1AHHA

7 alpha-hydroxysteroid dehydrogenase complexed with nad+
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
253
structure length
253
Chain Sequence
MFNSDNLRLDGKCAIITGAGAGIGKEIAITFATAGASVVVSDINADAANHVVDEIQQLGGQAFACRCDITSEQELSALADFAISKLGKVDILVNNAGGGGPKPFDMPMADFRRAYELNVFSFFHLSQLVAPEMEKNGGGVILTITSMAAENKNINMTSYASSKAAASHLVRNMAFDLGEKNIRVNGIAPGAILTDALKSVITPEIEQKMLQHTPIRRLGQPQDIANAALFLCSPAASWVSGQILTVSGGGVQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 7 ALPHA-HYDROXYSTEROID DEHYDROGENASE
publication title Crystal structures of the binary and ternary complexes of 7 alpha-hydroxysteroid dehydrogenase from Escherichia coli.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 95
structure length 253
sequence length 253
chains with identical sequence B
ec nomenclature ec 1.1.1.159: 7-alpha-hydroxysteroid dehydrogenase.
pdb deposition date 1995-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ahhA00
3R1IA 4RCVA 4L8VA 4E32A 3TZ6A 3GG9A 3WJAA 3PHHA 4KTVE 3G1UA 4BNHA 5HWSA 4A03A 3V1UA 3H6KA 3OEYA 5JNLA 5KJEA 4OQZA 1N7GA 2O3UA 4AJNA 1IHYA 2BMAA 2ZB4A 4R3WA 1UUFA 3LF2A 4LK3A 2JCYA 2WDZA 2CMDA 3BMQB 4ND1A 4WCFB 2R00C 2JFGA 4BKQA 5LC1A 2PY6A 3M2PA 1O8CA 3QW2A 2OMEA 4MKXA 1HLPA 4WECA 5FEUA 4XZ3A 1P9LA 2AMFA 1U4SA 2HDHA 2B37A 3ZNNA 2P4HX 4QSMA 2G82A 2IEBA 3E18A 1U9JA 1AHHA 3U4DA 4Q3NA 1LLDA 3KYDA 2NNLD 2ZTMA 1LLCA 3A9WA 4IDGA 4I5GA 3WGZA 1SMKA 2E4AA 5TT1A 5ADHA 3VKVA 2GZ2A 1R16A 1Q0HA 3RC9A 3EYWA 4HY3A 2IYPA 3GQVA 1XU7A 4IQ0A 1NAIA 4UUPA 3HHPA 3KOUA 1DSSG 1KIFA 3VHRA 1EFLA 2E37A 4EJ6A 4J6FA 2C82A 5HA5A 4PCVA 3UUWA 1HTBA 1C1XB 3RUFA 4K28A 4BNKA 1I36A 1DJQA 2JAHA 5L3ZA 3TZHA 3QWHA 3KZVA 2RBEA 1MGOA 2I5PO 4BGUA 1DAOA 1JVBA 1ADGA 4TRNA 3W8FA 2JL1A 4BO1A 3JD4A 3KEQA 4XB2A 4INAA 1IHXA 3M6IA 4HNHA 1S7CA 1F0YA 3BMQA 3I9NA 3PZBA 4QO7A 3RCBA 4YYZA 3PIIA 3WFIA 1RKXA 3GPDG 4DYVA 5EMHA 1R4NA 1C1DA 2X5JO 1EEHA 1T4DA 3ORFA 3KV3O 4GVLA 3B70A 3NGXA 1YQDA 1YQXA 1Z7BA 3ZHXA 2NACA 3KYCA 4NNJA 1PTJA 3FBTA 4BV8A 2HQ1A 3AM5A 2DC1A 4GMFA 5TF4A 3DZBA 3ZHZA 3D3WA 3DOCA 3KEOA 3GA0A 4KTTE 1ADBA 2ZB8A 1NVTA 4P22A 3H9QA 1B7GO 3FRJA 1QG6A 3VPHA 4RVDA 2ILTA 2Y93A 3JQEA 4IDCA 2B0JA 5COBA 3OIFA 2IXBA 5FYDA 1LI4A 4GX1A 1I3KA 3X2EA 2Q1TA 1I0ZA 4D0RA 3HDYA 2JJYA 1EK6A 1H5QA 4E0BA 3GVPA 3ZHYA 1S6YA 2PKRA 2ZQZA 5THQA 3WDSA 3WNQA 4OL9A 1E5LA 2B4RO 1P1HA 4HBGA 3EVTA 2ET6A 3U4CA 3W4KA 4C4OA 1D3AA 3C7DB 2PZLA 4TZKA 3WS7A 1NR7A 4BNUA 4P8RA 4LISA 1ZMOA 1MUUA 4R4JA 1LEHA 1NP3A 3ZWPA 2IXAA 4D3DA 3GVIA 3H3FA 4H16A 5KJFA 4Z9XA 1R15A 1C1DB 1LQTA 4JIGA 4LW8A 4IBOA 3S2EA 4K6FA 1O5IA 3BTOA 4YB8A 2EV9A 3JQAD 4H15A 3GDFA 4CUZA 2J5QA 8LDHA 1JKIA 4OJNA 4RDIA 3AI1A 1Y8QA 5F21A 1OMOA 1X7DA 1ZK1A 4R5HA 1E1NA 4FS3A 2VUSA 4PLPA 4NFYA 1ONOA 2O2SA 1EDZA 4UUMA 5HS6A 4YAJA 1YL7A 2YV3A 3Q3CA 3F46A 1PR3A 5EQDA 1FDSA 1N2SA 3AOEC 2BD0A 4KQXA 4BNIA 3IIEA 3P7MA 1DRVA 1CQIA 3JQ9C 1GL3A 3QWFA 4FN4A 2E82A 3DBHA 4ND4A 4NZ9A 2X0RA 4J16A 3WBBA 1KEPA 3FTNA 4WEQA 1EDOA 3AFMA 4MIYA 4J7CA 1NQAO 1SPXA 2J3JA 4FCCA 5JMPA 5THKA 1HYHA 1IZ0A 1Q2XA 5I9MA 3RBVA 3K73O 4A73A 7ADHA 5I7EA 1QORA 1EE2A 4ZD6A 4R1SA 5TJ9A 1V3UA 4ALMA 1BDBA 3AUSA 1DLJA 1MV8A 3N7UA 2XPCA 4J7XA 1VC2A 1H94A 1UP6A 2DBRA 3O9ZA 4JP2A 4OKNA 3PYXA 2HMWA 2GZ3A 4LRTB 1LSUA 4CMKA 4J49A 1EUCA 1ENYA 1XHLA 2YHUA 3GNQA 3IC5A 1YJ8A 3GHYA 3MTGA 1ZUD1 4L0QA 5IZCA 4Z3KA 1B8UA 1O0SA 2AEJA 3I6QA 1TA4A 3WICA 3CMCO 3GAZA 2YV1A 2IRWA 3SBOA 4ZJUA 3WGGA 1MA0A 1SB8A 4EGFA 3AWDA 3NEPX 3PHLA 4LMPA 1E7WA 3WLFA 3INTA 5TIIA 4W7HA 1BVUA 4CMAA 2PD3A 2V7PA 2W90A 4PVDA 5KTKA 3LZ6A 4I9NA 4NJMA 4WKGA 5C7IO 4IZHA 2YUTA 3OHSX 3LQFA 3U5TA 3NJ8A 3BIOA 1PS0A 4FPXA 3AOGA 2DQ4A 3N74A 1XWFA 1NAHA 1V9LA 6ADHA 4AJ2A 1U7HA 2NU9A 4U8GA 3UN1A 4H7PA 4JROA 5DBGA 3F4BA 2V6MA 2FRDA 1ADFA 2RCYA 3ICCA 4JJIA 2FZWA 4R01A 3PDUA 5JS6A 1CJCA 5IN4A 4ND3A 4R51A 2D5CA 1P45A 2H9IA 5H83A 3QWAA 3INGA 3EHEA 3L6DA 3NRCA 4ALIA 1ZMTA 3ICPA 1PGNA 4OQYA 4RQTA 2VHZA 2CVZA 3PDJA 3BTSA 1UDBA 2FPPA 4BKOA 5A02A 4HWKA 3TDKA 1V0JA 3ZWCA 3FI9A 2X5KO 3NTRA 1TT5B 4CMEC 4CMJA 3LDHA 4L4RA 1G1AA 1YRLA 1Z45A 2Q1SA 4R1TA 1NQTA 3LLSA 4NBWA 9LDBA 3E5RA 1XSEA 4BNZA 4RO0A 2C5EA 4HXYA 3JD3A 1LDGA 2UYYA 3WJ7A 5EIOA 5L7WA 5EN4A 4DRYA 3HB5X 3ADOA 5AXDA 3E1KA 2GN9A 1HDCA 1C1XA 3E8XA 4XQ9A 3VH1A 1XU9A 3VPFA 1E77A 3I9MA 4F6LA 1H6BA 3GK3A 4Y6PA 1YWGO 2EWMA 1ENOA 5BSGA 4J3FA 3VH4A 3ZWXA 5TS3A 4LCEA 1LA2A 2TMDA 4GX5A 5EQFA 1IPFA 3OA2A 3DFUA 1E5QA 4ZQHA 5A9RA 3UF0A 4DIOA 3C24A 3KYDB 3ZU2A 5ENVA 2DUWA 1B0AA 1RYDA 2Y0DA 4RF2A 3T7EA 4I5FA 3JD1A 1M6WA 1WXDA 2HU2A 3DZJA 3NUGA 5JO9A 3WIDA 1YDWA 3NJ4A 3ENKA 2AEFA 3E6AA 3BMCB 1NQOA 3KSZO 1Q0QA 4O1MA 5I7FA 3BYZA 3KSDO 3JQ7A 1X1TA 3K8ZA 2OHXA 3ZU4A 1B26A 4B7CA 4BNJA 4J1TA 5L53A 2X23A 5F1OA 4CQMB 4RF4A 3GH3A 1PR9A 4WOKA 2V6GA 3L4BC 4P4LA 1V8BA 3NGLA 1PSDA 2OGUA 3RBZA 3QVTA 1U1IA 2D59A 2EGHA 2W2KA 3ROQA 1ISMA 4HKTA 2DT5A 3PP8A 2DTEA 1PS9A 1NR1A 5G0UA 2C2YA 1DIBA 1E3SA 4WLEA 3W6ZA 5IZ4A 2JKVA 3GMSA 4YJDA 3DMTC 5ICSA 1FJHA 3HWRA 3RUCA 1T2AA 3OEWA 2B35A 2ZTUA 1J0XO 2BRUA 3DBHB 1GAEO 1QR6A 4DBVO 1JAYA 4I5DA 3RKRA 1I32A 4CL3A 4WCDA 2NV6A 5KVQA 1ADCA 2Y1EA 