1A9SA

Bovine purine nucleoside phosphorylase complexed with inosine and sulfate
Total Genus 84
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
84
sequence length
282
structure length
282
Chain Sequence
MQNGYTYEDYQDTAKWLLSHTEQRPQVAVICGSGLGGLVNKLTQAQTFDYSEIPNFPESTVPGHAGRLVFGILNGRACVMMQGRFHMYEGYPFWKVTFPVRVFRLLGVETLVVTNAAGGLNPNFEVGDIMLIRDHINLPGFSGENPLRGPNEERFGVRFPAMSDAYDRDMRQKAHSTWKQMGEQRELQEGTYVMLGGPNFETVAECRLLRNLGADAVGMSTVPEVIVARHCGLRVFGFSLITNKVIMDTESQGKANHEEVLEAGKQAAQKLEQFVSLLMASI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PURINE NUCLEOSIDE PHOSPHORYLASE
publication title Calf spleen purine nucleoside phosphorylase complexed with substrates and substrate analogues.
pubmed doi rcsb
molecule tags Pentosyltransferase
total genus 84
structure length 282
sequence length 282
ec nomenclature ec 2.4.2.1: Purine-nucleoside phosphorylase.
pdb deposition date 1998-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1a9sA00
4QEZA 1PKEA 3P0FA 5K1ZA 5CYGA 2OECA 3BGSA 5ETJA 4BMYA 5B7GA 4BMXA 1YBFA 1CB0A 1NW4A 3ONVA 1JDZA 1JDUA 1PWYE 4OJTA 1SQ6A 4DARA 3BL6A 3F8WA 5EPUA 3OF3A 4M7WA 2Q7OE 1JPVA 1PR2A 4R2WA 3FUCA 3PNPA 1Z37A 1TCUA 3NBQA 1Z38A 4QFBA 1Z5NA 1OTYA 4MCIA 1T8YA 2A0YA 2HSWA 4D8YA 3FNQA 4FFSA 1XE3A 4YO8A 4L5CA 4WKPA 4WKCA 1JDVA 3T94A 4F3CA 4QASA 4ECEA 3TL6A 4R2XA 3QPBA 1RFGE 2B94A 4K6OA 1B8OA 4F2PA 3KVVA 1U1GA 1RSZA 3U40A 1RR6A 1K3FA 5F7JA 4TXMA 1QE5A 3OOHA 4JOSA 2BSXA 1JE1A 2PGAA 1Z36A 1JYSA 1ZL2A 2AI2A 3KHSA 1PR1A 3LGSA 3K8QA 3DP9A 3P0EA 3UT6A 2A8YA 3INYA 3LA8A 5F73A 3EEIA 4GKAA 1A9PA 4NY1A 4LNAA 1ODIA 3BJEA 2I8AA 4TS9A 3OZEA 4LDNA 4QAQA 4PR3A 1V45E 2QTGA 5C80A 4WKOA 1ODLA 1A9OA 4TS3A 4P54A 4GLJA 1RXUA 1Q1GA 3FOWA 4L5YA 5CXQA 1K9SA 2QPLA 4TTAA 1TCVA 3NM6B 4OF4A 2OXFA 3E0QA 3MB8A 1ODJA 1RCTE 5IU6A 4TXNA 4QATA 2AI3A 1TGVA 1VHJA 4NS1A 3MMSA 1Z35A 1A9SA 5CCDA 4DA7A 1ODKA 1N3IA 1OV6A 1VHWA 5KB3A 4UC0A 1JDSA 3OZDA 2QDKA 3IEXA 4F2WA 4GLFA 4TTIA 1VMKA 1PW7A 4D98A 1T8SA 4EB8A 1K27A 1RXYA 1Y6QA 5JPCA 4PNPA 4NSNA 5FAKA 2ON6A 5F7OA 1U1CA 3UAYA 4WKBA 4TXLA 1YQQA 1VFNA 2IQ5A 1PR4A 1PK9A 3ENZA 1CG6A 3O4VA 1YRYE 4LZWA 3PHCA 2AC7A 3GB9A 2HWUA 4R31A 2HN9A 3OZCA 1LX7A 4OEHA 3BSFA 2XRFA 3UAWA 4F3KA 2OC4A 2QTTA 1Z5OA 3E9RA 1YQUA 2H8GA 4MARA 5B7PA 5CXSA 1V48A 4BMZA 1LVUA 1Z5PA 4F1WA 3FB1A 4DA0A 4DAOA 1ECPA 5EFOA 4KN5A 1SJ9A 1T8RA 1Y1TA 1U1EA 1V2HE 4G89A 1Y6RA 4DAEA 2ISCA 4TYMA 4D8VA 4E1VA 3UAXA 3PNSA 2HRDA 3OZBA 1PR6A 3OPVA 4IP0A 4QARA 3OCCA 4L6IA 3EUEA 4M3NA 1U1FA 3DDOA 1PR0A 4MCHA 5DK6A 5F78A 4L0MA 1Y1QA 3KVRA 4TXJA 1FXUA 3SCZA 3DPSA 1SD1A 5CYFA 1JP7A 3O6VA 1NC3A 2OC9A 4DA6A 1OUMA 4RJ2A 1C3XA 1JE0A 4DANA 1JDTA 3NM4A 3FAZA 4JWTA 1M73E 4WKNA 3FWPA 2A0WA 3IOMA 3PHBE 2QSUA 1YR3A 1B8NA 1G2OA 1Z33A 4OGKA 2P4SA 3GGSA 3UAVA 3DF9A 1RXSA 4M1EA 4G41A 3KVYA 1A9TA 3K8OE 4TXHA 4U2KA 5F77A 1Z34A 1U1DA 2RJ3A 1Y1SA 1Z39A 1SD2A 1ULAA 1RXCA 3EUFA 1A9RA 4LKRA 5B7NA 1Y1RA 3KUKA 1A9QA 5F76A 4BN0A 4DABA 4G8JA 1PBNA 1V41E 4GMHA 1RYZA 1ZOSA 1T8WA 1I80A 2AI1A 4LNHA 5F7XA 1A69A 4D9HA 3UAZA 4EARA 5I3CA 3NM5A 2A0XA 1V4NA 3KU4A 1OU4A 3D1VA 5F7ZA 3E9ZA 1V3QE 4I2VA 4TTJA 4YNBA 1TGYA 1PK7A 4H1TA 3C74A 4JP5A 1RT9A 3EMVA 4OY3A 4OGLA 5B7QA 4YJKA 1PF7E 1PR5A 3DJFA 1WTAA 1LV8A 1OVGA 4X24A 4YMLA 2GUWA 3OOEA 5IFKA 3ODGA 1NC1A 5CCEA 1OTXA 1TD1A 5EUBA 4DA8A 3LBAA 2I4TA 4D8XA 4L5AA 1ULBA 1T0UA
chains in the Genus database with same CATH superfamily
1XYVA 1D2RA 4RCVA 1DIGA 2GEUA 1L3IA 1WAMA 3HU5A 4H7EA 4J0KA 3MJSA 1KYIA 3B89A 3PUVA 4JKYA 2NVUB 4E14A 1DC8A 4LRWA 3A58B 4HY3A 4BB9A 2BI7A 3L0SA 1A7AA 1IQ0A 1RABA 3BXHA 3SS7X 1PHRA 2XE8A 2FXIA 5COAA 3CZ9A 1CIVA 2UDPA 1ZC4A 4MV9A 5K3CA 3VAYA 1X74A 1XJQA 4IJKA 5KKAA 3WKEA 1ST3A 3PLNA 4MDFA 1NW4A 7MHTA 2XMPA 3MK31 3TSZA 5G0SA 3SHOA 5MGNA 1SNYA 3ESQA 4ZI7B 4P4NA 3EMKA 1QHHA 4HQFA 4BGUA 1CZRA 1D1SA 1JHPA 3BQMB 3FUTA 4BATA 5L8VA 1DKMA 2H1SA 2CDAA 1IHXA 3B6MA 3K0KA 5IC6A 3UG6A 3ZGXA 3ON5A 2Z2YA 1G17A 4HFNA 2B30A 1XZAA 1ZD1A 3ABRB 3F8WA 3G82C 3OZAA 4K1XA 4KVGA 1Y5MA 5DH9A 3E5HA 4LI0A 5EVJA 2ZSEA 1U7DA 4BV8A 4DM4A 1WV1A 2NOAA 3LVRE 2OGWA 3O21A 3PITA 3CZQA 2JATA 3FH0A 2GN8A 4HB3A 1O1YA 4MV1A 3B9BA 1BDBA 3FPGA 3NIBA 4OHMA 3I1IA 1NR7A 3TOXA 1N5JA 5DB4A 4DCUA 3ETHA 1VB3A 4FDMA 1P72A 4AF8A 2DR2A 1LI4A 1DGQA 4W5NA 5AQEA 2B4TO 2V58A 3PNKA 4QU5A 3IIKA 1QHFA 4WRRA 4D8UA 1JJ7A 2P0EA 2ZJAA 3HYNA 4LHZA 3LXXA 1MN6A 4BQQA 5L3QB 3N0RA 4PN3A 1T5LA 1OLSA 1I3LA 2HF2A 3M49A 3QVJA 2XI4A 5KBYA 1TU0A 3PJFA 4GS5A 5F1KA 2XVXA 1KAGA 2R2GA 3A6KA 5FRDA 3UOGA 3KALA 3JAMA 4QAJA 2JCGA 1PJBA 1AZWA 3PPYA 3TLGB 1GSOA 3H42B 3K0CC 4LQLA 4QHSA 3H0KA 1EVKA 1OXTA 1L4KA 2ZBVA 4GBGA 2IOQA 3RUIA 4JP8A 2BM9A 3X2EA 1VZ2A 1JT2A 4ES6A 3DYVA 1U5AA 4DCCA 1G4UR 1QO0A 3EOZA 4ND3A 4NJMB 3KUXA 2ORVA 1UK6A 3H87A 1RJDA 2LCQA 3TL6A 1GSHA 3L1IA 4H0FA 1SB9A 1V8PA 2DUMA 2G25A 2D59A 2J0UB 4L22A 5EOVA 3I2FA 3RIMA 1GY8A 2A94A 2V7PA 1JA1A 2FE1A 4HV4A 4B3IA 3SEAA 3GLHE 4A82A 2EHJA 1P81A 1I9GA 1JG2A 1FK8A 4E21A 4P92A 4DF3A 3MCWA 1RR6A 1W8DA 4LUCA 4E6EA 1BDIA 3A9WA 3JQ6A 2HNKA 4HTFA 1K3FA 3UJPA 1E2FA 1JNXX 3WO1A 4WDRA 2Q29A 3O74A 4IGKA 4R1QA 1VFPA 3KETA 2AFIB 