The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
13
|
sequence length |
43
|
structure length |
43
|
Chain Sequence |
MKKRLTITLSESVLENLEKMAREMGLSKSAMISVALENYKKGQ
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Gene regulation/dna
|
| molecule keywords |
DNA (5'-D(*CP*CP*CP*GP*TP*GP*CP*AP*CP*TP*CP*AP*AP*TP*GP*CP*A
|
| publication title |
The structure of plasmid-encoded transcriptional repressor CopG unliganded and bound to its operator.
pubmed doi rcsb |
| source organism |
Streptococcus agalactiae
|
| total genus |
13
|
| structure length |
43
|
| sequence length |
43
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 1999-11-15 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF01402 | RHH_1 | Ribbon-helix-helix protein, copG family |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Arc Repressor Mutant | Met repressor-like |
#chains in the Genus database with same CATH superfamily 2HZV A; 2WVF A; 2JXH A; 2RBF A; 2K5J A; 1PAR A; 3QOQ A; 2BJ9 A; 1MYK A; 1BDV A; 2BJ7 A; 2JXG A; 3GXQ A; 2CA9 A; 2WVD A; 3FMT A; 2JXI A; 3VEB A; 2CAJ A; 2WVE A; 3H87 C; 2K29 A; 1BAZ A; 2K9I A; 2K6L A; 1EA4 A; 1NLA A; 2BSQ E; 2K1O A; 1U9P A; 4HV0 A; 3OD2 A; 4FXE A; 1X93 A; 2CPG A; 3LGH A; 1ARQ A; 1MYL A; 2GPE A; 4ME7 E; 4D8J A; 2H1O E; 2CAD A; 2BA3 A; 1IRQ A; 1ARR A; 1BDT A; 3FT7 A; 3VEA A; 3VW4 A; 2BJ3 A; 2AY0 A; 2BJ8 A; 1QTG A; 1P94 A; 1Q5V A; 2WVB A; 2WVC A; 1B01 A; 1B28 A; 2KEL A; 1MNT A; 2BNZ A; 2HZA A; 2CAX A; 2BNW A; 2BJ1 A; #chains in the Genus database with same CATH topology 2AN7 A; 2WVF A; 3QID A; 3QOQ A; 1BDV A; 3GXQ A; 3FMT A; 3NAH A; 3H5X A; 3SFU A; 3SFG A; 1BAZ A; 1OG7 A; 3NO7 A; 2JBV A; 1ARQ A; 1U9P A; 4FXE A; 3LGH A; 4MJW A; 2CAD A; 1IRQ A; 3FT7 A; 2BJ3 A; 1Q5V A; 2UUW A; 1MNT A; 2ADL A; 2CAX A; 3IR7 A; 2BNW A; 3LJP A; 2RBF A; 2JXH A; 2K5J A; 1PAR A; 2H3A A; 2BJ7 A; 1OHN A; 2JXG A; 3BSN A; 2WVE A; 3H87 C; 2K29 A; 3G5O A; 1SH3 A; 2K6L A; 1NLA A; 3NAI A; 1MYL A; 2KOE A; 3VEA A; 2AY0 A; 1P94 A; 2KKE A; 2HZV A; 1SIW A; 2BJ9 A; 1MYK A; 3VEB A; 2CAJ A; 2UUT A; 4LQ3 A; 2K9I A; 3UR0 A; 1SH2 A; 2Q2K A; 1EA4 A; 2K1O A; 3OD2 A; 2GPE A; 4ME7 E; 2H1O E; 4NRU A; 2BA3 A; 1ARR A; 1BDT A; 1B01 A; 1B28 A; 2KEL A; 2BNZ A; 4LQ9 A; 4AAI A; 2WVC A; 2BJ1 A; 4LRV A; 1Q16 A; 2CKW A; 2CA9 A; 2WVD A; 2JXI A; 4O4R A; 2BSQ E; 4HV0 A; 1X93 A; 2A2B A; 2CPG A; 4QPX A; 4D8J A; 3BSO A; 4NRT A; 3VW4 A; 1SH0 A; 3NNE A; 2WVB A; 2BJ8 A; 1QTG A; 3UQS A; 3H5Y A; 2B43 A; 2HZA A; 3UPF A; 2WK4 A; #chains in the Genus database with same CATH homology 2HZV A; 2WVF A; 2JXH A; 2RBF A; 2K5J A; 1PAR A; 3QOQ A; 2BJ9 A; 1MYK A; 1BDV A; 2BJ7 A; 2JXG A; 3GXQ A; 2CA9 A; 2WVD A; 3FMT A; 2JXI A; 3VEB A; 2CAJ A; 2WVE A; 3H87 C; 2K29 A; 1BAZ A; 2K9I A; 2K6L A; 1EA4 A; 1NLA A; 2BSQ E; 2K1O A; 1U9P A; 4HV0 A; 3OD2 A; 4FXE A; 1X93 A; 2CPG A; 3LGH A; 1ARQ A; 1MYL A; 2GPE A; 4ME7 E; 4D8J A; 2H1O E; 2CAD A; 2BA3 A; 1IRQ A; 1ARR A; 1BDT A; 3FT7 A; 3VEA A; 3VW4 A; 2BJ3 A; 2AY0 A; 2BJ8 A; 1QTG A; 1P94 A; 1Q5V A; 2WVB A; 2WVC A; 1B01 A; 1B28 A; 2KEL A; 1MNT A; 2BNZ A; 2HZA A; 2CAX A; 2BNW A; 2BJ1 A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