1MFPA 1LDYA 1Y7TA 3DTTA 4PLCA 3S8MA 3WSWA 4GQAA 1K6JA 3ANMA 2GDZA 4B3HA 2FPIA 1GU7A 4PLVA 1BW9A 1VLLA 4WLUA 4D0SA 1MX3A 2G0TA 4NFHA 1UR5A 4O5OA 3RASA 3ZW9A 4WE3A 1E1MA 2GSDA 1WP4A 1TT5A 2I65A 2Y1OA 1VJ0A 1HE3A 3F4LA 1J49A 1ZBQA 2J8ZA 4BNWA 1D8AA 4IJWA 1PJSA 2DUUA 1ZEJA 3QVOA 1NFRA 1KY4A 4F3YA 4Q3DA 5ER9A 2B69A 2EGGA 3TOXA 2HMUA 3WR5A 3DZHA 1ISGA 5T5QA 3NDRA 1PWXA 4BGIA 4E30A 1LQUA 3FNGA 1AE1A 2VRCA 3S1LA 1T2CA 4KQWA 4BO4A 3DOJA 3OH8A 3OJ0A 3JQFC 4XQEA 3LLVA 3UCFA 4CM9D 1XLTA 2YQ5A 1DIRA 4RVGA 3R0IA 4IQ8A 1QYXA 3W4IA 1ZFNA 2HO5A 1EFKA 1L7EA 4J91A 4M86A 4M1QA 4A0SA 5LDHA 5GY7A 1X15A 4YCAA 2VWPA 2O3RA 1V35A 2EJWA 2Q99A 3C3XA 3NTQA 4GSKA 4NIMA 4MPDA 4EZBA 4DUPA 3AU9A 3QV1A 1NWCA 2H6EA 3ANLA 3H5NA 4G2NA 3U62A 3LC2O 3PFWO 3KYCB 4K26A 4R68A 1HT0A 3C7AA 4JP3A 1AXGA 1WPQA 4YT2A 1R4NB 2E49A 3KBOA 5IG2A 1WDMA 4AJPA 3DMTA 1ISIA 1HYEA 2F1KA 4D45A 4G65A 2O50A 1AGNA 1EE9A 2XOXA 3HDQA 4WLNA 2VHYA 2O3QA 3L77A 4YDRA 1W0CA 2GERA 3ZWMA 3PWKA 3M1AA 4HADA 4MIOA 2IZ1A 3PJGA 4GH5A 2Y68A 2X5OA 2O3SA 4XX0A 1E6WA 4B3JA 4CLRB 4YJHB 4YT4A 3QVSA 3T4XA 1JN0A 5A03A 1UH5A 3K5PA 1HSOA 1KVRA 3E48A 3DO5A 2B83A 4XRGA 4MINA 1ENZA 5TJHA 2OP1A 1OBFO 5T64A 4IDBA 4RLHA 1KVQA 4WOJA 3VPXA 1P3DA 4YVFA 1VPDA 2I9PA 3ASVA 4IDEA 3AK4A 1A9YA 3VH2A 5JPIA 1HXHA 3ZHBA 1MXFA 3DAPA 3LT1A 4ESOA 3AUTA 4I9UA 1ZK3A 4AICA 1HRDA 2JD1A 2NADA 1MXHA 5F5NA 1WAMA 3SX2A 4OKIA 5CPBA 3AM4A 4BKUA 4FD3A 5KVVA 1U2GA 2P4QA 4LSMA 4U6QA 1SCUA 4Z0PA 5EL0A 3R3JA 2GASA 3PGJA 4Q3CA 4BO0A 1DHTA 3LC1O 3LT0A 4DPKA 1ENPA 4OHUA 1VL6A 2LDXA 3AUAA 4D44A 1BXZA 2AXQA 1B3RA 1GUFA 3QSGA 3KM0A 2OBNA 4MKZA 4AJJA 4PLGA 1KYQA 2Z1MA 3ADPA 5IN5A 2YJZA 4BL5A 1FDUA 1FDWA 3IL2A 3AY6A 2C07A 1BHSA 1MP0A 3GF4A 2JD0A 3ZGYA 4E21A 3QVXA 1YBAA 1DPGA 4YT5A 2QHXA 5TNXA 2DVMA 4HUJA 1LLQA 2EW8A 1PU2A 5C7OO 1JKFA 3WGHA 4B4OA 3JQ6A 3ON5A 2OZPA 1UAGA 4QT0A 3UAGA 4KZPA 3OECA 3E5MA 4M8SA 3MJEA 5H81A 3LK7A 4PG6A 2Q1UA 5K6AC 1NFQA 1YOVB 1RPNA 1F8FA 4G81A 1P1KA 1QLHA 3GMDA 1ML3A 5CG1A 3ETDA 1DRWA 3V5NA 3PHGA 1IE3A 1IZ9A 5JO0A 3WB9A 3EZYA 2UUPA 3A06A 1VM6A 4GLOA 5L95A 1YB5A 5I7VA 2WE7A 3VPGA 2ZYDA 3DAGA 3NDIA 4UEKA 4XQGA 2VOEA 1MG5A 1N7HA 2EP5A 4FR5A 4PG8A 1V3VA 4LN1A 2BGLA 1MLDA 3BMNA 3Q9NA 3VC7A 4O6VA 2AG5A 4P4GA 3E82A 1XCBA 3UVEA 1AUPA 3FSRA 4W7IA 3OJFA 3HADA 3H9EO 4XJTA 1E7MA 1K2WA 3G0OA 4MJLA 2B5VA 2YYYA 4RVHA 5LDGA 3MZ0A 1IL0A 2QW8A 2JFFA 1O6ZA 4TMFA 4ZGWA 4IMRA 4ONEA 4LVUA 3X2FA 3GDGA 1BG6A 4AJEA 5DF1A 1E3EA 3LYLA 1I3NA 1JLLA 4IY1A 3PYLA 4R5MA 4XDYA 2NU8A 1SOWA 3K92A 1JQBA 2EW2A 4MOWA 2Q4BA 1JVSA 2EKLA 3BTUA 1ISJA 5C7LO 4QXMA 4CL8A 4AJIA 3RJ9A 4CMBA 3PVZA 4ROSA 4CR7A 1N1GA 2PK3A 4FQ8A 8ADHA 2BLLA 4XYGA 2Z95A 3KLPX 4RPKA 3QWBA 2DFVA 1M66A 3CH6A 4RDHA 4FDAA 4XQCA 4E5KA 4RZHA 1BSVA 3PJFA 2X58A 2AW5A 1B15A 4KMSA 2CFCA 3WGTA 5I7SA 3WGQA 1ULSA 3JYOA 3K2BA 5DZSA 1N8KA 1QLJA 1LRLA 1U8FO 2J5KA 3JCZA 4NBUA 1XIVA 1QKIA 3QP9A 3TRIA 2NVWA 3OJEA 1I3LA 4N18A 2YV2A 3EAGA 2Q3EA 3HZZA 4CMIA 3RWBA 3I9OA 1A7KA 2PD4A 1VSVA 3I4FA 4A27A 3FHLA 2WWRA 1SAYA 1OC2A 4PLHA 5JDCA 1QP8A 1GV1A 2P9GA 1B8VA 1UXHA 3H9GA 3K6JA 4R1NA 1H6AA 4W9NA 4XYMA 1LNQA 3MJVA 3KUXA 5A1TA 5JW6A 2FWMX 2I6TA 4GMGA 1E3JA 3I3OA 3MOIA 1WMBA 3H4VA 2BI7A 5JMWA 3LVFO 4WJZA 3RFTA 1G0OA 3A14A 3NV9A 3GGOA 1ZJYA 3Q2IA 5TGDA 4MVJA 3COSA 4PVCA 4A2CA 4PG7A 3LC7O 1HDZA 1K3TA 2O2YA 4K1LA 3FNEA 4YPOA 4WK6A 4YJFB 3OICA 2BFOA 1LTHR 2ZTVA 3QVWA 4NK4A 4XD2A 4BS9A 2NM0A 4EUFA 1GPJA 3D4NA 3PRJA 2FOIA 3ONEA 4CM7A 3RI3A 2HCTA 3DOOA 4QECA 1I2CA 4IJKA 5DT9A 1X0XA 3Q9UA 2ZB3A 1XQ1A 3O26A 3UH1A 1GTMA 4E6PA 4WNCA 5FWNA 1P44A 3LT4A 3O8QB 4DVJA 3DZKA 3RUDA 4XCVA 2J3HA 4YEDA 5I9NA 5CDTA 4NJOA 1Q1NA 4Q9NA 3UOGA 3ZWOA 4FFMA 5TX7A 1K6IA 4CODB 2AEMA 2IE0A 3RC2A 3D7LA 2HRZA 2I3GA 4DQVA 4K9DA 1UP7A 3CMMA 1YQGA 5KCZA 4BNTA 4LRSB 1NPDA 3EY4A 4PRKA 3BA1A 3DBLB 3F1KA 4FOSA 4UVIA 4E12A 2ZIZA 3Q0EA 3PJDA 4S1VA 1DBVO 4CM6A 4NDNE 1PZEA 2ZQYA 3GUCA 2D0IA 3GUYA 2BGKA 3WYBA 4BGVA 3MTJA 3H7AA 4MVJI 3IUSA 4Z0TA 4LMRA 4IJVA 3ETEA 3VZPA 5AXCA 1MC4A 3GT0A 4OO3A 4XGKA 4XGNA 4JX8A 4J9UE 5JC8A 1BWSA 4IM7A 1PGPA 3HFGA 1PL7A 3PGXA 5DN9A 4YAIA 3GC6A 3RU7A 5JCJD 4NQZA 3KXDA 2Q2VA 3IQDB 3V8BA 3SLKA 1Y5MA 2ZATA 1JA9A 1U3TA 2FPGA 5L9AA 2CF6A 4MVJF 1BXGA 3AUUA 2NUAA 4N54A 4ZQFA 2CUKA 4W6ZA 3DWFA 2YFQA 1ARZA 4H3VA 1T4BA 3NX4A 3KB6A 4YXFA 1SOVA 1W6UA 3D5QA 4DA9A 4CLDA 5F1PA 2RH8A 2X0JA 1SB9A 4AJHA 3F5SA 4GX2A 4LSWA 1PJCA 4A7PA 4M87A 1PGOA 4CLEA 2GF2A 4R41A 4DWVA 1K0UA 4FJ0A 2GYYA 4MVJP 3T7CA 3KSUA 4FC6A 1XGKA 5JXWA 1WZIA 3C1OA 4BNGA 2OOSA 3UFXA 2P5YA 3DFZA 3DC2A 3B1JA 1EZ4A 3WFJA 1D1TA 2H5LA 4DBZA 3CTMA 4F45A 3DBRB 2VZ9A 3ZNPA 5KJCA 1YE3A 1ZK4A 3KRTA 3PZRA 4YRDA 3GPIA 1NTOA 3NAQA 4L74A 3FNHA 2O3JA 4Y98A 2QQ5A 4CUKA 3MJ4A 3A4VA 1KC3A 2NU6A 3FN4A 3SJ7A 5G0TA 3C1TA 3WTCA 2YY7A 3ZWAA 3GVXA 4E5NA 5JAIA 1GQ2A 1BVRA 5BQFA 3OQBA 2NTJA 1Q7CA 1KVSA 5K6AA 4I9HA 2WEKA 1GUYA 2ZB7A 4IJUA 2POQX 3V1TC 3SJUA 1VKOA 1LUAA 2J3IA 5AXAA 4BUCA 3HDJA 1J6UA 1ZSVA 1EVZA 1TEHA 2AQIA 2NWQA 4FC7A 4B4VA 1LDMA 4IZIA 3RUIA 2O48X 3BMOB 3EZLA 4R16A 2PNFA 5L7TA 4W82A 3ZV4A 1WDLA 5A9SA 3ZI0A 4IDAA 1T2FA 2CVOA 4GKBA 5IXSA 5DBIA 3C1AA 2AG8A 