3ASZA 5LQJA 1SEPA 5JUWA 1TKBA 2XYHA 3FCAA 5FA5A 3WLMA 5JSQA 2ZJ2A 2OZLB 4GMKA 1YIOA 1BSVA 1M6NA 1Z36A 4QFMA 3MJFA 4DLXA 1QH1B 1W5AA 4CODB 1T1JA 2YXBA 4PGHA 5EP4A 3V2HA 3KOZA 1N57A 4ZWNA 3QWHA 2D62A 2DU8A 2FEWB 1EPUA 1VKOA 3TDMA 2XBLA 4I4TA 3WISA 4D0LB 4JV5B 1SBIA 1SCJA 4GPIB 4L08A 3CZ5A 1JZQA 1KWKA 1EFTA 3WB9A 3O90A 3G9QA 1B1AA 1TZ2A 5JNLA 3KB6A 3P26A 3O8LA 1GZ6A 4MLCA 2FR1A 2B8NA 3HU3A 7GPBA 2YRFA 3LDGA 2BFFB 1V7QA 1PVVA 3S28A 3FWKA 2B82A 2O2XA 1E1QD 1KNQA 1UF9A 2C61A 1TTQB 2PZJA 2EAUA 2W8ZA 1J8MF 1EM8A 5ALRA 3CRQA 4LDNA 3NAZA 5BP7A 3DZKA 1E6UA 1JXOA 3HI4A 1OIWA 5GZ3A 4UXJA 4P38A 4MWSA 2JVKA 3Q7EA 2RGNC 3EQ6A 3KUDA 4OM8A 1GIAA 4U7PB 1IIBA 5TMEA 3E2IA 2PUHA 1X13A 2YC4C 1L6IA 2PL3A 3LBFA 2G09A 3ASUA 2C03A 1PYOA 1RXUA 1LJUA 5KYXB 5L51A 3GAZA 2VP3A 1NVEA 3C1AA 3ZQUA 4JLBA 3N0XA 2LTAA 3HS3A 2XKKA 1NRJB 2VNKA 4AXBA 4OF4A 1A4UA 2H06A 2ZOSA 4ZD6A 4KSBA 4Q9NA 2ZS7A 1LGYA 2JHGA 3LHIA 1UJ6A 5EHGA 4ZGBA 4MRSA 1FLAA 1Y5NA 2C2MA 3ET4A 4NFHA 4CUJA 1TL7C 1VL6A 3CX3A 4RQUA 3EYAA 1H8HD 3MRXA 2RONA 3DMTC 4TXNA 4UVEA 4ZT5A 1ONNA 1BRMA 2OHGA 1BOOA 2JHPA 1LTHR 1DXQA 2VDWB 1ID8A 4IIDA 4URUR 2BGUA 4J0EA 3KX2A 1MHPA 3VKUA 3W7VA 3WLJA 2Z6AA 3DONA 4QU8A 2DTDA 5HDQA 2HHAA 3R6LA 4JX8A 2PXAA 5H5JA 3ZS8A 1LXCA 4O33A 5DNAA 3OQOA 4RLFA 1YGPA 4F4JA 1MHTA 3RC3A 2QUHA 1NU8A 2ILVA 1GYPA 2DWOA 4AS2A 4Q48A 1VSTA 5CUQA 5JRJA 4M0EA 1WXIA 2F3SA 3G8YA 2X86A 5L3SB 2BDEA 4B4OA 1J1ZA 1GNVA 3WLLA 4OHBA 3K0AB 1XROA 3M1YA 3HXTA 1XZLA 3PGMA 2BHSA 3F0TA 4MUAA 4W8OA 5B6IA 1CZLA 1RQPA 2I6QA 2YDYA 5KREA 1HE2A 2A0UA 2FQQA 3N7AA 1PJ4A 5K4AA 3RTCA 2QUKA 4HATA 3KRTA 2IXFA 3CO0S 4AY6A 3AETA 1MQ8B 3UKDA 3WNBA 2WHQA 5K8TA 1IBLB 3T5TA 2CFCA 4DG8A 1LBQA 2M6RA 2BTQA 1T8SA 3ND5A 3O9ZA 4HNQA 1ZJJA 2DPGA 1T0BA 4I4TF 4ZVQA 3T3PB 3MINA 1KIAA 4IX9A 3QXCA 1KKUA 2OR3A 4MWCA 1ZIDA 4KPEC 3PQ8A 1N25A 2ON6A 4BP1A 1V3TA 2G5PA 3HYTA 3JYHA 5EI5A 4OFXA 5C0OE 4WBNB 3MINB 4TXLA 1KP9A 3Q6NA 2F67A 1TJPB 1ZLYA 1P75A 4IDOA 4P0QB 4WXYB 2WWWA 1ISFA 2WWTA 2YVUA 1CCWA 4IIYA 2CSUA 2YHBA 3LUHA 3U7GA 3HYSA 2HWUA 4J1NA 1NRXA 2B4KA 1XA0A 3QVSA 4P7JA 3L92A 2HN9A 4MMYB 4XUDA 4IO1A 4JI1B 3VQTA 2IZ7A 4DIBA 2QIOA 2V9PA 1PNVA 1SVSA 1VMDA 3IQHX 2VZ9A 4KQ1A 4YPVA 1WBDA 4BO4A 421PA 1UC4B 3EFOA 4R5HA 2HJ9A 4F3KA 8GPBA 5C8DA 5TXGA 1K88A 5FI5A 1VJRA 3BERA 4L75A 4QRDA 3UFXA 3KWMA 3GELA 4B35A 4QOIA 6ABPA 1WNTA 3NALA 2OXEA 3HNOA 4XE5A 3OC0A 5AW8A 1WM1A 2PPLA 3VH1A 5CBKA 4U3JB 2CLOB 1GKLA 4GOOD 2YFQA 2F48A 2PKXA 2IZ1A 4EATA 1JSXA 3F8SA 1MC1A 1U5BA 2PEZA 2WU4A 2VA8A 3ASVA 3IBCA 3QLEA 4FFWA 2WU0A 4FW8A 4HYEA 4FS8A 2Q0XA 4Q7EA 4R3WA 4R84A 4J29A 4JXZA 4KREA 1W29A 3S55A 2CMHA 2PS3A 2ZRHA 3CLSC 3PNVA 3OJLA 4ENPA 1G5TA 2RFLA 3TE6A 4WNCA 1U90A 1AT1A 2YOGA 3GCZA 4HJRA 4G0PA 4PHFA 2XT6A 3GLFB 3U81A 2P5SA 4ERNA 2O3SA 4MWOA 2JLXA 1ABEA 1ZNZA 4MW2A 3WGHA 1GNLA 2ET6A 2G1UA 1MEJA 4ANFA 4WBXC 4PC2A 1WVGA 5KYXA 1VI5A 1PL0A 1NXXA 5E4JA 4C1BA 4XSVA 1JQEA 1X7DA 5EJEA 3ANMA 1DT5A 4HGNA 3FI0A 3W05A 1TF5A 3C1OA 3A7EA 1JQDA 1QQBA 5L7WA 4DCVA 1PR6A 2JH3A 1OIVA 2I8CA 3A26A 3D2BA 3OPVA 2PA3A 4UHCA 3UWPA 3WHLA 4KR2A 1WKVA 2Q5QA 4IWNA 1JJAA 1HSZA 4PYRA 4CM5A 1ZR4A 4QHYA 5AHOA 3LPAA 4L6IA 3EUEA 1PTKA 1J97A 4IJWA 5HQ3A 3B9QA 1Y7TA 4DGSA 1SO8A 2BRUA 1OFGA 2R6AA 4MI9A 1DMRA 1EI9A 1PJ2A 5MN6A 2C29D 2PT5A 2EF1A 3R41A 2QW0X 4F60A 2QRQA 4NZZA 1BE0A 5AJUA 4EMSA 3T7AA 4YRIA 3KVRA 5CB0A 1PGPA 1BCSA 2MIIA 3T9CA 3UCEA 4I4TB 3ZHZA 3CEAA 1QGED 1E4OA 2AVNA 2QQ0A 1ZXLA 2VOJA 3F6PA 3A4NA 4OYYA 3UV3A 4JI3B 4M8KA 2W37A 4M9RA 3GJXC 2H0AA 3HDGA 1E5TA 4R6WA 3WICA 4BO2A 3JY6A 4L85A 4WDQA 3AILA 1R64A 4GOND 1T8UA 3DE7X 4QQ8A 3RLFA 5HGJA 5KPDA 2WAYA 2PU7A 5IDWA 1IOVA 5AW3A 3B5IA 3G2PA 2EVWX 3JWGA 1EA5A 4ZYYA 3TTUA 4NYMR 1A2OA 4NMXB 1DJPA 5E6UA 4DANA 4RHYA 1R12A 3P4XA 5LBUA 1XCPA 2IELA 1GUYA 1QGZA 3M2PA 4IH4A 2XDAA 5DNVA 1NSFA 3LC0A 1PP4A 1GU1A 3I9MA 2WIFA 3L49A 3VR4A 5EMMA 4ZHSA 5FEUA 5BWCA 4B8YA 1DTSA 1A82A 3ZGOA 4FWBA 2C5LA 2A92A 1AUVA 2WP0A 4W9MC 1BVYF 3QBDA 5HR5A 5JAOA 2HLDD 2JFZA 1EDZA 3C5EA 1I5RA 4IOLA 3OTQA 2I87A 3E0XA 1XQVA 3JQBA 4G1UC 5IEBA 1QZUA 2X5KO 3ZK8A 2W2OA 2Q62A 4MGIR 4RV4A 1ESCA 1FFGA 1K4KA 1O94D 3E2PA 4J3NA 5FX2A 3SSMA 3KXPA 1V6SA 1L7AA 2OP0A 5B64A 3MF4A 5D3MB 4ZIRB 2QRZA 1IULA 4DCSA 2RHDA 4W6ZA 1N4AA 4RPHA 4BNVA 1IQRA 3TLGA 5BVGB 4R16A 4GH5A 3RFUA 1T35A 1NRIA 1SHLA 3FNIA 4NBKA 3A6ZA 2HJSA 4W82A 2BM8A 2H7VA 3VKFA 5KNDA 4NH4A 1B6SA 2DLDA 1SU7A 2PCJA 5EJGA 5FPSA 3SS9X 4F4IA 4OB8A 4JEIA 4RA9B 4U2KA 4WHMA 5AW2A 1UFKA 4G85A 1ULUA 4L5IA 4L4RA 2E4VA 1SD2A 4GG1A 5DM60 4CV3A 4AFNA 3DMFA 1GUZA 3NP7A 2FXVA 2REBA 3AESA 3CB4A 4PW0A 3QVUA 3CONA 3I0ZA 3IESA 1GM5A 5LP1A 3C3YA 1ORWA 3O4IA 3OEHA 5F76A 4I81A 1F6WA 3UB2A 4DABA 3GJ5A 3SN6A 5JISA 3R7WA 4BU1A 1I01A 4XVQA 1RYZA 1N2GA 4BMPB 3OOSA 3I5YA 1NW5A 3A1EA 4BFWA 4N8EA 3S27A 4F97A 3T3DA 4HLNA 5BMVA 4WD3A 5DE3A 1PDWA 2IUFA 2QXYA 4FIZA 4LHYA 4YEDA 1Z6PA 3A9CA 5HEKA 3HB5X 5LM3A 1EWQA 4D9HA 1C9EA 2AUMA 4A10A 3H5TA 4L3WA 4MV7A 4XASA 1UQUA 4ZOBA 3AF3A 1SEVA 1YRLA 4MOWA 4KVAA 3RG2A 4ZI7A 1QFXA 2EU8A 4EP1A 2NU8B 5KEIA 3MAGA 3ZJYA 1LPMA 4BDSA 1FVXA 5CITA 2YTZA 2POCA 4X60A 3L06A 4JOCA 4CRWB 1GNRA 1S7GA 3O38A 4E4TA 3U7QB 5FBVB 3SC2A 3AXTA 4Q1VA 4YH1A 1UWKA 5IH3A 1HKHA 4EJSA 1RWQA 1WL8A 1FNDA 1U0GA 2O2JA 2HV9A 4C2AA 4CMJA 4GKVA 1ST2A 2PBZA 3QXJA 2GM5A 5FOTA 4YRNA 4EMTA 2IZ5A 3DULA 1WY7A 5B58T 1LPSA 3CGWA 5IHPA 4PIVA 3D8SA 1V95A 1K63A 3RS8A 3U6KA 3H7IA 1B2LA 1YQEA 1K2WA 2AFHE 2X1HA 3KKOA 4PYNA 2WILA 3LP8A 4MYCA 3VJMA 3VVLA 1FC0A 4M9SA 1QGOA 4O1HA 4RPJA 4A5OA 3KG2A 4IIUA 4FMDF 3N8NA 3AP1A 2GZ3A 3O75A 3VV3A 3HA3A 2EFCB 5LCXA 2Y93A 4DQ0A 2ZYGA 3NDJA 4FMCF 2VRBA 3IP7A 3O8QB 3VYTB 1M34B 1RTTA 5I7WA 5JZBA 4UTOA 4ZCPA 4LK3A 3O3OB 3OPYI 1K7CA 2B21A 5ERYA 4EPWA 1DIBA 2RHGB 4BKQA 3EPKA 4RS3A 1CEXA 4EB6B 2XR1A 1OKKA 1U8FO 2YDXA 3IMGA 3OIDA 1YXMA 4BE9A 3M8KA 3W8FA 2FKAA 3WKBA 5SY4A 2EWWA 2AUNA 1E1MA 1Q7CA 5LIRA 4DA4A 5K99A 2J41A 1FUEA 4BB5A 3MMPA 4Q3NA 4DA8A 3LZ6A 2EX1A 4TMZA 2BFFA 5HCIA 2IY8A 3W5HA 5J4VA 4B6JA 3HBLA 1JBKA 3N2EA 4WV3A 2JS7A 4FPXA 2CL6X 2ODWA 3RSHA 4XD7D 4O2AF 4QE3A 4ZQIA 5GVRA 5F2OA 5DI3B 3RS7A 1QIGA 3LNTA 3A4MA 4LJ9A 1OGJA 5DT9A 4BWVA 4UREA 2FUNB 4OLFA 2FG7C 3DA8A 2UYOA 4Z9YA 5JC1A 2RKWA 2H9IA 1LDGA 1TUIA 3JQ8A 3N58A 3ABIA 2J32A 1LF5A 2A5GA 3FZEA 2QX4A 4UM9D 4WL0A 3SE0A 3FUVA 2I2WA 5J59A 3V3TA 2XNCA 4I55A 3R9XB 2OZLA 2O1SA 3JQ7A 4RHUA 4MS4B 5H3CA 5I6DA 1KERA 3VNBA 3BAFA 3I73A 1XPOA 4R2KA 4QJ3A 4QOSA 5JDIC 3CLUD 4IOJA 5KHOC 1C1DB 2O3TA 3KYCA 2AN9A 4UHEA 2W2PA 4YPOA 2IYAA 3UUGA 4ZOQI 4N7RA 1OZ0A 1YVPA 3OF3A 3WMWA 4YCAA 3GA5A 1PKXA 3JAWB 4CUKA 4V38A 5A3JA 3WJAA 2QTNA 3HCCA 2Q7OE 2ONZA 1L5MA 1KDVA 1ZHHA 4DWJA 3IIMA 2CNDA 1N2SA 1YA8A 5CLFA 1DRJA 1KWGA 1U2GA 1BE1A 3HZZA 3NBQA 5JS7A 5CJPA 5JFGA 3ZNQA 5ITVA 3B7GA 3VR6A 1WHTB 1C1XA 4TWRA 4PG6A 1FLNA 4BLQA 2EERA 1C3OA 2QV0A 3PRYA 1N7HA 5CURA 2CYBA 4IR7A 1FQJA 5HFAA 4XIJA 2XVZA 4FHGA 3UGQA 4WNAB 3BTUA 2DVMA 3AIOA 4LYHA 3CH5A 1SUBA 4G2NA 4OHKA 2ZI5A 2H92A 4RE6A 4J2HA 5IT0A 4YO8A 3N5CA 3LT4A 4YUVA 4CI9A 4WKCA 1LLUA 5JANA 1KDTA 2AD1A 5I5GA 4F4CA 1QIKA 3P9KA 5LXTF 3SVZA 3ZLUA 5KSYA 2X7JA 1N6LA 1JF8A 1UADA 3KKZA 3MJTA 1N75A 1JDJA 1LI7A 2CY0A 1IG0A 1FS6A 1GZ3A 1UJCA 2EBHX 1G21A 3IKLA 5EUQB 4M0LA 1PQYA 4Q05A 4DDVA 2PUJA 4IIHA 1Y9EA 2E6UX 2ZRIA 1M9NA 4AROA 2XEDA 4URVR 2UZ4A 5J43A 1WVIA 2QDXA 4TYQA 4NHEA 3NPAA 3QX3A 2Q9UA 3P9XA 4C20A 3PIDA 1H42A 2JLQA 1DWQA 2YS6A 5HKAA 2IRWA 4IKOA 4PZPA 2HFKA 3OZTA 3JQ9C 3KQPA 3LO8A 5IJ0A 1WDKA 4XDZA 2UZIR 3GPBA 3I61A 4CKWA 3LVQE 4YJ2B 5EJ8A 2K6GA 3E8SA 2PKCA 3D5TA 3H4MA 2GRJA 3QFSA 3UT5B 3VC1A 3UXYA 2HSDA 4C3ZA 2A9QA 1DC4A 3AM5A 4IRUB 2P90A 2VJLA 4CFYA 1M2HA 3SYLA 3JSAA 1CS0B 1RI5A 2CNWD 1SUAA 4G56A 1TF7A 5K51A 3VOAA 4HAZA 3AYZB 2C82A 2PWZA 2ZCVA 3RRYA 1DZIA 3MC1A 5TVGA 2O8CB 4F7DA 3GFTA 1DO2A 1YNOA 4B81A 4DMFA 2JLRA 2IXDA 2Y76A 3AU8A 3DP9A 5CNMA 4JFRA 4YP1A 5LYJF 3AVTA 5EJMA 5U9CA 1J56A 5DPMA 1SCUB 5LN1A 1AS2A 3GBVA 2R11A 3PUKA 4FFPA 4LCBA 1GG2A 2QA5A 3A4TA 1KZ7B 4UMFA 5K3FB 2VT6A 4L9AA 4NF2A 1WEHA 4OH1A 4P7GA 3TAHA 4GKAA 2X8JA 1MFPA 3G02A 3W5JA 3OY2A 3EQ9A 5EY5B 3VSEA 4DG9A 1YVEI 4NY1A 1DAHA 1JJFA 5KU7A 2YINC 1W2WB 2G82A 3KDPA 1CR4A 3O2NA 1C0KA 2RB4A 3L8CA 5DNYB 1TTHA 5KVQA 2HLDA 3TGLA 1UDBA 2YWGA 4QGFA 3TPZA 1L4UA 1ABBA 4I4CA 4ZQCB 4BGVA 1HNNA 1N8NA 4K05A 4YXWD 1OAOA 1EP3B 2NU6B 3OCZA 4F93B 5DYTA 5TARA 5LOVB 3OX2A 2GAJA 4I50F 3E3MA 5FTNA 3VOSA 1KXZA 4KIJA 4S12A 5BQFA 3GRUA 4XVUA 1H22A 2YV5A 2PKYX 2QK4A 1EK5A 5F5XA 1MENA 1U9JA 2Q4DA 3AERA 3NOQA 3VZQA 3MGAA 1IH8A 3K30A 4UUQA 3A3PA 3FKJA 4F4HA 3GYBA 4ZK2A 2ZR9A 1XKQA 2JBWA 3CRW1 3EXHA 3KOOA 4OFZA 1E6CA 4JK3A 1X3SA 3DVRX 1CF4A 4ND8B 1GDDA 3O0DA 4WCFA 1F1JA 4JELA 4N0PA 5DOZA 3F5DA 5EIAA 3B48A 4Q15A 5ALMA 1YT5A 5E1OA 1P2VA 1N2CA 4Y2PA 1LSUA 1NWHA 1GR1A 3TLZA 4X7PA 4AN1A 2CZGA 1KARA 4XPIB 1AOXA 4B7AA 3L4BA 1TA4A 4YAWA 1QCDA 4B17A 1MAHA 3PHLA 1KY4A 2VYVA 2I8LA 4V0QA 2COKA 2ZU6A 2AJDA 2JGFA 1VHJA 2JLAA 1HGXA 1ZMOA 2FLWA 1XL0A 8MHTA 4RFSA 3WK4A 4DA7A 4MXDA 2QTLA 1NF2A 4QG3A 5ADHA 2BEKA 1T24A 1XXHB 4MYRA 2D0OB 4HDSA 4DILA 4XEUA 2E4ZA 5JXWA 1HEIA 3D4IA 3KWJA 3P97A 3MBIA 4EKEA 1ZUIA 4BB6A 3IXQA 1VE5A 5SYAA 1F5NA 4XWAA 4KB5A 3OZDA 2WFAA 4OHYA 4TT3D 5KOHB 3BHIA 3A1UA 3BBPA 1XLUA 3TM4A 1ZW1A 1BMFA 1UAYA 1NMYA 3R7AA 3KFLA 3F3KA 3PZBA 3WWPA 1VPTA 4JI5B 4JQYA 2GO1A 3UJ3X 4ENTA 2AEJA 3JQAA 4TTIA 3GAAA 4HS4A 4XDYA 4XM1A 1JL3A 3N2ZB 1NZJA 1O9HA 1ODTC 3D59A 4PBRA 4EB8A 4Q9JA 4K9KA 1PS8A 1EXWA 4V0LA 5DFAA 4YMUA 4YRZA 3N7TA 4YJ2F 4D3YA 1ULZA 3OM0A 5JPCA 3DZDA 1ZUNA 1Z47A 2JIPA 1L4HA 2WF8A 3N8GA 3MUEA 3ZGLA 4EYEA 1F2TB 3URKA 2OBNA 3E18A 3I4LA 3N2YA 3TVTA 1TD9A 4PZZA 3M6AA 1VFNA 1GTMA 1XDDA 2IEAA 3H1GA 3KB2A 3QPCA 1V5GA 2GTHA 3AGQA 2ZYSA 3D6NB 1ITZA 2HTFA 3LP5A 4XFKA 4XYEA 2CXSA 4ZMBA 4A8JA 4R31A 1TO2E 2JBHA 4M1ZA 1F4LA 4UJ3A 2JI7A 4BO5A 1B42A 1Y5LA 2OL4A 1FA9A 3MQ2A 4IZOA 3RC8A 4OHXA 5KDOA 4C4YA 5DXJA 1EUDB 1UIRA 1HDRA 1U7PA 5EIFA 3BSFA 1JAYA 2QRPA 1FL9A 4L0CA 2Q2NA 3GUZA 4MUFA 3VTKA 3ZWVA 3IERA 2A6PA 4NZPA 5DX0A 1RPZA 3RLIA 1XC7A 2YZGA 4J03A 5ARBA 4JENA 3AR2A 1O97C 3G1UA 4RMHA 1YHZA 1E2GA 3FI9A 3C45A 1Z5WA 1ZK1A 1K98A 1BAPA 5HMMA 3D54D 4WJLA 4KQIA 3RF7A 1IM8A 1G55A 3ZWQA 4WOKA 1QO0D 3HVRA 2Z1NA 5CVVA 4N39A 1HNWB 3BMOA 3QQ5A 1FTSA 4HBGA 4YLYA 4XUEA 1IUNA 4ZRNA 4EGAA 1O0SA 1OWPA 4JYMA 