4D42A 4J4HA 4CLXA 1HZZA 1X1EA 3EW7A 4CQLB 4OXKA 4GWKA 2BF7A 1R0LA 1VE9A 2OFPA 2I3AA 1YB4A 1T1SA 2PFGA 2DBZA 2OO5A 3PWZA 4PG4A 1OZAA 3AI3A 1IPEA 1Y8QB 1H93A 1U28A 3RROA 2C7VA 4B79A 1VL8A 2CDBA 4FB5A 2VT3A 1U4OA 3DTYA 4EITA 4KOAA 1GDHA 3AM3A 4J7UA 1JW9B 4GL4A 4DPLA 4B7XA 4JBGA 3ZWBA 4HFJA 4XR4A 3BMOA 4IIVA 1UXKA 5L45A 1IULA 2R6JA 2Y1FA 4IXWA 4ZICA 2BFMA 3G1TA 4IPTA 1EVIA 1RM3A 2V6FA 3O03A 4E13A 2AE1A 1VKNA 3HN7A 1IUKA 2IZZA 4DTIA 2NQ8A 3CSDA 1OOEA 4PLFA 3MJTA 3PI7A 3QQPA 2VOJA 4FFPA 2DBVO 4CR8A 5A3JA 4BIIA 2PH5A 1JU9A 1SZJG 3VVCA 4EBFA 2WD7B 4B4UA 5HBRA 5ILOA 3VPSA 1GFSA 1H0KA 4CLHA 1E0DA 4HFRA 2PZKA 2VNSA 4ZN6A 4IDDA 2BGMA 1FMCA 2GGSA 1GQYA 5L4NA 5IDXA 2ZCVA 2PH3A 2AQ8A 5CDGA 4Q3EA 5K9ZA 4M54A 1QMGA 4Y9DA 2BI8A 4Y6RA 5DNAA 4CMEA 1RM4A 4JBIA 3HFSA 5T8KC 4DIFA 4D3FA 1UAYA 4IXTA 4HFNA 5BR7A 3WQQA 4IIUA 2Q2WA 2EKPA 3GFGA 3T4EA 3ZH2A 2QZ9A 2DTDA 2BELA 4JBHA 4AJLA 3VH3A 4II3A 3S2IA 3QJ5A 4J2HA 3CPSA 3L9WA 4WUVA 2DU8A 1HDRA 4FIZA 1HE4A 4CM9A 4RF3A 4CM4A 1MFZA 1P1RA 4E3ZA 3EVNA 3QLJA 4PLTA 4RVUA 1NNUA 4YAKA 2NVBA 1C0KA 1GR0A 4ZU3A 4MVJG 1SBYA 1WWKA 3JQFA 4R9RA 4ALNA 1ZKMA 2PTGA 1R0SA 3OQ6A 1R4MB 2HLPA 4CM3A 5ENDA 2QRLA 3H5RA 2FN7A 2VYVD 5BNFA 4GI2A 1WLYA 3S2FA 1QRRA 2HMSA 3ZWNA 1F14A 2Y1GA 5JY6A 5FI3A 4R9SA 4EJMA 1LX6A 1PJBA 4WLFA 1FK8A 1HSZA 1E3WB 2X22A 3DR3A 3IJPA 1PQUA 3I23A 2HMTA 2C0CA 3PHJA 4TKMA 1GCUA 4FOOA 1DOHA 2AQHA 1WMAA 4UEOA 1LXCA 1W73A 2VT2A 3AY3A 4RJTA 3GEGA 3IAHA 3HB4X 1N9GA 1PGQA 2ZCUA 1GY8A 2Y1CA 4BMSA 3BTVA 1MG0A 2J6IA 2WJPA 4JJGA 4XB1A 4YAEA 1NFFA 1PQWA 3VOSA 5G0WA 5L7YA 4YR9A 3ZNOA 1EBUA 5KWEA 2CDCA 2UVDA 3V2GA 1A72A 1UDCA 2WYWA 2UAGA 2ZKLA 1QSGA 3BHMA 4DMLA 3K30A 3NT4A 5CDUA 3NT5A 5TQVA 4J9VA 4BO7A 4Z6KA 1E6EA 3B20A 4FGWA 3OBBA 1LBEA 3I52A 4AVYA 2CY0A 2XXJA 4E5PA 3U4IA 1ISHA 1DFHA 1GUZA 4BGEA 1I8TA 4D7AA 4FBGA 4L73A 3E9QA 2B4QA 1EK5A 1CRWG 1PL8A 4B4WA 3GVHA 5JSFA 2HK9A 5JAZA 3JYQA 3GAFA 3TFOA 2FMUA 1FDVA 3AU8A 2B36A 4CMIB 5GZ3A 3JQDA 1YONA 4TVBA 4XA8A 1YB1A 1E3LA 4E4YA 1Z73A 3FR8A 2FSSA 1GV0A 4PZDA 3VAZA 1NVGA 4MP3A 3GRKA 5G4KB 1KS9A 1NPYA 3L4SO 2G5CA 3JQCA 3UCEA 1ZSNA 3I1JA 3WQRA 4TKLA 4U5QA 1UZMA 4BNLA 4YWJA 4J4BA 5TT0A 4WPGA 2NTVA 4E33A 4ZRNA 5K0ZA 4G5HA 2UV8A 3GY0A 4IGEA 4DXHA 4O0LA 2JHGA 2PKQP 4WASA 3PLNA 4FSHA 1DB3A 4KUEA 4OOEA 3VZQA 4RVFA 4YJGB 4NU6A 3RVDA 4CLOB 4OSPA 4ND5A 2BH9A 1R4MA 5IJZA 1YVEI 3WGYA 3U09A 1YL6A 4GAEA 5A5EA 4W4TA 3JYPA 3RUEA 3KO8A 2Y66A 4B7UA 3KTDA 4YJHA 4DGSA 1R37A 2I67A 4YT8A 4CLOA 4CLRA 1D7OA 4Z3DA 1D4FA 2Q1WA 3PQDA 4R1UA 2GUGA 4TSKA 1YL5A 4BO5A 1RM0A 2LDBA 3QE3A 2QRJA 2X9VA 1V6AA 4GX0A 1LC3A 2IYOA 2JD2A 3CXRA 4R69A 3MWEB 2A4KA 3O4RA 3V2HA 4O59O 4XWYA 1UJMA 5L51A 1CIVA 4NI5A 5EERA 4DIBA 3MJCA 1NYTA 4FFNA 3ZWYA 4C7KA 1DIAA 3O38A 4Y67A 4JQCA 2VHXA 3PFFA 1B14A 5DULA 2D8AA 2GR9A 4NFSA 5G0VA 1YS4A 4IUYA 4UVGA 1X7GA 4KUGA 3S2GA 1HDXA 1A71A 4PG5A 2OL4A 1HLDA 1ZO8A 3MWDB 4M49A 1QYCA 2DM6A 3D5TA 3GOHA 1E6UA 3OP4A 4KWIA 2EG9A 2Y67A 2NSDA 3EK2A 3PQEA 3DBVO 4DC1A 1UP4A 3ENNA 4ILKA 3TL3A 3DQPA 3DZIA 1GPDG 1LDBA 1DC5A 2VTEA 2X86A 2OORA 2W2LD 4N5LA 2WE8A 3GHHA 2GZ1A 2G76A 2YQ4A 4PFJA 1Y8RB 5JCXA 4JK3A 4ALKA 1JDJA 5AYVA 1KEWA 1A5ZA 4PRLA 4YQYA 4PIVA 1M2WA 2ZYGA 3HUDA 4R3NA 2A35A 4II2A 4CV1A 4CM8A 3W4JA 3TWOA 4DL9A 4U6SA 3RJ5A 4BKRA 2DPGA 5A5FA 1Y81A 2X7HA 3ST7A 3HE3A 5LCXA 3OMLA 1ZK0A 1U5CA 4OM8A 1TVEA 3K9QO 4OAQA 3C7CB 1R12A 2D3TA 3K96A 4XIYA 4PN3A 5BSEA 1KVUA 1NASA 1P0CA 1Q7GA 2VN8A 3WGOA 3G49A 5A9TA 4E2ZA 1H6CA 3IMFA 4BB5A 5AXBA 2R2GA 4BO8A 4MP6A 3BZUA 3WMWA 1PJ2A 4UULA 1KETA 1VRWA 3DZFA 2Q45A 4GBJA 2O4UX 4WLOA 2HJSA 5ES3A 4GGPA 4GWGA 4CM1A 4D79A 2RHRA 4N7RA 4RPJA 4J1QA 1NHWA 4URFA 1Q7BA 2EIHA 3TZCA 4MIEA 4WLVA 5DCYA 2A92A 1TB4A 3P2OA 2D2IA 1O9BA 2GPTA 3U3XA 2EF1A 4OYRA 3VVBA 1BGVA 4UUOA 2WYVA 2X6TA 2XAAA 3PIDA 5MDHA 3ZV5A 4KP7A 3JQ8A 2WYUA 3E03A 4NG5A 3DHEA 1CF2O 4GKVA 4JN6B 1DIGA 1PIWA 1ZEMA 4TVOA 4DLBA 4F46A 4YBZA 1E7YA 4HX5A 4ID9A 2EEZA 1N9GB 3JQAA 3DBRA 5B37A 1ONPA 1YH3A 1H9BA 4UVHA 4L75A 2GN6A 1IB6A 3AI2A 2EXXA 2YHIB 2G1UA 2JAPA 5ITVA 4CM8B 3FR7A 2VUUA 2CVQA 2WTBA 3SVTA 4DQXA 1PJ4A 1LDEA 3ROKA 4J90A 1TLTA 3E9MA 1LC0A 2P68A 2Y0EA 4EW6A 2P9EA 2PGLA 4D41A 3IKTA 4NBVA 4WNIA 4YRBA 1LDNA 1HKUA 1PJLA 4Y8VA 3F5QA 5J23A 4MVJD 4DLAA 4YA6A 2NQTA 1GZ6A 4BVAA 2D1YA 3DEYX 4ZQGA 4JGBA 1T1RA 1H2BA 1QV6A 2E6UX 4MKRA 1DC4A 1NVMB 4BO6A 5L4SA 5GZ6A 2PKQO 1H6DA 2HKIA 4CPDA 3JQGB 2DLDA 3NTOA 4L9RA 4XJSA 3RFVA 2BFPA 4DPMA 1SNYA 1K5HA 4KWHA 1PEDA 4YRAA 3WMXA 1SC6A 1P0FA 1LSSA 2CSUA 3FWZA 5B12A 1ZXBA 4RPGA 1TT7A 3WTBA 3ETGA 2X1HA 5TRTA 1A27A 4IDFA 5DDIP 4YACA 1BMDA 6LDHA 4WGGA 3JD2A 3VZSA 1E7RA 2OP0A 2Y0CA 4NPCA 5DP1A 1WNTA 2PR2A 3BAZA 3H9UA 4ALJA 1UDAA 2NLOA 3I4CA 2W8ZA 2HSDA 4GVXA 3ITKA 4WCFC 2GCGA 5A9SB 1ZNQO 1HF3A 4GSLA 4NU5A 1X0VA 2PD6A 5I9LA 1U5AA 1YKFA 2UDPA 1A7AA 5BSFA 4A10A 4BQPA 3ZV3A 1P74A 4NR0A 4W99A 4XYEA 4EJ0A 5C37A 3EC7A 5U9CA 4BMVA 1T24A 4J0EA 2BKAA 3DB2A 2Q46A 1TI7A 2WD8A 1XDWA 5IAAA 2CF5A 2X9GA 5TC4A 4K6CA 2P5UA 3VTZA 3CIFA 3HN2A 2BHLA 3NT2A 1DO8A 3RQSA 2Y99A 1O95A 5A3VA 5JLAA 1RJWA 1P1IA 2FHSA 3C8MA 1A4IA 3NDJA 1QXSA 3D1LA 3DXFA 1JWBB 3WQSB 3P19A 4UAGA 1IOLA 1CEQA 2CDAA 3OM9A 3GZNB 4LCJA 1GYPA 4QTZA 4CV0A 5C5IA 3PTZA 1P31A 1QYVA 2E48A 1PJTA 1I2ZA 1DHRA 3GGPA 4CM5A 5KNLA 1I2BA 1L7DA 2WSBA 1W8DA 1NWHA 1E92A 1XA0A 2W4QA 4RORA 3EGOA 5ILGA 4BQRA 2GLXA 1SEPA 3MCVA 3CEAA 1Y6JA 1CERA 5H82A 3GZNA 4OOFA 1I30A 5IDYA 1GD1O 4L4SA 3TPCA 1X14A 2G17A 4WEOA 1C3VA 1M75A 3PHIA 1EQUA 3H65A 3H2ZA 3M2TA 4S3MA 3TJRA 2EHDA 4QQRA 3DHNA 4UVDA 2O3TA 3K31A 2A94A 4I08A 4UVEA 5BT9A 1J4AA 1VSUA 5FFFA 3GEDA 4RGBA 1E1KA 4QO8A 1KOLA 4ITUA 4QX6A 4XYLA 5G0SA 2QRKA 3AFNA 5CPFA 1SO8A 3VKUA 4AJKA 5IFLA 2Y05A 1DXYA 1Z75A 5KJ1A 1KEUA 5CAEA 5KJ6A 3C85A 4AJOA 3RC1A 4X54A 4CMHA 5FF9A 4LVCA 4E2XA 1A9ZA 2O7SA 1D1SA 1PJQA 3Q11A 5IDQA 2PGJA 2FR1A 9LDTA 1XEAA 1Q0LA 4MVJH 1OFGA 3WOHA 1KBZA 1R0KA 1QYDA 2SCUA 4YJGA 3ULKA 2JHFA 3OFSA 1P1FA 5T6BA 5DP2A 3GNSA 2I66A 2QZZA 3RFXA 3AJRA 3RSHA 2JCVA 2IODA 4U0JA 4TRMA 2NVUB 3FPCA 3WXBA 4P4NA 3KLMX 4EUHA 1IYZA 1Z82A 5KVCA 1PS8A 3NYWA 1LSOA 5DOZA 1XG5A 3P5SA 3Q6IA 4U7WA 3ZCXA 4BNNA 5B4UA 1R66A 5KOIA 4YQZA 5A4DA 4J2OA 3BMNB 4IS3A 1JWAB 2Q50A 4QEDA 1XELA 1KC1A 3D4PA 4RQUA 1YBMA 1GZ4A 1LLUA 1ZW1A 3RIHA 3RUAA 2Z5LA 5A05A 3ABIA 3JQAB 3JQBC 3UCXA 3UHAA 1XQ6A 5CFZA 1OAAA 3N58A 3SEFA 3ZV6A 2V6BA 1CWUA 3TNLA 1WZEA 2Y1DA 3WX0A 1YBVA 2DFDA 4JLWA 2C54A 2ZYAA 2NTNA 3MJSA 4Q39A 1DFGA 3QHAA 1E1LA 2FP4A 3TQHA 4BKPA 5BNTA 4R54A 4J1NA 1GCOA 1N5DA 4PZCA 2J3KA 2PGDA 3TZKA 5ER6A 3ZDFA 4FFOA 4BB6A 4OH1A 4CMGA 3JSAA 1U3VA 2AQKA 4XR9A 3U0BA 3Q2KA 3SC6A 2QYSA 1DEHA 3ZU3A 3ZZNA 3OF2A 4RF5A 3U4HA 5GZ1A 3OQ1A 3IKVA 4A26A 1KY5A 1BW9B 1TXGA 3W8DA 1SEVA 3CZRA 1V3TA 2IDZA 5G4KA 4AJ4A 4EEZA 4CQLA 1U3UA 3DL2A 2VWHA 3HDHA 2OBYA 4PGFA 2O4CA 5GMOA 2XXBA 4TRRA 4JCOA 4JJFA 5CDSA 1VI2A 3WWYA 1XYGA 1ZJZA 3DMYA 3SC4A 5CEFA 2DBQA 3QY9A 4B8ZA 2GD1O 1HETA 2VZ8A 3LSYA 4D43A 3JTMA 3ROMA 2VHWA 1R6DA 4BNYA 5HM8A 2RAFA 3VZRA 1CQJA 4BO2A 3I9KA 1PJ3A 1HZJA 1JTVA 5L40A 2H63A 1NHGA 4BNFA 1PGJA 4PLYA 1U8XX 1Y8RA 1B16A 2XF8A 1NX6A 3LT2A 3PWSA 4CV2A 4CJXA 5JYDA 5JDCC 2C2XA 1Z6ZA 2ZTLA 1C14A 3IOYA 1DC3A 3FTPA 4IINA 4BNVA 1P77A 2VRCD 3WSVA 1NQ5A 4A5OA 1J5PA 1GEEA 3DZGA 4ALLA 1I01A 1YDEA 1N1EA 1P1JA 3A1NA 3D0OA 3DHYA 3JQ7B 1CDOA 3RAJA 4O63O 1NBOA 1WW8A 3F9IA 4Y6SA 1BXGB 4AL4A 5CP8A 5EESA 2VNAA 3IJRA 4OIMA 1EUDA 1YGYA 3W1VA 4J43A 3WYEA 4QUKA 5T67A 1EMDA 3INRA 3IP3A 1PL6A 1C0LA 5TSDA 2NVUA 4Q3BA 1GYQA 1K89A 3FD8A 2RHCA 4BV9A 4TWRA 2X8LA 4I1IA 2I99A 4E2YA 2C7GA 3UICA 1I24A 1ZZEA 4KDEA 5I8WA 4XEHA 3JV7A 3HJAA 5IZCC 1G6KA 3RKUA 3CKYA 2QX7A 3GZ4A 5COAA 1UXJA 3OETA 2W2KB 3ZN2A 1FXSA 4CQMD 1WDKA 3R3SA 3PK0A 3FF4A 1YO6A 3L9XA 3BHJA 1MB4A 4E5YA 5B1YA 1QV7A 3STHA 1VL0A 1NXQA 4U0KA 4BMNA 3MOGA 5JAQA 4CQMA 1LRKA 4PLWA 1CYDA 2FR8A 4EI2A 3UKOA 1BDMA 5JFOA 4DMMA 3HNPA 1T2EA 4EYEA 3CINA 3H5AA 2HAEA 3OA0A 1BTOA 3NKLA 2UUOA 1LU9A 2EKQA 5T57A 4F6CA 1EVJA 1OC4A 1M67A 1L1FA 2Q4EA 2I76A 2ZJ1A 3F1LA 3WNVA 3GG2A 1EQ2A 1PZGA 4XKJA 2P2SA 4FW8A 4KDFA 2HMVA 3ANNA 4L4XA 1W4ZA 2VYNA 3B1FA 2GN4A 3AY7A 1X7HA 1NPTO 2GRAA 2J5RA 3FNFA 1U7TA 2AA3A 3U49A 2EJVA 2YFHA 1E7QA 2ZJ0A 3B1KA 4HP8A 5JY1A 1HDGO 4NH4A 3PEFA 2YDYA 3HSKA 3IS3A 2HUNA 1C0IA 3RU9A 2QG4A 2PZJA 2C29D 2Q49A 1KVTA 5A04A 3DDNA 2VWQA 3OJLA 3E9NA 5G2OA 3JQ9A 5L4LA 3L6EA 3AOEA 1B3BA 4OMUA 5EINA 1UZNA 3HQ4O 4DQUA 4ZQBA 3BHIA 3WG9A 1DIHA 3W6UA 1HEUA 5CEJA 2HK7A 3DBLA 1VJ1A 2Z1NA 3F3SA 4P38A 3H3JA 4XIJA 3TL2A 4L76A 3D3WB 2PZMA 2TMGA 1Y9EA 2V65A 3TSCA 5CG2A 1AHIA 3SXPA 5AVOA 2PV7A 4FGSA 1M6HA 3OIGA 4FFRA 3JD0A 1T26A 3ZWVA 4E5MA 2PLAA 4FJ2A 4M89A 5C3MA 5ICMA 5U1PA 4RLSA 2JCXA 2ZK7A 4NMHA 4DLLA 4B8WA 2YDXA 3LU1A 1JKJA 3G3EA 3V2UA 2X9NA 1I3MA 1YXMA 4E2WA 1HDYA 1HWYA 2X4GA 4CV3A 1K6XA 5JE8A 4CR6A 3GGGA 1CETA 2B5WA 2RIRA 3EUWA 1A4UA 5JBIA 4TROA 2H1SA 2YZ7A 4TZTA 2W2LA 3ASUA 4RL6A 3P2YA 5DBFA 3IUPA 3H8VA 3ZW8A 3RD5A 3ONDA 4D3SA 4IQGA 5ITWA 5TLSA 4IGFA 4ZQEA 4J4TA 2BFAA 3CUKA 3WBFA 1GYRA 4W9NC 7MDHA 5EJ2A 5A06A 4NBTA 4ZRMA 3I9LA 2F00A 2C59A 4MVJM 1DRUA 5BNIA 2FSVA 2GO1A 5IXYA 4CUJA 3JQBA 2AE2A 2VRBA 3WWZA 3VTFA 1HDOA 3GRPA 2DTXA 1B2LA 1I5RA 1P33A 4TRJA 4ZA2A 5B4TA 3WGIA 1U3WA 1M76A 1NM5A 1H2HA 2B4TO 2VHVA 4TQGA 5JYEA 4JXKA 1PZFA 2O23A 1F8GA 1XR3A 1QYWA 3A28A 5JAMA 3IDSA 1F06A 2YHIA 1Y9AA 3TF5A 2IEDA 2C20A 2RH4A 1EVYA 3JYLA 4GGOA 5IDWA 3ZU5A 2R00A 3KETA 2O7QA 5I8ZA 3TFQA 4OGWA 4Z9YA 5F5LA 1DJNA 1LSJA 2W98A 4UEJA 4CMCA 4BHTA 3D4OA 5U4QA 3UW3A 3W8EA 1PQPA 2DAPA 3KVOA 4XGIA 1UZLA 2QYTA 5KIAA 2VTDA 2VZ0A 4IMPA 3RUHA 3RBXA 4CM4B 5HRUA 2FZEA 3PJEA 3WIEA 4AFNA 4FFLA 4ZHSA 4MP8A 1YJQA 3IP1A 1KEVA 2Q2QA 4E31A 1F17A 3VDRA 3LF1A 4LGVA 3FPLA 1GEGA 4J1SA 3UGKA 4N5MA 4NK5A 1ZVMA 4N5NA 3TN7A 5IF3A 3H2SA 5CHEA 2HRBA 3ONFA 3ZWWA 1U2DA 5CDYA 3S55A 2JFHA 2FR0A 4BOYA 2AHRA 2VYND 3G17A 1E3IA 1XKQA 3KHUA 4GLLA 4ND2A 1DDOA 1PZHA 3GVCA 3BMCA 1FDTA 1E7SA 3BXXA 4AG3A 3EDMA 3GNTA 1ZIDA 2GNAA 2NU7A 2YW9A 4XYBA 1OI7A 1C0PA 1X13A 2D5AA 1VJTA 3GFBA 4IS2A 1LJ8A 3I9JA 4KUHA 4M55A 1Z74A 3QRWA 3UXYA 2EP7A 4OXNA 3EMKA 1DFIA 5HTOA 2WM3A 4YJFA 1HL3A 1PWZA 5AOVA 2X0IA 3U9LA 2P9CA 4FJ1A 4MDHA 5MGBA 3PQFA 4MVJE 4NBRA 4DYDA 4RPHA 1ORRA 4I8XA 4JNKA 3D64A 4NHEA 5AQ1A 1HE2A 1YOVA 3L0DA 2OUIA 3PXXA 1GZ3A 3CZMA 3PLRA 