1DLJA 3OCVA 4K6HA 1II0A 4R6XA 5HX7A 2OYRA 4DA0A 2R5NA 1NSYA 4KPUB 3AFOA 1NVXQ 4OU4A 4XOUA 4PRYA 2WZQA 4X6XA 3HLKA 4YIKA 1XLWA 5FP0A 1MC5A 2PNJA 1FFXB 3RT9A 5JMOA 3WGJA 2DPYA 5DBGA 3OQMA 1CZUA 1R4ZA 4JJ6A 1ZRHA 4X41A 3ZKWA 4OLBA 4YMVA 1Z7YA 1DDIA 1F8UA 2JJMA 5KTKA 1MW9X 4TYMA 2OYSA 1KEWA 4Q4CA 5K0LA 4UNRA 3QWAA 4HF7A 4B44A 3FLEA 2VYCA 3OQHA 4EYQA 4ZDJA 1YZKA 2R0QC 3SXUB 1NASA 2DERA 3B13B 2Y0CA 1UXJA 1XNGA 3C6BA 4R3UC 4JROA 3EGDA 4DGQA 4YMWA 3T0IA 1XDGA 1RMTA 3DZFA 2GCEA 3BMXA 3PXAA 1SULA 3GGGA 3EDRA 1JLKA 1J0EA 4TL9A 4YECA 4A0SA 3ZCQA 2HMWA 2NU6A 1BE8A 5SZIA 2BUAA 3FPLA 1E9DA 3BRQA 4B85A 2OD7A 1GAXA 3N6XA 1FXWF 4F06A 1PL8A 3SMVA 1VYHA 4NEQA 3PDIB 3IAS6 4DWVA 2X6RA 3A2LA 1QVWA 2XTNA 2QLTA 1PWZA 2B2XA 1YVUA 1MIOA 2ZXFA 1YO6A 3KSDO 4HK4A 1VJ1A 3OD5A 3TRIA 5EXTA 2HGSA 3HFGA 3L6OO 1XL1A 3TD6A 2BT4A 5FTLA 1U6IA 3ND7A 1G0OA 2OB2A 2XODA 3AUUA 4PG4A 2FPWA 2HQ1A 4PLYA 2ZIFA 5JCJD 3ZW9A 3JQRA 2IYRA 1K8RA 4LTDA 5AXAA 5IVIA 3WMXA 5DOVA 3RHFA 3NV9A 1FUUA 4JA2A 1KP2A 1T5OA 2Q3HA 3OP4A 3SYRA 2VWQA 2MMGA 3QYPA 4RLHA 5ITSA 1YTLA 3QTBA 3JTEA 1ZFNA 3LHSA 4HQNA 3SJUA 4JWTA 4YCDA 4HUTA 5B4VA 3AUFA 5E3IA 4HZIA 4DEVA 3Q10A 3QKWA 3ZHTA 3SSNA 4XVHA 2W2VA 3VA7A 4F2HA 3DFKA 3BCHA 1G3IA 3BK2A 4P35A 2XRYA 2X4GA 4RKYA 4AECA 5KX5B 2WB2A 4A15A 2AOUB 2WY2D 1ODCA 3VISA 4IVNA 1CQJA 2RGWA 3DSRA 2ZT8A 3VDRA 2IGBA 5AXDA 1IWOA 4WK4B 1Q7TA 5KTSA 2CFTA 2FFAA 1SU8A 2C83A 2Q0SA 1GQYA 2GPAA 5IYZA 3W1WA 3ESRA 3LUDA 4IZ6A 4UUOA 2QZZA 1ZBDA 2CVHA 4CL2A 4F2GA 5IKMA 1EVYA 4BC1A 2G9QA 3H1PA 5KNDD 1ZA2A 4GHWA 4Y7CA 3ANSA 5IFLA 3HXMA 5REQA 3SYKA 1ZGJA 1LWNA 1V8OA 2GHTA 1QQ6A 4JT8A 2EHDA 3MTEA 4MTCA 3GP3A 4YRFA 4I1VA 2JANA 1KVRA 4M0CA 1OHHA 1H3FA 4BBJA 3LHKA 3SP1A 3MWGA 4BKMA 4YV2A 3V8EA 2VJPA 3OIUA 2P67A 4UXIA 3W8EA 4EJ2A 4IGFA 4JLAA 2VBFA 2HWWA 2R1ZA 3IO3A 2UVPB 4G8JA 4BWGA 1A9ZA 5JCPA 2ZU0C 4R54A 4TUYB 5H1YA 4JITA 4GIBA 3GD5A 4KO2S 4REQA 3OUZA 2X5OA 3TXYA 4E0BA 2OB1A 4ZVTA 2CFOA 3CKYA 3HDYA 4F45A 4KQCA 1RJWA 3DR5A 2AI1A 4XJTA 4FZ3A 4XUCA 4K6KA 3CN9A 5IM5A 2JARA 2O0HA 3ZWAA 5E6SB 3VXKA 4RKEA 3LUBA 3KBBA 1PL7A 2VHJA 1UJBA 2ZR8A 1S2LA 3MN1A 1WD7A 5CGQB 1UKYA 1U4NA 2G1AA 3EC7A 2ZQYA 2ZRGA 2WYHA 3AUSA 5EMNA 1WMSA 1AKWA 3S3TA 3UN1A 3CUKA 3JAWA 2OGUA 5F7ZA 3V55A 4KBGA 3R5KA 2C9MA 3SZRA 4MS3A 1EJ0A 4UEJA 2W6NA 1O5IA 4DXDA 1C1DA 4MWTA 2OHJA 1TQHA 3I8SA 2QAJA 1F0PA 1CJCA 1GDTA 3HLYA 2PZGA 2HKIA 5DCWA 1W6UA 2V7XA 4F6RB 5DM70 1E4YA 2ZTVA 3VTZA 4DR3B 2IDZA 4YMIA 1VJCA 1V4VA 2AXNA 2QP9X 2IZZA 1R8XA 1KDRA 3FB4A 5K6RA 1QOQB 1J0DA 2BUBA 3QI7A 4PVCA 3VJRA 4NU6A 4C0AC 4H3VA 1BE6A 4BUZA 3OZWA 1N9KA 3LRXA 5BYBA 1Q14A 4UCQA 4XCQA 3RTEA 2PR7A 1WRBA 4RSMA 4C14A 3J81k 2KBEA 1CD5A 1EZ4A 3H19A 2WTEA 1W96A 1U8YA 1PGOA 3M6MD 3TXAA 1MR3F 1BEUB 3M83A 4FGZA 4RMGA 2N0SA 3WRYA 1QK3A 3EZLA 3QVMA 2PGOA 4KH1A 2XB8A 2ZUFA 3GN2A 1G3UA 3Q3HA 3I6MA 4DCJA 1DC7A 5TMPA 3QNMA 4WN3A 3AZQA 4UDNA 5LB4A 4BBAA 5JDCC 1GPYA 1U0FA 1H4QA 1ZCBA 3NQ41 3G2OA 3T54A 1FP2A 4C7KA 3N59A 2WKRA 2H5IA 1WETA 4ZFNA 3AJAA 3AWIA 3SG0A 1QH8B 3QH4A 2YMLA 1JFLA 1JI3A 5C8ZA 1E0SA 2VF2A 2NT3A 1DIHA 2I4TA 2IXGA 3IPAA 1C80A 1I4WA 1U11A 4ALIA 1M34E 3EVCA 1XDSA 3BMNB 1C4OA 1OX5A 3EDQA 3K1JA 3AZOA 4D26A 4Y6RA 4YS6A 2WNIA 3ZHOA 2DX7A 3BIXA 4OQLA 3O3CA 4Y67A 1XLTC 1GXSB 3T0FA 2BFWA 5L4NA 1M7GA 1CVLA 3DBLA 5THKA 4CL3A 3TO5A 2ONCA 3UIEA 4QUEA 4IDQA 3S81A 1LKZA 1GCAA 2HF7A 2V97A 3IAEA 3VMMA 1NZFA 2IEBA 3N6VA 3RTAA 5ECGC 4IUBS 3V4OA 1P7PA 1M1YB 4EZIA 4ZI5A 2XYPA 4IL5A 3HEBA 4U7HA 3B3AA 4CMEC 1EQAA 1II9A 2GAIA 3WB1A 4LEIA 4G5HA 3U3RA 2OILA 2JCXA 2A58A 1X3LA 3CG4A 4YXWA 3V6MA 4BUCA 5IVPA 3N0VA 1HLPA 1AGNA 1UODA 5CX1B 2QMQA 4M76B 2YJGA 4DARA 3BL6A 2HH9A 1XV5A 1TCAA 1T3HA 2VP5A 2PYIA 3C3CA 3GHYA 1U0JA 2J4CA 3P71T 2G5TA 1DBPA 2IYVA 3PDUA 4ADSG 1E3WB 1FFEA 5JJKA 3P20A 2OEPA 2D1SA 2QD5A 3R5FA 2YXNA 3FCUB 3WZ2A 1CF9A 1NJGA 1ECBA 2AC2A 3ERCA 2CVZA 1JEQA 1Z37A 5FL7A 3T7DA 3P9IA 2ATCA 4H60A 5FWXB 3IBGA 2QE7D 4M9CA 3P0JA 1UXOA 2XT0A 4MCIA 1RJEA 1DP4A 1WDTA 2Y1XA 3H6KA 1Z0UA 3R3HA 4UHFA 3C6MA 2D06A 4Q4HA 4U7GA 3M6LA 5H81A 4TVBA 4LKOA 4QUGA 4B76A 4DJDC 1NI5A 2H5LA 3SY8A 1XRRA 3NRBA 3LK7A 2RGAA 4OSOA 3H4TA 4KVZA 4LV6A 3TSWA 1CZNA 1AKEA 4PQFA 3WRWA 4MI3A 2W8BB 1ZH0A 4FE4A 4NBSA 2R1UA 4I9GA 3ND9A 1KZ9A 2J45A 2H1CA 3BZBA 2J09A 2QM7A 1HYHA 3GH3A 4MKGA 3W1EA 1SPBS 1RQXA 2GPWA 1ZD9A 2IHNA 2JHCA 2P8SA 1KAOA 4CNQA 4D81A 2UUPA 3Q9SA 2XXAB 5EUCA 1KYQA 2AFVA 2HDWA 2NQ8A 2RAPA 2REQA 2YYZA 5DTEA 4ETWA 3MM4A 5A5VA 1NATA 3NHRA 3ZVKA 1B8OA 5F5LA 3EEQA 3OWOA 3S8MA 2CNOA 1HR0B 2WB4A 1XJWA 3A1FA 3RIEA 2FVYA 3BD6A 3CR8A 3QV1A 4ZIRA 2JFQA 3EZ6A 4TKMA 1OX6A 3OTIA 5DCUA 1IJFA 4MVWA 1C7ZA 1UC9A 4N0MA 1BD4A 3CF4A 3ZEIA 3CPEA 5ENDA 1KOFA 3ZI4A 4F5ZA 3MS7A 4QT0A 5GPBA 3Q5EA 4OL9A 5C5CA 5ALUA 4BFCA 4EA7A 3TOCA 3I53A 3DHVA 2PUWA 3LXMA 4X6UA 2ZVQX 1Z6YA 5I9IA 4M7RA 2R65A 4D45A 5NULA 3EQ7A 5FORA 2BSXA 3C3JA 1EFVB 3PUYA 3NBXX 3BL8A 1DOZA 2OCGA 3C3EA 3DT9A 3JQFC 5LA6B 4KR9A 3W9YA 3WNQA 2FZKA 4BYMA 5B6JA 2HEIA 1KL7A 2V9CA 1Y63A 4WBNF 3IEIA 5D5HA 4DDUA 3W8RA 1JQBA 3V8NA 1JG7A 4BJHB 4BP9A 3FKSA 1A9XB 3Q1LA 5TGTA 1E79A 4QEKA 1L5HA 1F06A 1PTJA 2VZLA 4YAUA 1YZQA 3MLAA 1SBTA 5FWYB 3VR6D 1IPHA 4IMIB 1NKSA 3NETA 4PZDA 1OLUB 3A3NA 4XDHA 5G40A 4RM3A 2QB5A 2VJDA 5A0FA 2R84A 1XQ6A 1RYNA 3SFZA 4LQ4A 4BEBA 2JI9A 4MQ4A 4DPMA 3TCNA 1XD9A 4ZICA 3C6KA 3EIWA 3EF3A 2C2BA 1AZTA 1S8FA 1SQ5A 3NIFB 2WSYB 5EVCA 4MKIA 4CQMA 1MF7A 2I8AA 4RTPA 5AK6A 2VH2A 1GADO 4EFMA 3HBFA 3H99A 4GWGA 3G7SA 2E1RA 1X8JA 1QC5B 4LXHA 3AZPA 3GK3A 4BUJA 4BHTA 1KK3A 3U1BA 3GNQA 1GZ7A 1V43A 1VLMA 2BF7A 2EJBA 2YOFA 3LYHA 2CLKB 3L79A 3V7WA 2W11A 2Z43A 2OORA 1S3GA 2H57A 3GROA 1T5BA 4WKOA 3GCXA 5AT1A 2NQ2C 2APJA 4HWPA 1H6AA 1RIIA 5FT9A 2WKSA 3WL7A 2CHEA 2WMYA 2I4LA 1XTUA 2DBRA 2QSZA 2X0FA 3FOWA 3NDBB 1ZD4A 2ZGVA 3IBTA 2X14A 3W2HA 5JXGA 1DXYA 2RHJA 1VXOA 3D4OA 3MWJA 3VR3A 1RKXA 2QPLA 1G8YA 3BXPA 4KAFA 2VSNA 1VG0B 3O1IC 2ZPUA 1ZR2A 5DV9A 2V45A 1AKMA 1EU1A 2QX6A 1A04A 5EG5A 2OM6A 2ZTLA 4X95A 4FEEA 2YHUA 2PMCA 2FX3A 1II8A 2IBTA 2IUUA 4LF9B 2R87A 4IDDA 4CKYA 3N86A 4E70A 2FPKA 3K05A 5I4CA 2VHCA 1O97D 3ED5A 5J40A 5TQ0A 3UMJA 4HQ0A 1DVRA 2FMKA 1ZRMA 2ZUUA 1DSSG 2NU7A 3H1EA 5C1PA 1P6QA 5IP5A 4C3UA 1AQNA 2IS6A 4ZQFA 2O0JA 1PGNA 4V0SA 2PBLA 4JBYA 3VFDA 5HOQA 3RKSA 3UA3A 4DDWA 4KQMA 1DJOA 3E9EA 3U0BA 3STTA 4LV5B 3WMRA 3H5NA 4AULA 3ZGNA 3ZHQA 1P2DA 3S2GA 1DUSA 4R8MA 1FOEB 4HX9A 2COUA 4A6PA 4AP6A 3FR7A 3EISA 1TVCA 4IWXA 3RRZA 3IVRA 4DBLC 2YIVX 4DV6B 2D4AA 1EUQA 2DR3A 3G2NA 5KQRA 1OPXA 2GAFA 2QORA 3R0XA 3U39A 4CV2A 2DFVA 2RH9B 4IF6A 5J3JA 3KTDA 1Q7BA 1YU9A 2VYQA 2WLSA 5K8VA 1NQTA 3I23A 1ATIA 2EYUA 1OA1A 1AM4D 4UARA 4ACAA 4AZ3B 4X3CA 1L5NA 2V7TA 3EGCA 2QPOA 1BDJA 2EQAA 3H11B 3GR6A 4E30A 1N36B 3B7WA 1M6VA 2VLIA 4IGEA 5CRIA 5JSUA 3T12A 4NSNA 3SD7A 3FTCA 2KJQA 4CF7A 3MPUA 3UAYA 3TX6A 4CXMA 3UMCA 2DM6A 3W5DA 1CDDA 4NG4A 3TZHA 4PZUA 5AVJA 1WDWB 3V34A 1GD1O 1KK1A 4H4CA 1K68A 4N6OA 2AC7A 1X2EA 3OZGA 5T3UA 5GIOE 3GMTA 5I9SA 4J4HA 1UBLS 3O2QB 3FSJX 4MVYA 2WR8A 3B3JA 3OEED 3OP1A 3UICA 4KPYA 2GD1O 2WU1A 2Z30A 2YHAA 1F0KA 5IAEA 1MO6A 3RE1A 3U4MA 1Z4KA 3ZH9B 3A32A 2W0MA 2RBKA 3V1TC 2K2QB 2R8RA 1Z9BA 3FYUA 3WQSB 3JQEA 1R1DA 5E4YA 2EWMA 3U3OA 4HCJA 1MX3A 1KI2A 2JBAA 3WRYC 3IKMB 3NFRA 3EMDA 4AY5A 3M3HA 1DO0A 4RH1A 1GQOA 3UK7A 2GZSA 3AIIA 3K73O 3D6AA 5ALYA 2VNJA 4QYTA 4NDAA 4B73A 1FDIA 3ZJUA 2ZYDA 2D1TA 3PQ4A 3GLGA 2VIIA 1JMVA 2P1ZA 1V11A 4DADA 3EBOA 3NHBA 3M1IA 4YACA 5J58A 1YOVB 1KMIY 3F7NA 3ABQB 3KOMA 5FOUA 3EOAI 3TLXA 3CR3C 1SXJC 3PENA 2PR2A 4BVKA 3ADBA 3KQLA 1ZN7A 3NTXA 1BXRB 1DELA 3IP6A 1U1EA 4MRMA 4TV9A 1O4WA 1Y3AA 1HFEL 1IAVA 4MVJM 5G53C 4CBVA 1QOZA 3OQBA 4WIAA 1FE8A 2GUGA 4YA6A 3V8MA 1YRHA 4F8YA 1M72A 4ZOAA 2EGGA 2XLCA 4NAHA 2AN3A 1GL6A 1JQ5A 1K6EA 3GEBA 4J0HA 3TVYA 2JZNA 2NZUG 4AD8A 4XRGA 1F0NA 4BCCA 4QYSA 1CY7A 4L74A 4A8JB 3OJEA 1U80A 3SPXA 5BW6B 1NJ2A 2WJWA 4MW1A 1XZEA 3NYQA 4LCEA 1P4JA 2FEMA 2QMEA 4QARA 1E1KA 2X0JA 4B0OA 4FBMA 4IVPA 3SE7A 3RUDA 4K9LA 4B3XA 5LYJB 4RETA 1UOQA 3OT5A 3DEAA 1Z12A 1IOLA 1H0KA 1T36B 2VA9A 3G8AA 3JQFA 5G1NA 2MR6A 4HX2A 1T43A 4BLPA 1RMYA 4JLKA 2VDUE 4UNNA 4CMBA 5KKCA 3Q2OA 2PGLA 3LU1A 3NRJA 2WAAA 5AK3A 1OT5A 4Q12A 2VVTA 3M81A 3RYHB 1WU8A 2WJHA 1TAQA 5HOEA 4GVLA 5KU1A 3ZWWA 5I01A 4C4SA 4E46A 3PCTA 4ZPXA 1RM0A 1ZXBA 3TNYA 4KGZA 1XMXA 4LPKA 3K3PA 5B53A 3ER9A 4RJ2A 1GP2A 1U8UA 3W34A 5AW6A 5FDFA 4IYRA 4YUXA 3BWDD 4E33A 3PSHA 1B7GO 5JAZA 2AHOA 4L8YA 5M29A 3CXUA 2B7CA 1IOZA 3AINA 3NX4A 4O5AA 2ZZKA 1E3MA 4Q00A 2V1XA 3PXBA 3FF4A 4EBFA 3ESXA 2J4FA 1K5GA 4R1NA 4MA5A 4KXMA 3UWOA 5TB5A 1C7IA 4CTOA 1E3SA 2YASA 4YRAA 2QGFA 3DFMA 2A0WA 2P9TA 3K2QA 2WYOA 3PHBE 1HE5A 2J31A 1QIIA 2ODTX 3HJUA 3VZPA 2DB3A 1Q0QA 3RJMA 2BI4A 5AKZA 1AHHA 4Q4AB 3T3IA 1YWGO 2PTGA 4OK5A 3FETA 4J3JA 4FFBB 3W9SA 3WK7A 4CDGA 4G4SO 1X8XA 2BCJQ 4FYVA 3F73A 4U6QA 2Z9CA 3ZDCA 3QLUA 5D1HA 3K1AA 2B69A 3TFQA 1GZHB 5K7SA 3TH5A 3P9NA 4MJXA 2GXSA 4R1OA 3KVYA 1IEVA 3NKFA 4CMAA 4Q47A 1PSWA 3AL0C 4J7XA 5JCOA 1J07A 4ZZ3A 3KQUA 1T9HA 4DOMA 2CNLA 2H1IA 1F5SA 4C4XA 4LGYA 3W6PA 5ERXA 2B5WA 3K9NA 3AM4A 4TWBA 3RADC 9GPBA 1Z39A 3QKRA 4QBGB 1FZTA 3A36A 2LR0A 2Q3DA 4V39A 4ZTZB 3KUKA 5AJZA 4ZA2A 1YZTA 3D4PA 1VBNA 2GAOA 2IFTA 2Z3ZA 2JLZA 4CLRB 4WLOA 1EA7A 1DC6A 1LVHA 2FMFA 2QQEA 1HDYA 3DB2A 2PO5A 4DB4A 4B5KA 1F48A 3R7BA 3ECCA 2DFNA 1ZOSA 4UVHA 1EB8A 3B82A 4AMVA 3IJEB 5ADWA 4W1QA 4JBWA 3WB0A 1TEZA 1J5EB 1AN0A 4LNHA 1NW8A 3RAGA 1PFKA 2XCSB 4RUKA 1ZWKA 1H5UA 3ENVA 2IPAB 1HC7A 5FI3A 5JLAA 2IYOA 3PNBA 3AKCA 4PXSA 3FWHA 2ONJA 3CZAA 2FW0A 2V0NA 1VRVA 5TT0A 1OILA 2R62A 2WWIA 3DAOA 1QB8A 2WLTA 3D1VA 4OFBA 5GWXA 5I7VA 1CS0A 3HI6A 3MTBA 4MGKR 4WFIA 2YNMC 3GFQA 4X3PA 1P4AA 4FQ8A 3AX6A 4GM0A 4H4DA 3GPLA 4YV7A 3MERA 2A2ZA 1B8UA 3RROA 4NOLA 2IYSA 4RA6B 1M1NB 4KG7A 1MA3A 2P11A 1M2VA 1OCEA 1ZUHA 4IINA 1G5IA 1BX3A 2PMWB 5K03A 5K0CA 1JQAA 1YZUA 5LMNB 3PE3A 2AH5A 4C5AA 4UHHA 3WSVA 3U9SA 3OWHA 1B41A 2HQOA 1DEHA 1CB7A 2BVNA 1I2AA 2R4TA 3KIPA 3UANA 5MN5A 5HKKD 4AY2A 4GZ5A 2WHPA 1OB2A 3TINA 1XVUA 2Q6KA 2FLVA 3KYDA 3VMFA 2R5FA 4LSMA 1GO2A 4ZXPA 3VOTA 4P3KA 2NT4A 4LOKA 3EDOA 5D85A 3H2JA 1Y3FE 4XD2A 3H2IA 4JJFA 4NH0A 4LF7B 1KMCA 4JKOA 3ZIDA 4YIHA 1A5ZA 4KYVA 1VP3A 3LECA 4YMLA 1T1IA 4MVCA 4MSUA 2MYUA 2LGJA 5DYIA 4XVRA 3CNLA 1P6UA 2H85A 1ZBQA 3MYRA 5IFKA 2IS4A 5BURA 5BVHB 1YVRA 2VNAA 