3L6OO 4EDFA 1Y5RA 3L07A 3PYMA 3L4BA 2D4AA 3M1LA 3O8QA 3CE6A 4BNXA 4NJMB 2CNBA 1DLIA 2DPHA 5T8KA 5KKAA 1ULUA 3WYCA 5F1KA 2IZ0A 2VWGA 1F12A 3I6IA 3WLEA 2GN8A 1IY8A 1LRJA 4WCFA 4PZEA 3V1YA 3GEMA 3GLQA 5JDIA 3F6YA 3I5MA 4EUEA 3R6DA 4ZVVA 4D46A 1I10A 1GQQA 3KYBA 2EERA 5CEEA 3Q1LA 1ZH8A 1ISFA 4RPLA 3PPIA 4AJ1A 4GPD1 3GDOA 2WMDA 5FI5A 4BNMA 4EEXA 1RWBA 2A9FA 3D3EA 4I5EA 1O89A 3ITDA 1WVGA 3FCOA 3I83A 2VYVA 5B4VA 5EPOA 5JDIC 1ONNA 3FBGA 3TZQA 2C5AA 4J0FA 2WD7A 3H9JA 2DKNA 3FWNA 3B6ZA 1I33A 2P91A 5BSHA 1N92A 5HS4A 1ZK2A 3GR6A 5COQA 4YAGA 1E3WA 2PA3A 3JQGA 1G0NA 3MEQA 3QA9A 3K2EA 1EUZA 2VQ3A 1PX0A 4XRRA 3DAFA 1MC5A 3QIVA 3OSUA 1KERA 2VCYA 2PWZA 4QFCA 2CZCA 1AXEA 5F3RA 4HFMA 1ZCJA 4UREA 4BO3A 5KVSA 1HE5A 4UUNA 4XDZA 1Z7EA 4DC0A 1O94A 3F47A 4Z9FA 1EBFA 1Y1PA 3JYNA 3QWIA 2OXIA 3OIDA 1JAXA 1H9AA 1ZXLA 4YTEA 3ROPA 3GN2A 4HV4A 3OJOA 2X0NA 3TOZA 1DC6A 4BO9A 2FY8A 1HYGA 4Z0HO 3SLGA 3AW9A 5KKCA 1FF9A 4MO2A 4RV9A 4HNGA 5G4LA 1RYEA 2HJRA 1BXKA 4DREA 5JCJA 4C7JA 5DCUA 1BRMA 1GADO 1RM5A 1ZSYA 2QIOA 4RZIA 4OXYA 4B3IA 2CD9A 5DOVA 3HG7A 3JQ8B 1UXIA 1T25A 1UXGA 3GN1A 1DAPA 4OSOA 4RVSA 5JC1A 2HK8A 4PLZA 3G79A 2VUTA 1AN9A 1ID1A 3ZNQA 4QFDA 5DCWA 4Q3AA 3VDQA 3RC7A 1B8PA 1T2DA 3DONA
chains in the Genus database with same CATH superfamily
4Q02A 2WU8A 2P40A 4WQMA 4UEWA 1E96A 2WUFA 4RA9B 4XI9A 1FZTA 4V2IA 3ILHA 3M6VA 3GV0A 4HLCA 3K0EA 1CF4A 4TYMA 2PBLA 3GAAA 1NJSA 3PHHA 4IDPA 3KE9A 2OC9A 4U63A 1IY1A 3U1VA 2WJ3A 2WU3A 2IH4A 3G2QA 4PQEA 3H6KA 1UZUA 5IYZB 3OEYA 1FUKA 2R68A 2OCLA 4M37A 3NHKA 5BN5B 3KQWA 1HK7A 121PA 2VJCA 4OQZA 5DX0A 3W5AA 1N7GA 2O3UA 1IHYA 4LUCA 4FLEA 2ZB4A 4R3WA 1UUFA 5FQNA 4CWAA 2FXVA 2WHYA 3LF2A 3G5LA 2JCYA 4GSYA 1SC9A 4ND1A 2O8CA 4WCFB 5JQGB 2X0EA 1CUSA 1U81A 1WOYA 1Z26A 1E0SA 1VHTA 3GBSA 3P27A 4JFAA 4HZGA 4MH0R 4KX5A 4RM2A 1YUNA 1V2HE 2R11A 3OFJA 5FEUA 3U7HB 4UE3S 1SVKA 4NS1A 2AMFA 4ISBA 4ZHQF 1IN1A 5JSUA 4MYCA 1KAMA 1NKTA 1TZ2A 3GCXA 1F5NA 1UAAA 4G1BA 4RFLA 3BT7A 2J41A 3E18A 1AHHA 3CB4A 3PUHA 1TDJA 1O94D 1V1RA 2XSZD 4F60A 3W9BA 5JS7A 4JJ8A 1LLCA 2GTHA 3JR3A 3PRYA 3A9WA 2B6HA 5ADHA 5B3AA 2GZ2A 1FLNA 1P2DA 3OQPA 5H59A 2WUVA 2MSEB 1T10A 3IB6A 1YA6A 5GM1A 3THSA 4IQ0A 2NU8B 4NEGA 4DCSA 5DK4A 4NEQA 2E37A 4G0ZA 4EJ6A 4MCIA 4TLCA 1GKYA 2IHVA 2ZYVX 4WH0A 3UUWA 1CXZA 4S1OA 2NUTA 3ZH9B 3RUFA 3L93A 1AZWA 4K28A 1YA4A 2CLSA 2JAHA 4U4AA 5FWYB 3TZHA 1U9YA 4KLNA 1BHO1 1DAOA 1JVBA 2CNDA 2C88A 2JL1A 4EUNA 3JD4A 1XDSA 5HJ7A 1PEYA 3L05A 4QO7A 3M6IA 1HUQA 1UFKA 3I9NA 4C20A 4CIVA 1GVHA 2YC4C 2CNWD 2ZSJA 4EABA 1T6ZA 2D1TA 5TQ2B 3O3MB 1T2NA 4RYDA 3KR1A 1UWKA 1C1DA 1TU3A 3JTEA 3ORFA 2I2BA 3B70A 3EQZA 5IC6A 1EPUA 1YQDA 5K09A 4OATA 2PU7A 5JSZA 1Y9JA 3HJTA 3KYCA 1NG1A 1PTJA 3FPKA 4BV8A 2JH8A 4P82A 4PZAA 1NRWA 1BXRA 1EVLA 1QHHB 2BZGA 4FFDA 1IUPA 4AF8A 3LVBA 3DZBA 5TF4A 2JLSA 3RS8A 3ZHZA 4EPRA 3D3WA 3DOCA 5F9MA 3B5JA 4RCYA 3T5CA 1ADBA 1IUNA 2A9PA 2BTQA 2AV6A 2BH2A 4J0KA 2ON6A 3ADKA 3G6WA 1WXEA 3RS3A 3VPHA 3D6UA 2HNBA 2Y93A 3CLSC 3NM5A 3MUOA 1SUDA 2R6CA 4BPBA 2LE0A 2REQA 3N2NA 4MW4A 1Y7LA 4FMCB 3K1YA 1I0ZA 2P7HA 4KFRA 1Z7WA 2JJYA 1EK6A 3NORA 4B6SA 4E0BA 4KR7A 3GVPA 3IOMA 4YO8A 1Y7HA 1SKYB 2ZQZA 3WDSA 2H06A 4P7BA 4HDMB 1J2EA 3M6UA 4ANFA 1TKAA 5JSYA 1WPGA 3E61A 4CHGA 3PF8A 4HBGA 4Z4IA 4MRNA 2J3LA 3E05A 4C4OA 2XYPA 3AINA 3C7DB 2YJNA 4X60A 3WKAA 4YV1A 4LISA 1MUUA 3ZWPA 2IXAA 4D3DA 5C8DA 1S2IA 3I8SA 1C1DB 1LQTA 1WDWB 2A5LA 2FWNA 5C8VA 5KPJA 3OX3A 3S2EA 4O5AA 4P0TA 1TUGA 1WD5A 4PAOA 1BCSA 1JLHA 1PFUA 2EV9A 3JWEA 4H15A 4YB8A 5ALFA 4DLPA 3SHVA 3G9QA 1UMDB 1QHHA 4UBMA 5D5HA 1ECCA 3TXAA 1QVAA 1OMOA 1QDLB 1X7DA 1KI3A 1ZK1A 2VUSA 1CDZA 3MHTA 2O2SA 3CH4B 3IUNA 1BZYA 1YZFA 1AZSC 4TT3A 5EA2A 4YAJA 4EP1A 2LIPA 3F46A 3QMMA 4MDYA 1BD4A 5BQPA 1TCVA 3DXYA 3L0YA 3F97A 5AI9A 2ZUWA 2AX4A 3FUCA 1OXXK 2IGBA 1C3EA 3AOEC 4KQXA 5SICE 4GHWA 2H57A 3IIEA 3UUGA 2XA1A 1KYWA 3P7MA 1VMKA 3DM5A 4DCOA 2HV9A 5EIXA 1FQWA 2AJ8A 3BXEA 3DBHA 4FN4A 4NZ9A 5FBQB 2YWBA 1DKPA 3BWYA 1QRAA 2IT1A 3FTNA 4GR4A 1SN7A 4GOKA 4WEQA 5AM5A 3AFMA 4ZMRA 1NQAO 1SPXA 3E3AA 4TT8A 1HYHA 2P9FA 4A73A 4PFSA 4F4JA 2FDCA 4HAVA 1P19A 1K7EB 3TLYA 2WIDA 3P32A 2PQ2A 4R1SA 2XT6A 3T1YB 4BFZA 4NCAA 1HT2E 1MV8A 3A1EA 2Q8NA 2VAPA 5HNKA 2XPCA 4R83A 3JZDA 1VC2A 4LF6B 1UP6A 1Z18A 3O9ZA 4PHHA 4OKNA 3JVVA 2LKDA 2GMWA 4I4LA 4LRTB 3ZY6A 2APJA 1OFIA 2AI1A 3TX6A 3IAAA 1RLMA 3AKYA 3FCXA 4HDSA 3HR8A 5SY4A 4CMKA 2O2ZA 4F2GA 3U44A 1N2XA 1XTVA 2YJTD 3MCWA 5M34A 3LUJA 3MTGA 1ZUD1 4LXXA 4L0QA 4TGLA 1IQ0A 2Q8PA 4ZIRB 1YUMA 4TV8F 2GSWA 2VQFB 1PSWA 1DJOA 1EDBA 1DOAA 3G9XA 2I7XA 2OB1A 1G41A 4X93A 1XMXA 2ODAA 4H31A 5TGZA 2GM4A 3PPYA 1SB8A 1I6MA 4NZZA 4JDUA 2J31A 1F1JA 2OHIA 3EA4A 2WU0A 1ECPA 4KHZA 3KJXA 4LMPA 3WLFA 4DMHA 2ZJAA 4B3XA 1J22A 4EYGA 3CO0S 5FUYA 2A30A 2WHXA 3G8CA 1BVUA 3VAAA 4K03A 4HEQA 4PVDA 2ANCA 4I9NA 3GCWA 2Z8YA 3E9ZA 2Q5LA 3OOHA 3T1OA 1J23A 3H87A 3NJ8A 2X77A 1GPMA 2GT1A 4BVGA 2V7WA 1RI3A 1HTWA 2DQ4A 2H2GA 4DLZA 1XWFA 4OMCA 2J4FA 4AJ2A 3DM9B 4B3BA 3Q98A 2IYNA 4JROA 2BUCA 3LBHA 3VSEA 3PB3A 2V6MA 3V7NA 2L18A 2RCYA 5A3SA 3FFXA 1J8YF 3HU5A 3FGZA 3O5AA 4JJIA 4KO3S 1A8QA 3BZWA 3VR4H 2C98A 1MW8X 3GX1A 2PS9A 