3Q0TA 3LGAA 4LQDA 4M60A 4B74A 4BLTA 2XCRB 2PUEA 2A14A 3IB3A 1NXQA 3UHAA 3S0JA 2QN8A 5HF9A 2IV3A 3HG7A 3KEQA 3MD0A 2PA0A 4YJGB 3SC3A 2WHPB 5HVNA 1IAQA 2FETA 2W4MA 4H4EA 3FHJA 5EP3A 3FPBA 5I9LA 4REMA 4ZN6A 4ZYLA 3KZXA 4OCZA 1ZEJA 4QM6A 3DDNA 1M76A 1AC5A 4BEWA 2UYHA 4UTRA 3D1LA 1KYZA 2HCTA 1JV2B 3DEYX 3NIGB 1YZNA 3EK2A 3P0FA 4OMUA 5DLPA 2GDJA 3U9TA 4ZK6A 3THXB 4HKTA 3ONDA 2NZXA 3PLAE 2JGDA 3LFUA 4PPNA 1GZSA 4WWHA 1Z56C 4AZ0A 5KVAA 2GYYA 4U2CA 3QNUA 1ZZEA 1CB0A 1RPTA 5D5PA 1N5MA 3ONVA 4HGPA 2PTHA 4KR0A 2YY6A 3VM6A 1HE3A 3RT1A 1CC1S 4LY6A 3BH6A 4L95C 3WGIA 1KU6A 3PC7A 3VV2A 2J85A 1MTOA 1RZRA 2VK4A 1DWOA 2JAPA 2R60A 2GERA 3AHGA 4TLAA 3B85A 4LY9A 5BSHA 2VPIA 1GFIA 1RRPA 2BELA 4MNTA 4LFBB 1SVUA 2B3TA 1ZNYA 2F3RA 2ZE6A 3BF8A 4Y2UA 1V8BA 3NC1C 2H4YA 2Y05A 3VHXB 4PXAA 4CM8A 4DYVA 4M1KA 4PBTA 2XTZA 3SFVA 3I01A 3WLSA 3L1KA 1KGDA 1RAEA 1V9LA 1NUTA 2RB5A 3OCWA 2XNDD 2WDPA 3AT1A 1MDBA 1W0CA 4ND1A 4F86A 3PDIA 3KE8A 1RMQA 1USVA 2BWJA 2WW8A 2Q5JA 3IUPA 3DMYA 3HBMA 4C4AA 3ZJ5A 2ZYTX 4ROTA 4I8XA 2P3QA 1OJ7A 3AI7A 3GJ6A 4BS9A 5A5DA 6REQA 2WIDA 1XWWA 1GZ4A 1GEEA 4L5JA 1LF0A 1LA2A 1QG2A 1RJ9B 1T0PA 4BX0A 2VJMA 3AR8A 1Y7IA 3GVHA 2IL1A 4DVJA 1UOOA 3B6EA 3C7AA 2K7FA 5DWVA 2Y1OA 4J0DA 4YRTA 2ID4A 1GOTA 1YS7A 4V02A 2GF0A 2XMDA 1I14A 2X5XA 3I2GA 4RVDA 2ZSJA 5AW1A 4TVOA 3WDMA 1Y42X 2HNAA 4G67A 3G8BA 3R8CA 2VYFA 4UXHA 3RSZA 3QOFA 4FT4A 3W79A 2VK2A 4FFDA 3TKAA 2HK6A 3RFVA 2R66A 1IJBA 1Z8NA 2IUYA 1GARA 1F2VA 2I2CA 2PSDA 2QENA 2W6MA 4M86A 5HE8A 2JAXA 2VT2A 1UBEA 1BS2A 2ZULA 2DCMA 2IOYA 5FV7A 2JZOA 1VG9B 3DP7A 1Z13A 2FWJA 2XOKA 1E32A 4FFBA 2YWXA 1N7JA 4S3MA 2VEOA 5ALHA 3ZLTA 1W85A 4JHXA 1YQDA 4Z4CA 1Z63A 3O8OA 4JXXA 1XPJA 5DTJA 1ZJ5A 1XMIA 3HJGA 2VTDA 5LDGA 5JMTA 4B4KA 1UKVY 4AZVA 2YQ4A 1MQSA 1YDFA 3BWYA 1N32B 1OH8A 2W2KB 3G0HA 5JDCA 4CCAA 4M36A 4V24A 1T9CA 1Y3HA 2P6UA 5YASA 3VDNB 4HQOA 3WGLA 3ZDQA 2VXOA 3H1TA 2O2EA 2AYXA 1NBMA 2P3OA 3KDSE 4ZCMA 4Z6KA 1G1AA 3IDFA 4PZEA 3M9XA 5ERGB 1GUDA 1YQTA 2RDMA 2Z0MA 3LGSA 5K0ZA 2P91A 2WF6A 1XMPA 2PWAA 3K6RA 4LSGA 3P0EA 1DRUA 1GGFA 1YUMA 4J0IA 5JCXA 3RS3A 4O63O 1E77A 2W6OA 5EKXA 3TD9A 4J9UE 3B78A 1NNEA 1W4AA 4MYUA 1LDNA 4RH0A 2P3LA 4QBTA 1OBVA 1N3YA 4AK9A 3VPCA 3WBKA 2RHBA 4BO9A 4CZ2A 4DR4B 2EGHA 2NSYA 3QEOA 4MR9A 5T3YA 3RFTA 2X2PA 3CLTC 4TYPA 3T3EA 5JY1A 2YV1A 3TZBA 2BGIA 1HQYE 1VE9A 3SX0A 3CZPA 4ZDIA 2VI5A 3V7UA 4R05A 4EHJA 3K6SA 2I71A 3VPFA 2YRXA 5C52B 3WG9A 1RXWA 1NMXA 3KCNA 2PK3A 1XKLA 4LSZA 4D4MA 4CT4B 2AA3A 3ENQA 4QAQA 1ZOLA 2I3BA 2X23A 5AOBA 2R25B 1VIYA 4JLPA 2Q3CA 1DKPA 2DHEA 2QD3A 1Z7BA 2GHIA 2O2DA 5I9MA 2P40A 4RPCA 5E0OA 2JA1A 1GG5A 3L6UA 4LVNA 4ALNA 4XGQA 3D3WB 1GSIA 4ARVA 4OQPA 4R68A 1JPJA 2ZUDA 2AMLA 4YBZA 2P5UA 5AW7A 1OE0A 2PLWA 1H69A 2IWRA 1ZMXA 1TCVA 1P2UA 1P1FA 3DM9B 4R51A 2C3YA 2FG6C 3S1AB 3L2OB 1SXIA 1J06A 1E9VA 1ZG3A 1FRZA 3KTAB 4RV5A 1ZCJA 2J9RA 4KGDA 4TTRA 4F3RA 1V1RA 1YGYA 2P6OA 1QKJA 1TAGA 1UPTA 1Q77A 2XXBA 3I42A 4ZQEA 4E2WA 4QATA 4JNKA 1COZA 1XDUA 1GYQA 3RIYA 3T8YA 2DFPA 4TQAA 4HDMB 4DRXB 4C6RA 4K26A 1RKUA 3GUYA 3P4YA 4MUNA 1JS1X 5DHQA 3FTNA 4ICIA 4G5OA 3D7RA 2KLBA 2OV8A 5UKDA 4GLOA 3V46A 4M83A 2XMSA 4P34A 3U2QA 2ZWMA 2GEFA 5DSZA 1F9EA 2Q4TA 3II6X 3SHVA 1RWMA 3L7DA 4R2LA 4D7AA 2ZRQA 4N8SA 5GOZA 3TQSA 2WE8A 3D5QA 4DMRA 1NNUA 2VP4A 4LN1A 5DYGA 1ZN8A 1ACMA 2PLRA 4G24A 4L4XA 2C3PA 5AUQA 4V1CA 4L16A 5DISB 4Y1RB 2GN4A 1LUAA 1JX6A 1W581 3ZY3A 4Z0TA 3WJ2A 2IHKA 5TX7A 4YYZA 5IK2D 1HX7A 3AERB 1OSNA 4GSKA 4BLWA 2LDBA 2YN4A 4ASUA 1CJTC 2ZAOA 4K9PA 5HKBA 4MYHA 4KKVA 4WJKB 2Y67A 3RYTC 3Q8KA 4MI1A 2DY1A 2JFXA 3D0RA 3VHLB 4ON9A 4I19A 5FNVB 1J4AA 2FI1A 1OZAA 4GZ6A 3TE7A 2JEOA 3S2YA 1XIVA 1YRWA 1O54A 1EP2B 1YQQA 3UT0A 4WY2A 3AVWA 2OCKA 4QVKA 1PR4A 3BTSA 1PJSA 3FROA 5G0UA 3E3AA 4RD2A 1JDBC 3PHCA 621PA 5LZ2A 5FNZA 1Q1ZA 1NOJA 2O7NA 3JPWA 4IEFB 1LBSA 4KXNA 3T7JA 2SCUB 3G49A 1B74A 4QJ4A 1V1MB 3FG9A 2QL7A 2RC5A 4HDNB 3VC3A 3JYOA 4JP1A 3GCGA 1QOPB 1S0UA 1GA4A 1Z8DA 2QZ4A 3ZR4B 2IVZA 5D5QA 5CT9A 4AG3A 4CIXA 4V0KA 4HADA 4IXDA 2OV2A 1PZHA 4TKVB 2A5LA 3HJRA 3F3SA 2ZUWA 5CA0F 2OKGA 5EYPA 1PFWA 1TU4A 2PX2A 1AV6A 1OFIA 4G37A 5I8WA 3JAKB 2RGEA 3V1KA 1DWUA 2Z5FA 4RX1A 3WLQA 1HORA 3BWMA 3TLKA 4B7ZA 1RAIA 3AWDA 2LPMA 2V7QA 4FN5A 2X8WA 5FOWA 2H2GA 5EWMA 3FE2A 2FK8A 4KO4S 4NBTA 5GIPE 4WTOA 1K6JA 1QBKC 1NONA 3VZRA 1AK9A 1VSBA 2VJQA 2WYUA 2ZSHA 2WV7A 3D6FA 3BXXA 3FFAA 4IEIA 4H6PA 5FHQA 3TNDA 2DCUA 1QHGA 1X7ZA 5JH7F 4GAEA 4MLDA 2PAAA 2D8MA 4MJLA 5FI1B 2ZT5A 4ZCRA 5M34A 1L7DA 1MORA 3UZUA 2SKDA 4ER6A 1U8AA 4PFSA 3UUEA 4EY4A 2W9XA 2XTMA 1GVNB 5JJCA 3HKBB 2REXB 3VJLA 1R0SA 1ECPA 3L6DA 3NUQA 2ZR0A 5U4XA 5ALFA 3C6XA 1SBZA 3AHJA 2ZJ6A 5J2UA 1BQ4A 3JAKA 3D4BA 2C4NA 1HO3A 5C51B 1N0WA 4Z1MA 1R8QA 4KQHA 5F52A 5L6MB 1UBGA 3H2ZA 2QLBA 3WIBA 5ED0A 1P5RA 3BG5A 5FO1A 3IXLA 1PV1A 2QD4A 3S29A 1QFZA 3NEJA 3H8JA 5KDLA 1QE0A 4HWTA 4JLNA 1Z8HA 3OOWA 4DBVO 1SURA 5KYWB 3TQRA 2CLCX 2H5EA 2AG6A 3BRWA 1EMDA 3R20A 4RW0A 4ENWA 1ZS9A 1AUXA 2V7UA 3IDAA 3BTVA 1BVUA 1FF9A 4CIWA 4NV1A 3SIPA 3H5AA 3EPHA 2PS1A 4NCJA 1JIXA 3BZWA 1UPUA 4ZVRA 2JAOA 4XLTA 4BDTA 1ECCA 3ROTA 4BXOA 2Q5IA 4JEMA 1JEDA 4H2DA 3TW0A 1YE8A 1DARA 3OQIB 5FUWA 