2A0WA 4LWZA 4WVLA 5JS6A 2FEXA 1TJ5A 2ORED 3F3YA 1P45A 3MCUA 1USIA 1WQ1R 1WCWA 3NRCA 1ZMTA 2F64A 4IKOA 3SC2A 3VBCA 2FZGA 2VHZA 3PDJA 1P5HA 2IC5A 4AZ3B 1V95A 1RLUA 2B8TA 2JEOA 4HWKA 4NBLA 1FFDA 2RJNA 5AMXA 3T9EA 4UQOA 2AIRA 3I2JA 4A2QA 1L8AA 4HT3B 2M6KA 3ZDDA 4G67A 3OZDA 3ELYA 1TT5B 3V7YA 3MAAC 3BS4A 3LDHA 4L4RA 1NSTA 4HDRA 3N0XA 1UPTA 1YRLA 3FPBA 1L1QA 2A78A 2GCNA 7REQA 1XZAA 4JP1A 2C0QA 2QL5A 4NBWA 1ZGCA 3JAMA 1TCAA 1XSEA 4F86A 2Z04A 1XZ8A 3EVZA 2GJ4A 1E1CA 4MAMA 2E9SA 4TTSA 4CG0A 2IYTA 1Q5PA 4AB1A 2JHCA 1O97D 1O9GA 1LDGA 3ANSA 1A76A 3JD3A 4JYMA 1PG2A 4US0R 3NZEA 5L7WA 2W6JA 4PXAA 7AT1A 3DWEX 1ZNWA 4ZU1X 2FEOA 1QKKA 2G63A 2V3VA 4D6YA 3B51X 2CLIB 3HKCB 3V4FA 4KN5A 1E77A 3GJSA 3O75A 1L4BA 1A7JA 2R7NA 2X8BA 2Z0MA 2W37A 1YWGO 3C43A 2WUEA 3GK3A 4KIWA 4REQA 5BSGA 5HR5A 1Q17A 4MB2A 1K9SA 1M7HA 4J3FA 5LYYA 1I4WA 1HNNA 4OGGA 1W48A 3E8MA 3L0IB 5B7NA 4MI3A 1E2MA 3KJEA 3MUNA 5EQFA 5BV1A 2OBFA 3MTEA 1E5QA 4ZQHA 1ND6A 2VPTA 2XNDD 4HGQA 3UMRA 4AZVA 1IONA 1PD1A 3ZUGA 4KOEC 2Y0DA 2O8VA 1PFWA 4RF2A 3V9AA 4X90A 4FMBB 3T7EA 1T5DX 2GM5A 2AXNA 1CJKC 4EHAA 3TNDA 1I4OA 2HU2A 3HN6A 2HCFA 3CONA 3DWIA 5F77A 1YDWA 1YMVA 3LNTA 3WK6A 5FFNA 4ACAA 3EARA 1VI6A 1CQXA 4JL5A 2BZ1A 4AKGA 1QK4A 3LO8A 1Q0QA 1M74A 3VYUB 1NQWA 1X1TA 3QX7A 4DJAA 1Q0PA 1MZVA 3VC2A 4MZXA 2QGFA 3TZLA 1PLKA 2ZRLA 1HORA 3IMCA 2NPFA 4NZPA 4C30A 4WTOA 2J7PD 4B7CA 1NW3A 2X23A 4X63A 3OAAD 3OZXA 4R8MA 1PR9A 4WOKA 5E6SA 2V6GA 3RRXA 3S8YA 2BEWA 3COWA 3MUEA 3L1VA 2D59A 1TYZA 1KS2A 3C14C 1JNYA 2ALJA 1I3OA 2W2KA 2A7XA 2W71A 3IXQA 3MXTA 3IBFA 3LMKA 3SG0A 2K6GA 2DTEA 1NR1A 5JXHA 1KP3A 4RULA 4CHTA 2QY9A 4M88A 1WXGA 1NDUA 3VA7A 1DIBA 3KD2A 3W6ZA 3KX2A 1OBCA 1N8SA 1X3SA 2BFCB 2OBBA 2OCKA 4ARCA 4OGFA 1BQ3A 4E2FA 3FZQA 3Q12A 5K0TA 3NV7A 2FFHA 2P9JA 2V4UA 4URUR 4JYCA 1WMFA 3DBHB 5H3HA 1E8NA 2RC6A 3BGVA 2I34A 4RJ2A 1B8NA 3R0JA 4H1UA 2XGSA 5J1TB 5GPBA 4MLCA 1L5SA 3FH0A 4P08A 1FFSA 1JXAA 3M1YA 1LPBB 2JS7A 5DNVA 1D2CA 1WNFA 1RACA 1ADCA 3ND8A 1KFEB 1MFPA 1LDYA 2HJGA 4YY3B 3WSWA 4FYWA 3ZIUA 4C3VA 4JYBA 3CVYA 1KWKA 4DV7B 4AY6A 2WD9A 4AXBA 4HDKA 5K0SA 3GJ6A 4OB7A 1S89A 3IR6A 4PLVA 1LPPA 1XAIA 3KOZA 3LCVB 4WLUA 4NONA 4TTVA 4BLUA 4BE9A 4XLZA 3F6BX 3P9XA 2GSDA 4K9LA 1NG9A 2JGIA 5E1OA 5CB6A 2IEIA 2QAGB 3OCXA 4YQFA 1ZBQA 3CEMA 3O73A 1M8PA 4YIKA 5FHQA 5T4BA 4WD3A 3G2LA 2IV2X 3IURA 1NFRA 1Z6XA 4H3HB 4K5QA 5B1EA 4F3YA 5ER9A 2GPWA 2YWEA 2YBEA 1KAGA 1USVA 2ZS8A 3NALA 4GE0A 4PU0A 4BP3A 3OU7A 5I7RA 3K9HA 4BBJA 3IT3A 4DE5A 4FEYA 2Q9UA 5T5QA 5CVJA 3JYHA 4BGIA 4E30A 2Q41A 1LQUA 2CJXA 2WIJA 3OC0A 5J5AA 2H08A 3OZAA 3IPXA 5TQ0A 1T2CA 4JJKA 2OD9A 4QUDA 1C3JA 2EFHB 3DOJA 3PVCA 2GO7A 5B2FA 4ZQIA 3O9VA 4CT4B 1JJBA 4IJ6A 1CR0A 1XLTA 4ZTBA 1T5LA 1TOAA 4MR8A 5AKYA 3PNPA 5BYBA 3DZDA 3ZQUA 2DHQA 1FP6A 3MNFA 4CI0B 2HO5A 4EHNA 5LBIA 3F5FA 1KMQA 4PBRA 4JSRA 4QVIA 4NABA 4J91A 4LOIA 5LDHA 2X8WA 1DAKA 3NFYA 3SQXA 5GY7A 3UZUA 5DEIA 3F90A 2VWPA 3A1FA 1V35A 2EJWA 1T8UA 2Q99A 3NTQA 4JD5A 1XNGA 4MV9A 1M8GA 5AK6A 4EZBA 2XXAA 3OZIA 3QV1A 3GLGA 3ANLA 3U62A 2VK8A 4G97A 3OUTA 3LC2O 4EHDA 1RYZA 2G77B 4K26A 5JTUA 1C30A 1KZ1A 1KMIY 1JE0A 2O0KA 1ORWA 3CURA 3LBAA 2OXTA 2XF2A 2AFIE 4KXQA 4QQFA 4YT2A 3SM9A 4R84A 1ZMXA 2E49A 3B89A 1WDMA 3KBOA 2W6MA 3GQBA 1P8AA 2E18A 2QR3A 3EIQA 2F1KA 3CG0A 4G65A 4DV1B 1J70A 1RQGA 4M7OA 3URMA 2A3NA 5LZ2A 2VPWA 5K8UA 1KO4A 2Y0PA 4QRDA 5AKEA 2VJOA 4YDRA 1DRJA 4AROA 1AB5A 4IXMA 5JSKA 4E5DA 3QU4A 4IG4A 2FMKA 4KQEA 3E7FA 4DW8A 5A3QA 5L3SA 2B1RA 4IXNA 4YT4A 2DBYA 2ZT6A 4XIFA 3TR5A 1FEZA 5ESXA 2J32A 5FNVB 3K5PA 3R75A 4ZEWA 4EJSC 3LL7A 3I09A 3LPNA 4QODA 1I9GA 3R41A 1BX1A 3E48A 3QGMA 2B83A 4XRGA 1JXQA 1RABA 1OBFO 4C6HA 4F4DA 4IDBA 4MYHA 1N9ZA 1EAMA 1SPBS 4G6ZA 1RWOA 4IO0A 4ZOCA 4IIEA 3VPXA 2OD7A 2C7BA 4HDOB 4LWPA 4MNTA 3T1QA 3U9TA 3Q7TA 1NT4A 5JPIA 1HXHA 3VH2A 2NQ2C 5KSZA 3LT1A 2QD5A 1B43A 1XNJA 4JI8B 3TTSA 1XL0A 3OZBA 3K6SA 4AICA 5K8LA 2NADA 1UQUA 4NMMA 3GD7A 3WA7A 1Q7EA 4AKIA 2ECOA 2EZ9A 1I94B 1JU4A 3U3RA 1ZD9A 9GPBA 1U2GA 3MINA 4RX1A 3PBKA 1UFVA 5LR6A 2ZT7A 4D02A 4BO0A 1XL1A 2ZBGA 4KZKA 4PHCA 3LT0A 1XP5A 3VNRA 1ENPA 3OLZA 2OCPA 4KACA 3FYTA 3BFPA 4ZI5A 2GPYA 1ZJ5A 4D44A 4D8TA 3BXPA 5EWMA 4DKXA 3TGLA 1B23P 1OJLA 4YECA 2OBNA 1QUEA 3X1ZA 1KYQA 3AFHA 4IQFA 2YJZA 1X70A 2CMGA 2FRXA 5DTEA 4UZEA 4XCXA 1X94A 2C07A 1BHSA 1DKNA 1Z9BA 3SE7A 3GF4A 1UC5B 3ZX5A 2P0EA 1V41E 1ZJJA 3QVXA 3TQOA 1QH0A 4DB4A 2PUHA 4M98A 5TNXA 1Z2OX 1OVGA 3R3WA 2C77A 2VEDA 2X19A 5C7OO 1XF9A 2DPYA 4ZO9A 4QAQA 2H4HA 2CLOB 5FLYA 4B4OA 4C6TB 4QT0A 3I1IA 1NR5A 4DKJA 2DFPA 1QOZA 1M10A 1ZJ4A 3ZXSA 4DRXA 1N0IA 5H81A 4P53A 5L8VA 1XMOB 2XITA 1QGOA 2Q1UA 1PUIA 1NFQA 1YOVB 4G81A 5K6AC 1P1KA 3D4BA 4GUAA 2Z3VA 5DWDA 5E4FA 1QLHA 4G5RA 1NXSA 1RYBA 2H1VA 1KI8A 3ETDA 5E6UA 1I2MA 1DRWA 5K8VA 3V1NA 3VKWA 1YS2X 1SQGA 1TLLA 2F1OA 1EI9A 1CQIB 3K9GA 1EWTA 3G02A 1I6WA 2ILVA 4GLOA 3QKRA 4CEJB 3ELUA 1Q6YA 2WE7A 1Z7GA 4F5WA 2ZYDA 3DAGA 5HSGA 2H07A 4JJ6A 4FR5A 1X1RA 1T3HA 1I6KA 3C45A 3LFTA 3BSSA 3VR2A 1IRXA 4ENPA 3PCTA 2YWXA 1KZGB 3Q9NA 4FINA 3VC7A 1L5FA 3UK2A 3CZPA 4XSVA 4PYKA 1ISRA 2AG5A 2JGFA 3E82A 1XCBA 3CBGA 1AUPA 1J2RA 1L9XA 1WUIS 3OJFA 4QDOA 3H9EO 