3DYBA 3HCPA 5DJ5A 5HG0A 5KSOA 3UC5A 3DKVA 3NVDA 3SDZA 3G23A 1U7OA 3QA3E 2E82A 1RLIA 2X6QA 2EJUA 1IXZA 5J2UF 4Q24A 2JGRA 1QAMA 2YR0A 1ZC3A 3I2JA 1FFBA 2O2YA 2QRKA 4WZBB 3QG5A 4DA6A 2RHMA 3S70A 3VSCA 1ZEMA 4OQFA 4FXOA 4JR0A 1NMEA 4BBPA 3AVUA 1X1BA 3KSZO 4MQMA 3WKAA 4LXIA 2J07A 2AR0A 2H1FA 1KJQA 4H7FA 2Y4OA 4QTYA 1KVSA 1NYTA 4YCCA 3QKSA 2EJTA 2OGSA 4DDKA 3K70B 2HT6A 4JT4A 3RRBA 3SOZA 2OZPA 1QKIA 3ZWNA 3NM4A 2PAFA 2OT3B 4F11A 5BT9A 2ODBA 1KNXA 1VLLA 3PFKA 2JBAB 1I36A 3A25A 3R0JA 4G0YA 4HDMA 4M8LA 3DKIA 4WZBE 3SZOA 4P4SA 2YNMD 2IYXA 2UYYA 2RIRA 1YBHA 2ZAMA 3LLVA 3W6UA 3T7EA 4PX3A 1XK7A 2QR2A 3A1CA 3C43A 4J4BA 1SXGA 3A11A 1FRVA 3KP1A 3P2JA 4R8LA 1RWWA 1ES9A 3OQ1A 1FTYA 1T9GS 2GWRA 4ITRC 3A9VA 1FBTA 1RYBA 1NVTA 1Z2AA 2W48A 3Q5DA 2O8EB 2Z9DA 3TG2A 1EX7A 2CJFA 3A37A 5CT5A 3KT8A 3QVGA 5E3JA 5CA1B 2HJRA 1L5FA 2C57A 2YCLA 2ZG6A 4LK2A 5ECWA 2BN4A 2VF7A 3S40A 2ZM5A 3TIVA 3A04A 2XBUA 3W2IA 5EESA 2W8BA 1E8NA 2B83A 2HCFA 1M2NA 2PIAA 2ZB2A 1T6YA 5DSTA 3VGJA 2PLNA 3PC4A 5H82A 3CVJA 2O7RA 3K0CA 1DB3A 2ZPTX 1Z68A 3PGJA 1N5IA 1T9KA 1QUEA 1HL7A 4I4LA 4ZVNA 2V96A 2Z2ZA 3GDFA 2ENUA 3HDHA 5GAJA 1JTEA 2W70A 3KVOA 3HXQA 2WUDA 3D8RA 2ZETA 1HL3A 3GAFA 1KVQA 3IAS1 3D0KA 2OXIA 4LMAA 1Z5VA 1NA5A 1NT4A 3VBEA 3ZHVA 1OTHA 1I6LA 1QMPA 4OGGA 4XAQA 4WZAE 1K7EB 1VE6A 2Z56A 3YASA 4RNDB 1JLLA 3AUAA 3FYSA 4LYEA 4MR9B 1SH7A 1ZJWA 1V3VA 1A2KC 4BLOA 5K6TA 1QM5A 1TQ6A 5JASA 4DV7B 1WD5A 3B7PA 3HB4X 1UXGA 7ABPA 1I4EB 4OM7A 3AR7A 2GJ8A 4Q3AA 4GZ3A 4D56A 2TYSB 1HDEA 2ZANA 3UFBA 1IL0A 8ADHA 4FONA 1D4FA 1XLTA 3PXXA 4MQ6A 4AWAA 1N34B 4EH1A 3P1JA 5GZ1A 2IW1A 1Y8ZA 2YHIB 1NFRA 2R68A 3NWBA 4DXHA 3N2NA 4RKRA 2XCTB 2YFYA 3RVRA 4S0XA 3E9ZA 4DCTA 3CISA 2OENG 1BU5A 3FDIA 3OAAD 4Q02A 4TZ6A 2FN4A 1PIWA 3ETCA 5EERA 1ZISA 3MFQA 4TTJA 3K8YA 2D5BA 4P83A 3OTWA 3V7NA 1QWOA 1WEKA 5HP4A 3HU1A 4BOYA 3L5OA 5A0VA 3QLJA 4J16A 1KIMA 5BSTA 5DHUA 4DPKA 3AM3A 1EHCA 1XG5A 1YDGA 3C4VA 4ZYZA 1NJ1A 3CNQS 3QXSA 2VDRB 5AVZA 1J24A 1R0CA 5BNWA 3CNBA 3FGPA 4CKCB 4Q0MA 1LW6E 2DH6A 3MMZA 4F5WA 1KP3A 1PR5A 4ZU3A 1JHUA 3RYIA 2W00A 3PQDA 4G81A 4I3GA 1V25A 4C7MA 4MPDA 1HT1E 2ZATA 3SI7A 4P31A 4G4IA 4EKNB 3OE1A 3G2KA 4GXNA 3TZ6A 3HY4A 4UJ5A 5LJLA 2O7QA 1M2KA 2VYVD 2JIOA 3EX7C 1C0LA 1B6GA 3NO4A 2HJGA 4QBFA 3RVQA 3HEMA 5CCEA 5AVXA 5IAAA 2PT7A 2FOXA 2W6PA 3OE5A 1SUSA 3P4UA 4GX2A 1Q5PA 4R9RA 4AKEA 1AO0A 2G0TA 2CXUA 2JJ1D 5KX5F 2R3SA 2H1LA 2NN3C 2I4OA 3PUZA 1ZO8A 5A9TA 2NTEA 2QVLA 2VJYA 3IMKA 1NF3A 3O91A 3DVLA 3DLPX 1WB5A 5HK8A 5IRCD 4D8XA 4S1TA 1EGAA 2QLMA 4G1FA 3THWB 1PZGA 2XIQA 4JR2A 1N3LA 3HHPA 1OLUA 5BSGA 2AMVA 1EK6A 1SUWA 2IDJA 1E1RA 2PN1A 1CHDA 3HO8A 4X91A 4M6WA 3GJQA 1TEXA 1AKUA 3ZUPA 5CD1A 2Y27A 3I5MA 3F8TA 1B0ZA 1MGOA 1ZN9A 4OP2A 4H08A 5A4IS 2DRIA 2IYYA 3HZOA 3LKVA 3D8TA 3L9WA 3C7KA 4IY1A 4QPJC 3ZOKA 1XTJA 1R6AA 2XCIA 4RF5A 1JT9A 3T1QA 4IIFA 1E2KA 3TMKA 1DJQA 1JDZA 7MDHA 2VP9A 1ZK3A 3M7IA 4MDEA 1VECA 4HLQB 1C9JA 5EJ2A 3K2EA 4EW3A 5T6MA 4IZHA 3A4LA 2YRWA 2G9VA 1KZ1A 1GEGA 3GW8A 1PWYE 4IG4A 2AEFA 4UBOA 5CR9A 4KHPB 1RP7A 4KUEA 4D8TA 1BHSA 4UAVA 4FE3A 1U63A 1Y9AA 4ZODA 1D9XA 4IV5A 2EP5A 5B4TA 4M7WA 4FILA 4MUYA 1GTRA 2QRMA 4DCNA 2NU9A 1A27A 3LDAA 1JPVA 1WZIA 1YHNA 2QYOA 3DV2A 4R2WA 4KBFA 3QV2A 1M0SA 3HJBA 4F3NA 5BWNA 2XJ4A 1ORHA 1M5UA 4JBGA 1KQ3A 2QRLA 1I3MA 1KI6B 1OTYA 5P8WA 4KDCA 1WUHS 4A0RA 2QD1A 3ZIUA 3I45A 3QF7A 3WL4A 4L8FA 2ZYUX 1RKBA 4FHZA 2XXAA 1X42A 1N8KA 3TW8A 1I7DA 4YV0A 3KJHA 4NULA 4D8YA 4NATA 1LSSA 2HMSA 4D8WA 4D9NA 5T6BA 2RI6A 3FNRA 2H3HA 5K3DA 4DT1B 5B12A 4R1LA 1A9YA 3FCYA 2XNJA 3C2QA 3FMGA 4QHTA 4C3OB 4DLLA 5JDIA 3GOQA 1CK4A 1PI3A 1O6BA 4CM9A 4YRGA 5JXHA 1M75A 2Y1EA 4BB0A 3CPJB 1T0JB 4IS3A 5K3AA 3QP9A 3COYA 4F3CA 1WDMA 1QUFA 1XRSB 3LLMA 1AQLA 1ZM9A 4QU9A 1XZNA 3KPWA 3WC4A 2WU8A 3KJFA 3ONFA 1F12A 1MABB 1L5SA 3S1SA 3O47A 5HZMA 4KZPA 3N2KB 1RFGE 4NONA 4NCKA 3RU9A 3HTXA 5CFMA 3M34A 2EZ4A 2QYTA 2VSYA 5KYKA 1Z88A 1MDFA 2ZB8A 4FR0A 3LIPA 4YBRA 3UATA 1YB4A 4XJSA 1Y48E 1VL5A 2A9PA 4MKRA 4URHA 1R16A 1VBKA 1ZITA 1XRPA 3TLAA 1SOMA 4Y2QA 3FOEC 5LLSA 4ZOLB 1CJMA 4NNOA 4MIKA 5A9RA 2I9PA 2GPBA 2YL2A 3GOHA 3BB3A 3IX7A 5IK2A 2V9ZA 1D2GA 1RS0A 4FDVA 4KDRA 4N0QA 4NU5A 1J42A 4UU1A 1MX5A 1N3BA 1UKEA 1B6TA 2YQZA 2I9KA 1GRQA 2OCYC 3T9EA 4HC4A 3X3HA 4LY0A 5DN9A 1A2BA 1W85B 4GMGA 1CU1A 2AI2A 4RF3A 3LXUX 2XADA 4TRMA 3CVOA 4CM7A 2GA9A 3NBYC 4MVJD 1E5VA 2BFCB 1FP1D 1Y8RA 2IPOA 1JQJC 1RWPA 3EEFA 3IILA 4HFRA 4MITA 3BBLA 2JVJA 2GBFA 4KP7A 1Z15A 4BECA 1PQWA 3MHPA 2A33A 3T15A 1E0KA 1GJRA 2AGVA 3BMNA 2INGX 4W1RA 4R8RA 1CYDA 1A98A 2C2KA 2R9VA 1U0EA 2VPYA 2H8KA 3JASB 5AI6A 5AVOA 2C7QA 4BO3A 2R85A 1KBQA 2B99A 4X92A 3TQQA 2PVSA 5F35A 4HWGA 4J1QA 4EJSC 1P9OA 5HZKA 3AKZA 3EQZA 3GLSA 2VZ8A 4LOIA 4OP1A 4OMDA 5F3DA 2GX6A 3F49S 1JKFA 1FS5A 1FTGA 4QRHA 3S2ZA 4Z4QA 1FYWA 3QKRB 1TI7A 4FDUA 4HNSA 1CERA 2XJ9A 4FOPA 1V45E 4YCBA 1GTSA 3CBQA 3OF2A 4L7QA 5C5EA 3EGXA 1OOEA 2RHRA 4GECA 5DLEA 5DYNA 3PR1A 1JG6A 5P21A 3CPSA 3W5SA 1P5JA 2LP4Y 1NN5A 1MUUA 4H6VA 2OPHA 1IWPB 2AF3C 4N3GA 1DINA 1XMOB 4GP9A 1YCFA 3DOEA 3PX3A 2JIQA 3N3BC 1MZVA 3GGPA 5TV2A 3RVLA 1E89A 2EJCA 4G26A 1KRWA 4DV4B 1O5OA 4US2R 3KUUA 1QPGA 1PJAA 