4W7IA 4CDNA 1QQBA 2HZBA 5LMUB 3AR5A 2VJMA 1E1YA 1YFKA 2BC9A 1ZD2P 2YYYA 4UBKA 3T41A 3K9BA 5I4BA 3LXUX 2VH5R 1JQDA 3ROZA 2JFFA 2NP7A 4KO2S 3NATA 3DLPX 1KE1A 4Q6WA 2KSQA 4LVUA 4AJEA 2VQ6A 2P2DA 2QR2A 2QD1A 3LYLA 5DF1A 4F9GA 2Z4RA 1RCFA 1JLLA 3W06A 5FJIA 4JI7B 5CNIA 3ZZ1A 2AG6A 3EYAA 4M8KA 2EW2A 1FL9A 1MRZA 2EKLA 3BTUA 1ISJA 4FR2A 4PPFA 1IJBA 5A0VA 2G28A 3LPLA 3I2GA 3IRUA 1EGVB 1VB3A 4IVNA 2CNOA 3T7KA 4ROSA 1N1GA 2PK3A 4LA4A 5FBLB 8ADHA 3B9QA 3JWGA 4Q9IA 3SF8B 2IS1A 1W93A 4MS1B 3KPYA 1CNMA 4FN5A 2YBDA 4D98A 4N6GA 4XQCA 4RZHA 4IGAA 1RRPA 3W5CA 1ES9A 4EVQA 1BSVA 3PJFA 4A2PA 4KMSA 2CFCA 3PNSA 4YMWA 4HB2A 3WGTA 2C1ZA 3JYOA 3K2BA 4KFTA 1N8KA 3WAKA 1I9CA 4RV5A 2NIPA 5EPEA 2NNWB 1L4YA 1HV8A 3EG9B 1QKIA 5IVDA 1U11A 3QP9A 4U3JB 5HKKA 2YMQA 4TYPA 1AGPA 2EKZA 2V9PA 4P2GA 3SHOA 3DEFA 3SZOA 2FWPA 5EKTA 3HZZA 1W88B 2IPMA 4QKQA 2XLBA 1T9ZA 1UBOS 3I9OA 1A7KA 4KHPB 3AHJA 3COJA 4YP0A 3VR3A 5AVUA 4JBNA 4LRYA 4HYYA 2XUPA 2B20A 5K0EA 4E88A 2H18A 4ZOLA 4C2AA 4YRGA 4LCBA 2XB9A 2OHVA 4PLHA 3C5CA 4RQAA 5MGNA 5JDCA 3HXOA 1GV1A 3DVAA 1L4HA 3CWQA 4KQ2A 3RGGA 2P9GA 4PS0A 1B8VA 3DG9A 3AHIA 3DFFA 3OSZA 3T5MA 1LNQA 5HRCA 2J0SA 2IS4A 2ZYSA 1I1NA 4GMGA 4UBJA 3I3OA 3K0BA 1EBBA 4L3OA 3NIDB 3RVOA 3B2NA 4BAUA 3OC6A 4RAOA 5FTWA 3RFTA 1G0OA 1OXTA 3A14A 3ORHA 1VYHA 4C6RA 2ZJ7A 5DWQA 2R97A 2C8KA 5FPPA 1GZSA 3LBYA 1U2SA 4MQBA 3UK1A 4A2CA 3H11B 1K3TA 4EZEA 2GBLC 3MCZA 2JFZA 1N7JA 2UZ1B 4WK6A 4ND8A 4ECEA 5BSVA 3EW9A 1W76A 1ZAKA 2PMBA 2GPSA 1USUA 2NTEA 2FVYA 4BX3A 1RIIA 1ECJA 1WX1A 1YVPA 3FPAA 1GPJA 3LFHA 2C4TA 1W0JA 2ZBEA 4RKYA 3FGPA 2CL6X 2HCTA 4Z4EA 4MS3A 1U5BA 3DOOA 1JZQA 1QVVA 1MT0A 3GEIA 1L7RA 4Q3KA 4RK1A 1XQ1A 2XD4A 1KA9H 2GWHA 1R0CA 3T5DA 3T9CA 2DERA 3SNKA 2P1ZA 1Y1SA 1N2CA 2KJQA 3QG1A 4EHJA 3CEPB 1E2LA 1M1NB 3NHSA 4XCVA 3D3JA 3LECA 2HJ9A 4JC5A 4YEDA 3B53X 4DCMA 5I9NA 3NKFA 2BBOA 4RV4A 5DRTA 4AZTA 2B7LA 2QX9A 2OD2A 2WABA 3UOGA 3ZWOA 4FFMA 3JVIA 5TX7A 4DCGA 3T15A 4C03A 2QP9X 4UMDA 4L0DA 4A0GA 1KJWA 3VSAA 2IE0A 4HDNA 2R1ZA 4Y9RA 2HRZA 2I3GA 3PUWA 2VUIB 2I2CA 4B48A 3RT1A 3RJTA 1IJEA 3E2IA 3S0JA 3EY4A 2F90A 4AG5A 3F1KA 4GBMA 1EUYA 4IOLA 2PX3A 2JIPA 4CEJA 3R7NA 1YAJA 3A1CA 4PPNA 1VCIA 4AURA 1BA2A 1NUPA 1PZEA 3ENZA 3FAKA 2PYZA 2I8CA 3QNMA 2E1PA 3HXLA 2GEFA 2ODQA 5HILA 4BGVA 2YNMC 1ZYUA 3H7AA 4M4SA 5F73A 3IUSA 4LMRA 2CYBA 2J46A 4IJVA 4N0QA 3B6JA 3AJEA 1S3FA 3EH2A 3GT0A 4OO3A 3LL4A 1BE6A 4MJ7A 2XB8A 1ZD1A 5IUNC 3T1TA 5IKXA 1VE3A 4J9UE 2FEAA 2FWAA 1BWSA 1Z4MA 4C7OA 3O2SB 3PGXA 4E5VA 5DI9A 5E0KB 2ZBVA 3KVRA 1FFGA 5HE9A 4NQZA 1IG3A 3SXUA 3W5UA 5JJLA 1VECA 1XI2A 2CCKA 3MWEA 4GQIA 1CUGA 4FI3F 3EB9A 4CDMA 3EF3A 2A4MA 2X7XA 4RL4A 5IANA 3V8BA 1JG3A 3TKLA 3HVIA 1DBWA 3JARA 5PGMA 5JANA 2O20A 4DBLE 1E6CA 1GP2A 2E4WA 2B1QA 3O82A 3P52A 4HHEA 5TS2A 2Q3LA 3OE7A 3TL6A 5EUCA 2VK1A 4F6RB 5A4IS 4MB0A 2CLCX 1L5MA 1RADA 4N54A 1J97A 1ADYA 2FR8C 4ZQFA 5J4YA 3O4HA 4JT8A 4WJKB 4EB6B 4F4HA 1U2ZA 3C6QA 3NI2A 4D0LB 4YXFA 4F4FA 4LDAA 2PJUA 2XR1A 1IEXA 3IAUA 3NX4A 5B55A 4TOIA 4E7PA 5F1PA 1SB9A 1TZKA 1N7IA 3F5SA 4M87A 2Q0XA 1P39A 2GF2A 3WLSA 4B87A 4Z0NA 5LZ8A 3RT9A 3D1VA 4R41A 5JUWA 3S5UA 3I6BA 1WO8A 1KDTA 3A6PC 2IUEA 1CSEE 1YKSA 2P78A 3QKTA 4U9IS 2H5EA 2VKTA 4KQGA 4RMNA 1TEZA 1P8JA 4OHVA 5HKAA 4KO1S 3IVAA 2B8JA 2EX4A 2JI6A 4Q00A 2QV7A 2A59A 3GMTA 3RRZA 3VO8A 1I0IA 1EZ4A 4DCCA 1QTNA 4ISCA 3W78A 4L5YA 3A1WA 3I42A 2CFRA 2H1CA 2H5LA 1CY1A 1WHTA 3ZY3A 3UWMA 2HDNB 1JHUA 2IXGA 1FUIA 3B8HA 3GH1A 4RJKA 4DJTA 2AGVA 2IYQA 2C94A 3FZGA 1VBFA 3PZRA 1SZCA 3DEIA 3HRIA 1G8PA 2YYZA 3GPIA 3W6NA 4A36A 3BDVA 1YB6A 4GOJA 5YASA 2YZ2A 4MTLA 3HCDA 4Q9KA 2XDYA 3DQZA 3TGWA 3IVGA 3RC8A 4V02A 4D9JA 4TKZA 4E03A 2AZTA 1GPUA 3TBFA 5A1JA 4AMGA 2WZBA 4JZYA 3U3KA 1PDVA 3P2KA 3WTCA 1DGQA 1L5GB 1PV1A 3GVXA 1X92A 2D3WA 4FYYA 5MN6A 3S8EA 5FUWA 1L4LA 5JAIA 1BVRA 2I9KA 1NVXQ 1YR2A 2P2NA 1SXJC 2ZRIA 3AR9A 2WTMA 4OP3A 1Q7CA 4DV4B 1T4CA 3KPVA 2HLDA 2D1SA 1Q84A 4HCJA 4I9HA 1GUYA 1NVWQ 2ZB7A 1ORHA 1TCBA 3DOHA 4IJUA 4KVGA 4MGZR 4JB0A 1OFUA 3R09A 1US8A 4I50B 3RB8A 3CW8X 1BE8A 1JU3A 1G7TA 4BUCA 4KU4A 3HDJA 1HLFA 3RF6A 2ZJ6A 2D1QA 3QF4B 2G07A 2IELA 4B4VA 3L4EA 1V4VA 3IMEA 4IZIA 3RUIA 2X8JA 4PC1A 5HTKA 4EHLA 1RC8A 3PUKA 3EZLA 4R16A 4C76A 1UK9A 3KVYA 3H2YA 1ZUNB 1WDLA 4XSHA 3ZI0A 5BR4A 3VR6A 3ZEIA 3N0RA 4RZUA 5IXSA 5BORA 4RK5A 4XWAA 1AS3A 3C1AA 3CLUD 1CZKA 4H6PA 2AOWA 1AZLA 4NC9A 5C0OE 3T5TA 1KRXA 2ZI6A 3DO8A 1SIWA 2Z5GA 3EW7A 1A2KC 1N57A 3VYWA 4BU0A 1B4DA 3CBQA 2LBPA 2BF7A 2WYIA 2PSFA 1E2QA 4PSCA 4BFYA 4WN3A 5HOQA 1XRSB 2ZSBA 1YB4A 1T1SA 4BE7B 2WSSD 2HWKA 4K9RA 1M1XB 3AI3A 3ILYA 1NW6A 3RROA 5D6NA 1U28A 3MWYW 4C4YA 5AVJA 2C7VA 2VPYA 1FYDA 3I72A 3JVDA 3NHBA 3OLVA 1KGSA 2CDBA 2ISCA 2QMYA 1U4OA 3LHKA 4HGZA 4FB5A 3ROGA 4UNRA 4MKGA 4DT1B 2VXYA 3FFWA 4LBYA 2CE2X 2J59A 4JBGA 4HFJA 1V16A 2PLNA 3E7DA 5L45A 2R6JA 1YTLA 4LMAA 1MRNA 2MT9A 4LRWA 3U4AA 3KELA 3RRFA 3GDWA 4QLBA 1DKRA 2HM7A 2YZMA 4RPIA 2EEPA 5BPFA 3T34A 3TB6A 3F8SA 4D9BA 1REQA 3MMSA 3L4JA 4OMDA 4ZJPA 2Z30A 1COWD 1OOEA 4LKOA 5EY5B 3PI7A 4FFPA 4EI9A 5CVDA 1ST2A 4CR8A 4LHWA 5HE8A 2PH5A 4R40A 2J9GA 4UC0A 1TPZA 5HIJA 5C1OA 5LOVA 3O83A 4B4UA 1ML4A 1ZC3A 3P26A 2YJ3A 1ZBDA 2F1HA 3EGCA 3NHYA 2F3QA 1FRFS 4GDFA 3GQBB 1OWNA 2ZKIA 3JZIA 3F71A 4FXPA 3SQNA 5IM4F 1GPYA 2OO5C 1J0BA 5EYPB 3JASA 2KX7A 3H1PA 4PX3A 1FSFA 1KZ6A 5JECA 2V98A 2V7GA 5CDGA 2D2EA 2QD4A 1T5IA 2EX1A 2KBEA 2FSUA 2JC3A 4G1UC 1NVVR 4Y6RA 5CLQA 3HH8A 4JBIA 4RNDB 5F35A 3VRHA 3HFSA 4YUAA 1UAYA 2AYXA 2MYNA 2YS7A 3PU6A 5JXGA 4IIUA 2EKPA 3C70A 5TQ2A 2LNDA 5JASA 5FKJA 3JPYA 4L0MA 5LP6A 4JBHA 2FN4A 1ORIA 1OREA 1R5OA 2XUKA 3I2KA 2AHOA 3L9WA 3MGBA 2QF7A 1SUIA 2GB4A 4OG2A 3LXRA 3BKXA 2BR5A 4E3ZA 2SECE 2DFKB 2A57A 1NNUA 3FYUA 2WWYA 4IJ5A 5BWMA 5ERYA 1M6VB 2NVBA 4ZU3A 4CNQA 3FDXA 4R1LA 1GQRA 1AKEA 1H1LB 3AIOA 4LNAA 2TSYB 1KMHB 3C3CA 3FGNA 2HLPA 1MU0A 5CGZA 2QRLA 2JI4A 4FONA 4WZBB 5FOTA 4DAOA 2JANA 2FN7A 2A67A 2AFIB 5BNFA 1WLYA 4N7JA 4RTQA 2E4ZA 1GGVA 4J0CA 3OQNA 4M38A 2R7MA 4RVOA 3R3HA 4NOJA 8GPBA 3GBPA 4XUGB 2X22A 1L6IA 2VH2A 4G07A 4RSMA 3I23A 2HMTA 2RCNA 3O4JA 3D43A 5FHRA 1SCJA 1VRCA 1LZKA 1PNVA 1LXCA 2QE7A 2XYRA 4WKPA 3A1UA 4CN8A 4M21A 3FCSB 2VHJA 4TSRA 1U9IC 3HXTA 1N9GA 1PGQA 2R2AA 1GY8A 2V1XA 3EF0A 3ZZMA 1WABA 4JT2A 2R1VA 4RKFA 3UMFA 1NMQA 2F17A 2JVIA 3FPSA 3DZ8A 4FIDA 4OJYA 4TUYB 1Q11A 3DKVA 3HZRA 5CW1A 4J3NA 3UPTA 1XBTA 5KU7A 4LF7B 1NFFA 2WUGA 4RA6A 1NTRA 1PQWA 4G85A 3RSFA 4KREA 5G0WA 4DLYA 2FDRA 2C2OA 1GLVA 4Y9TA 4P3KA 1TU4A 1WMDA 2VDVE 4ZVNA 1A72A 5AOBA 3UUEA 3OKPA 4Q4HB 1YU6A 5HF9A 5LWHA 4LECA 1CRQA 2WP0A 3V4PB 5AVZA 2YOGA 4TV9F 4EW2A 4HRXA 3NT5A 4PHGA 5CDUA 1EXVA 2OC4A 4HGOA 5ALOA 1WTCA 3B20A 4BDSA 1QHXA 1UBHS 1J1ZA 3MUFA 2C7OA 3OBBA 4LYAA 2A1UB 3R7WB 3NRBA 4AVYA 5DYNA 3TOVA 4DLVA 1KSFX 2GEJA 2NO0A 4R2MA 3P9NA 5A7HA 4B5LA 4JOSA 4NULA 1GVNB 4KE9A 4TZ0A 1GUZA 3UAXA 3NCTA 4Q03A 4FHFA 3ZZUA 3IP8A 4RIEA 2NXJA 2HGSA 1NDQA 2VPPA 3KB8A 4GPEA 3H8JA 3CF0A 1SRQA 2Q2OA 3HABA 3KU1A 3OF5A 1B1CA 4KWTA 1X7YB 4NSNA 5ANRB 3G9TA 1L7OA 4I3FA 2YQZA 3NHLA 1V4BA 1QE5A 3JYQA 2AYZA 3GAFA 4OD0A 4Q48A 4NV0A 3TFOA 3F2IA 3IEMA 3IILA 3QUTA 1XMQB 2B36A 3RVSA 5GZ3A 3F2VA 1LBQA 3VPCA 1Z63A 3JQDA 4XA8A 2GRJA 4HAIA 3L6CA 1OX6A 4E4YA 6CHYA 1Z73A 1QZUA 2QVYX 3EJ6A 4I14A 4OH7A 3HCBA 2C92A 2D0PB 4HQNA 4E11A 1T9GS 1SQ0A 5J4VA 1HEIA 1E98A 2PGIA 3PFHA 3VAZA 5HVNA 4MP3A 3GRKA 5AI4A 1KS9A 3Q7SA 2BTOA 1X7XA 2Y3IA 2G5CA 2CUZA 3JQCA 3L5OA 5H0IA 4REOA 3UCEA 4D4JA 2QUIA 4TKLA 1EHIA 2CFOA 1WPRA 1NW8A 4FHEA 3RHSA 4G1EB 2NTVA 3AW8A 3OWOA 1TUEA 1CT9A 4LOHA 4G5HA 2UV8A 3N3BC 1BDHA 1BMFA 3BL8A 1XQ9A 1R18A 4UUAA 4ZK2A 1CEYA 5KWIA 1UEIA 2RHDA 2ZSUA 1H2RS 4L16A 4M36A 4TXLA 3TBKA 5AW1A 2PX5A 4ZT6A 3LE8A 3F98A 4I7EA 1M83A 4BWYA 4RVFA 3N28A 1LF0A 4YJGB 3RVDA 4YUYA 4TV9A 4EH1A 1KZ7B 4QBFA 2O6HA 3JASB 3VU3A 1KARA 4OFBA 4ZVOA 4GAEA 5ECYA 3BGSA 5E4JA 2JDIA 1RRFA 3IKMB 5DB4A 5GGXA 2BE9A 3BVPA 4LI3X 4EF6A 5A5EA 4DV3B 1PCXA 2SKCA 3R5KA 4AN4A 4CFZA 1RIFA 1UXOA 3DEHA 1UKCA 1EK2A 2ATEA 4FMDF 4YT8A 2W22A 2I67A 3CRRA 4BVEA 4Z3DA 1D4FA 5CFOA 2OESA 1ZH2A 4FS8A 3RAPR 1TVKA 1PI3A 2GVDC 2Z58A 1WEHA 5IJ0A 3V55A 3CNQS 5IVIA 2CCJA 3ZLVA 1SBCA 4QM7A 5F51A 1RM0A 3DLAA 1GG9A 1AO0A 1UZAA 1G2IA 2O2IA 3MG9A 3O94A 4LXYA 1JJIA 2GOYA 4M7RA 1JFSA 4FT2A 3T7DA 2X9VA 3A6GA 3I53A 3QEMB 4KYTA 5FBZA 2K2QB 2RGYA 2JD2A 1YZYA 2IYVA 2RGCA 3E4DA 4R69A 5B3JC 2KLBA 1Y98A 2A4KA 4KJXA 2RGXA 5NULA 3FOFC 1UJMA 2VPXA 2E2WA 3OTQA 2XV1A 1GT91 1LBHA 2PIDA 3A4IA 4OK5A 4ZYYA 3DL0A 1M8JA 3QXGA 4DIBA 2F6RA 3I92A 5J5CA 1E0AA 3L1UA 2FQXA 1VCMA 5GAJA 3ZWYA 5G1NA 3I45A 1DIAA 3A7EA 4C7KA 1B41A 2OVBA 1OH6A 1PZMA 3PFFA 3E58A 3SZUA 4NFSA 1CVRA 1QTIA 2Y6UA 3CX6A 1J42A 2OCXA 4OHRA 3S2GA 3EBLA 3MWDB 4EGQA 3STVA 1QYCA 3D5TA 1CUAA 4UPEA 1E6UA 4ER0A 1XNRB 3D1JA 3UWDA 3H11A 2KW5A 2WNHA 2Y67A 1PYDA 1FXWF 2FK7A 2GFQA 5BW8A 3ENNA 4N9QA 2A0FA 5FI0B 1LDBA 2OCBA 2IW3A 5KQLA 1DC5A 3A9RA 4X1YB 2NYUA 3TLAA 2WE8A 4HAUA 5LU9A 4I55F 1J21A 4ZTZB 3P0RA 3IPAA 2VHUA 1EAYA 4F7WA 2QB5A 1Y8RB 3M4ZA 4N6NA 2CL7X 4B6FA 1P0QA 3M3PA 2VXCA 5DI3B 3Q7IA 2B4AA 3D6FA 4M2LA 4X7MA 2N9UA 1JDJA 4XWWA 1KEWA 1D03A 1CZHA 1ZD3A 2AC7A 2VH1A 3CISA 4YQYA 5EFZA 2X42A 3TQRA 1SVSA 4M1KA 3RSQA 1JIIA 2NSYA 3CX7A 1W47A 2WWVD 3S1AA 3KALA 4FLMA 4NZMA 1Y48E 3DB1A 3G59A 4QUGA 1K3UB 1KMMA 1QZ3A 2DPLA 4RH1A 4G8CA 4U6SA 2DPGA 3RJ5A 4BKRA 2RE8A 3NHWA 5BT8A 2FLWA 5LCXA 3N2GB 2AUNA 3MT8A 4RACA 1RHQA 3EJWA 1H9CA 3C7CB 3K96A 2XWPA 3GA5A 3EVFA 4PN3A 4HGYA 3QK7A 3AF0A 3KYIB 4JQOA 4OFZA 1B1AA 4UAUA 2VN8A 1IH8A 4E2ZA 1GLNA 2QLJA 4P83A 2CV1A 3EGXA 1TUBA 2R2GA 3VNQA 1Z37A 4LJSA 1BHJA 4PONA 3WMWA 5I6DA 5BMOA 1JIUA 3PD1A 4DDWA 3SIPA 2J1LA 5ES3A 2HJSA 2ZQ5A 4OHKA 4YRJA 2OZKA 1IM5A 1DG9A 1MT3A 4GEGA 4MS1A 4N7RA 4RPJA 2PRSA 3ITEA 1NHWA 3BRWA 3AVQA 1PV4A 1W4AA 2PT5A 2EIHA 3D3NA 4OA5A 2VPZA 5KB3A 3WDLA 1UKZA 2ZIEA 3U3XA 1SHUX 2CNKA 3UOAB 4UUOA 3FYUC 1CY6A 2WYVA 4X84A 3FOEC 4MW5A 5C5DA 4J16C 2CWDA 3ZV5A 3LPAA 1K5DA 1TJYA 3V4LA 2BGUA 2C2MA 1XEXA 4PS1A 3E03A 1CF2O 2ZR9A 1QIJA 1VMDA 3MJHA 4LY6A 5JH7A 1ZEMA 1WLSA 3B6IA 3V8RA 1O5TA 1OXVA 4F46A 2H92A 1E1DA 4IDNA 3R5SA 1ZD4A 5D8DA 3H1EA 4ID9A 4JX9A 3ZI4A 4EKYA 2WK1A 1DWQA 2V9ZA 3KQUA 2EEZA 4NPHA 3SS9X 1WZ2A 2W58A 2QQEA 2X2OA 3DBRA 3IX7A 3UEOA 3W1EA 5B37A 1ONPA 2C99A 3ZCUA 4JA0A 3I0NA 2FMFA 2GN6A 3KSBC 3WOVA 4RXTA 2FUCA 3AI2A