1K6MA 3VHXA 1K8ZB 3VO2A 1GG8A 2H3EA 4NTZA 4KQFA 2Z6UA 2VJOA 4MRAA 1JSZA 3MB8A 2HM7A 2Y8EA 3DBOB 3AI1A 3ZVMA 4GWKA 3T3GA 4QKQA 1P9NA 3V1MA 2IZOA 2BFNA 1G8KA 1WWKA 4OHZA 1X94A 3PC8C 5KTNA 3KO8A 2R8EA 2DT8A 2EGUA 4CMGA 2WNHA 3CUVA 3QMPA 2D2FA 3VYSB 5HZHA 4RANA 3AVVA 4RD1A 2DJIA 1WF6A 4A5SA 1HFKA 2BUCA 2ID7A 1QVZA 4LWOA 3RNOA 3PC8A 4JLWA 1KO5A 3PUWA 2EC5A 5CDGA 1XU9A 1EHIA 1FPQA 3DVQX 1F8XA 1Z7EA 3CS3A 3E5MA 5J5VA 3H18A 2HU2A 4H6WA 5DT2A 3DLAA 1ZESA 1VHWA 4Y8VA 1H5QA 1N2BA 2NZ8A 1X0XA 2PRZA 1NW7A 3SQXA 2Q6OA 4GP6A 4OQ4A 2XMRA 4KIFA 1HYGA 2G40A 5D3QA 5E1BA 5ICEA 2PUAA 4DLPA 5DMXA 4XB2A 5I4BA 1XZGA 1ZOOA 5HQTA 1GPUA 1X8LA 2PIDA 2WEKA 3AXSA 3EVAA 3T3HA 1Z4LA 2YVKA 2ZIGA 1ONOA 1C2TA 2V74B 1IFXA 4KHZA 1GTG1 3BEOA 1LK7A 1ESZA 2GYVA 16PKA 2NZ2A 2Y92A 2ZRDA 3H9EO 3IE2A 2BFAA 4P5DA 4Y2SA 4DW8A 4ZO8A 3GVXA 3EQ8A 4H0CA 3N2KA 1JR3E 1RHRA 1P0CA 2JIZA 4GR5A 4OBBA 4D98A 4FGUA 5LQMA 4DTCA 2CXXA 4A2WA 2ZS9A 2P9EA 2VYND 3DXZA 5LU8A 3QE2A 5DI9A 1F2TA 4FS3A 1T36A 4ND2A 1YZVA 2I3DA 4EVSA 1A96A 2EG9A 1C3EA 3K0FB 4L5BA 4R2MA 3U31A 3C98A 1G19A 1U1CA 4LG1A 5CT4A 2R47A 4ZO9A 4YDQA 1M83A 2BE7A 5C7IO 4U7JA 2FSSA 5EJ7A 1NPTO 4ZT2A 2W6JA 1A8PA 5TPZD 4DT1A 3E81A 3MBOA 3P45A 3PIIA 4NAUA 5BVHA 2M1XA 1ORVA 3GB9A 3SIXA 4RZQA 3NVMB 4EY3A 2PYZA 3T5DA 1EK1A 3EZ7A 5FBZA 1GT91 3ME5A 4MJ3A 3ZBQA 1H2HA 4IFBA 5H4GA 2CDRA 5D6OA 3LC1O 3QK7A 5TQ2B 4EMBA 4G63A 4IWYA 2Q7DA 2F8TA 4RJIA 5I9BA 4RCZA 4JUBA 3KC2A 4WY8A 5LC1A 3UAWA 5B3LA 5JYEA 2RGXA 4HDSB 1T1RA 3T7IA 1PWEA 4GLBA 3HKCA 2PANA 2B35A 1GLGA 1N6OA 3FPCA 5GOTA 3CLUC 3G7UA 3INRA 1MG0A 4YCLA 3AUXA 1YUNA 3QVTA 4CU5A 3DL0A 4MARA 4H17A 4MZDA 2Z4TA 3FOBA 2YWEA 1I4TD 3FVQA 3GRFA 1UPBA 3L7IA 1PJLA 5TDHA 3IKJA 3ENNA 4OJNA 3PD7A 1AQJA 2CV1A 3K0BA 2XZTA 1PD0A 1RTKA 1ZNXA 4F1WA 4W9NA 2X4DA 4YK7A 1RD4A 4CR6A 2FWIA 1DG9A 2WQZA 3AUTA 4JUCA 4D6PA 3QSYA 1R50A 5T4FA 3D0OA 3O1LA 5CCBA 3UGKA 1E7RA 4K3UA 4CTJA 4EUEA 4H16A 2IPNA 1A8QA 4MGHA 4BFYA 1SKMA 5EZYB 1GUFA 5AHKA 5TVKA 1RWVA 2X8BA 5AJVB 2P9JA 1RAGA 3HZRA 3N6RA 5CW1A 4M1MA 1L4MA 3AYXB 4M7PA 4OMCA 4QTXA 2D00A 5IXSA 1Z0FA 4YYEA 1NE7A 5EL0A 1E69A 2JKYA 5ED4A 2B4YA 3BHNA 5IH7A 4CLOB 3QKUA 4Q93A 1OU0A 2C4HA 2QY9A 2NPIA 1M1ZA 1CP3A 3EIHA 1Y6ZA 2NZWA 4L6CA 4ZT3A 3T4XA 5BMOA 1W5BA 5HIMA 2HF8A 1TW3A 1XUOA 3KR9A 1A3CA 1R66A 5T4HA 1IXSB 2PUVA 3FSGD 4J7AA 4Z8XA 2QTVB 3NEYA 2HQSA 3LPMA 1PCXA 1VBMA 2HA7A 4FSXA 5IW8A 4BRZA 3TI9A 3GLHA 4RKQA 2HK8A 2VXYA 1DXOA 3I09A 4B2YA 3AHHA 3NYRA 3QNWA 4CGZA 3CF4G 4P22A 2IODA 1EP1B 4JT2A 4W5WA 3FFTA 2JLVA 3PR2B 1C30B 1Q57A 1DC3A 3UPUA 1IE3A 3A6EA 2XKBA 2HPAA 1U2DA 3SJCA 2YWDA 4B0PA 1H9BA 4KE8A 3E7DA 3CGGA 1HM5A 3Q4GA 1FP7A 4GI5A 4XCXA 1FFXA 2G72A 1Y8QB 5BN5A 2GESA 3BGVA 4NG5A 4PLZA 2F00A 3CA8A 4IDEA 2R48A 5CYPA 2WIKA 1A0OA 1OYWA 1YRBA 5ICFA 3U3JA 1TYDE 1VCHA 1XQYA 4MS1A 4HLUA 1XJ0A 3M82A 5TEVA 3GO4A 3T34A 1Z6AA 5BR8B 2YZNA 3HVHA 1NVKA 3KSUA 3MTIA 4KNYA 4I1SA 1QHHB 2O0LA 1JLHA 5DIFA 2ZDGA 2RBEA 3RWOA 4PYQA 3CWQA 2W71A 4ZOLA 3UV6A 1E9AA 4LXYA 1E3IA 2W2LD 4NENA 4PAGA 2JGNA 5DGXA 3LWDA 3U4AA 1XTQA 4PLVA 4A6DA 1M1UA 5EJFA 2OFFA 3W6NA 1ZW6A 2H65A 4MZXA 3RVPA 4LJSA 4ZV9A 2XDWA 2XKJE 3HUEA 4NDZA 3S2EA 5F4BA 1IN7A 3D8HA 3T7KA 5KTOA 4ARSA 4RS4A 1AA9A 1XMVA 1HUQA 4G2TA 4KXUA 2P4SA 1GG9A 1BW9A 2FA9A 3I62A 4HN9A 4OUDA 1JW9B 1Z2EA 3WGOA 4A16A 3R7WB 2P2ZA 4P82A 3G17A 1G20E 4X7MA 2OHXA 1SKAA 4LNUA 3FMFA 2Y0PA 5CTAA 1DU4A 2OAQ1 4FMDB 4JSTA 4DRZA 1ZSVA 3K8OE 3DE2X 1R5BA 4B7CA 1O4VA 2EX0A 3EXG2 4XA8A 3CNHA 4UZEA 4GBJA 4AICA 2D3TA 2I2BA 4LF4B 2RD2A 1Y1SA 4P58A 2EKLA 1PRYA 2J6BA 4DQKA 2C9YA 3QPVA 1E7YA 2QTMA 2WPDA 5KYNA 2QTCA 5B7NA 4UW9A 1L8XA 1GQ2A 1LRKA 2BFMA 3IIIA 4OAQA 3PBKA 4X64B 3E9NA 4HNRA 5ALSA 1QVRA 5JFTA 1HF3A 1EWKA 1VE1A 3QBJA 4TQGA 2Z5GA 3WWOA 4RQAA 3GEHA 2FWAA 3X44A 3BCUA 4C1NA 3FCCA 2BYTA 1LI5A 2YMMA 3UAGA 4LZZA 2OLKA 1OXKB 2JLUA 6GPBA 2OUIA 3TUIC 3RT7A 3PGVA 5JNSA 3O31A 1UBMS 3TB4A 4AYTA 3R3UA 3ZI7A 3RVJA 2DY0A 4BFXA 1N7GA 2HBYA 2KBFA 3AUKA 3I34X 5M3BA 4DV0B 4PANA 5EEGA 5DEIA 1J7JA 1PG2A 5AHXA 3ZGVA 2V6JA 2LCFA 5AKXA 1FP6A 4L0QA 1EFHA 4LBWA 2Y1FA 4TTSA 5C1BA 1O77A 1FRFS 3PQFA 5FBLB 3T35A 1IY0A 1V11B 4A9AA 4ZARA 1XA3A 2J5BA 1KEEB 2RH4A 1EUZA 2O20A 4OK3A 4TS1A 1QMGA 1XK6A 3HY3A 3I04A 2IU4A 2VYNA 3BJMA 3NKVA 4Z9XA 2JZCA 4AS1A 1D8TA 3U13A 1JIKA 1LQUA 3GFVA 4LTNA 1YBAA 3EMVA 2ZUEA 1U3DA 2F8LA 4LBYA 5AM4A 4TTVA 3AKEA 3U49A 3ADDA 4NZNA 1SWWA 1T5DX 3DXYA 4FFMA 4X65B 4J0QA 1NW3A 1Z83A 4EBBA 4OJQA 5IAKA 1TT5A 3ODPA 2QL9A 2RGGA 1G20B 2ASEA 1I6WA 2NYUA 2ASVA 2X4LA 2YOHA 3DNMA 2IQIA 3BMQB 5FUBA 2IHTA 5LOVA 4KV7A 1RBQA 1S2IA 2I7CA 2RGBA 2MMCA 2H1VA 3JS5A 3SEFA 1M6VB 3JD3A 1NOIA 4KPFC 5K0TA 1O94A 2VHYA 3SZLA 1O6FA 1OTXA 1VKNA 1Z29A 2Y77A 4RESA 4JR1A 3SJAA 4BCDA 1U98A 3DT6A 3P9YA 5KNBH 2NZVG 2EARA 4AIRA 1J5PA 1U2EA 1X19A 2YJ3A 2ZRPA 1U9ZA 3O4HA 2FMXA 4PYMA 3SIRA 3SBEA 3BWEA 3W5UA 1PFUA 2C54A 5F4ZA 4KYUA 4EUHA 1HWYA 4CQLB 2IHBA 4DBLE 2OUKA 3DAPA 3OG9A 4M54A 4WNYA 3EGWA 2CF5A 4JJKA 3KLNA 2JG3A 5F33A 4Q4AA 1XTBA 3MJEA 3A3OA 3U4IA 2DQZA 4Q4JA 1SHJA 3NHSA 2VPQA 4Q3LA 4HB2A 2WA2A 4IMPA 4X5OA 4FB5A 5K09A 4DLTA 4LJLA 3GG9A 1E1CA 4ML3A 1QO9A 4R01A 4X1OA