1B2LA

Alcohol dehydrogenase from drosophila lebanonensis: ternary complex with nad-cyclohexanone
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
254
structure length
254
Chain Sequence
MDLTNKNVIFVAALGGIGLDTSRELVKRNLKNFVILDRVENPTALAELKAINPKVNITFHTYDVTVPVAESKKLLKKIFDQLKTVDILINGAGILDDHQIERTIAINFTGLVNTTTAILDFWDKRKGGPGGIIANICSVTGFNAIHQVPVYSASKAAVVSFTNSLAKLAPITGVTAYSINPGITRTPLVHTFNSWLDVEPRVAELLLSHPTQTSEQCGQNFVKAIEANKNGAIWKLDLGTLEAIEWTKHWDSHI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALCOHOL DEHYDROGENASE
publication title The catalytic reaction and inhibition mechanism of Drosophila alcohol dehydrogenase: observation of an enzyme-bound NAD-ketone adduct at 1.4 A resolution by X-ray crystallography.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 98
structure length 254
sequence length 254
ec nomenclature ec 1.1.1.1: Alcohol dehydrogenase.
pdb deposition date 1998-11-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1b2lA00
3WGTA 2QYSA 1LRJA 1Z82A 2I99A 3GGOA 4XRGA 5A9TA 5ITWA 2PGJA 5DCWA 2JJYA 5EQFA 2Y93A 2IE0A 1Z7BA 1NPDA 2O3JA 2ET6A 1E3EA 3CINA 4M8SA 4B8ZA 1E1NA 4WPGA 4FFNA 3OSUA 4Q3AA 1NR7A 3MOGA 1X7DA 3ASUA 5BSFA 2FR0A 3F6YA 2Y1DA 3LT0A 1LNQA 3T7EA 1Z75A 3AFMA 4GI2A 1MB4A 1QSGA 2A9FA 5THKA 4LVUA 5IXSA 2C07A 4NZ9A 4NI5A 2IXAA 4D41A 2IDZA 1FDWA 1WNTA 4OJNA 2AE2A 4CQLA 3HJAA 1IHYA 4F46A 2OGUA 4FIZA 3OIFA 2PNFA 4M55A 3TL3A 2NADA 4KUEA 4BNYA 3DBLB 5I9NA 2ZYGA 3GPIA 4YAIA 1E3LA 4FPXA 2R2GA 2CY0A 3ZV3A 4BVAA 4BO0A 3R3SA 4ZHSA 1NVGA 4YJHA 3ZI0A 3OETA 4QUKA 1V8BA 5C37A 2E48A 3HNPA 3PJDA 2CDAA 2WEKA 1MX3A 2DT5A 2AHRA 2HKIA 5ADHA 3MJTA 3VHRA 2P2SA 3PZRA 1Q7GA 3BMCA 3I6QA 1LXCA 2I65A 5CP8A 3RUIA 4LMPA 3H6KA 3FNHA 1DOHA 3H3JA 1DIBA 5TC4A 1UZMA 3FHLA 3EK2A 5JS6A 3L0DA 3EGOA 1YGYA 3GGPA 3M6IA 3AWDA 4PVCA 1J4AA 4TWRA 5T67A 3KETA 3DAFA 3BMQA 3U4IA 3RC7A 4D44A 3BIOA 3CXRA 5COAA 4AJKA 4II3A 1H9BA 1MP0A 3QWFA 1HDRA 3DBHB 4JP2A 3DZFA 3GH3A 4L8VA 1UDBA 2HRBA 5HA5A 2AQIA 5FWNA 5A02A 2BKAA 3OBBA 4TZTA 1CQIA 4FS3A 4BNKA 2O3QA 2Z95A 3C1TA 2P9EA 5J23A 3T4EA 1V6AA 1XKQA 3PPIA 4E2YA 3VVCA 1BVUA 1BHSA 1YQGA 2OFPA 4WLVA 4FGWA 4IXWA 1L1FA 1NQ5A 3MJVA 1TXGA 2H1SA 4E0BA 4PN3A 3KXDA 4BNGA 2WD8A 2XXJA 3LLSA 1VLLA 2DUWA 4PCVA 1RM0A 4M89A 3O9ZA 3UCEA 1OI7A 1BDMA 5EERA 3INTA 4Y67A 4R41A 1KBZA 4KOAA 3PI7A 1HDXA 5TF4A 3PVZA 5K9ZA 2GDZA 3SX2A 3RWBA 3UAGA 5HRUA 4DYDA 4YJHB 3ROKA 2EIHA 3RD5A 4XQCA 3WGZA 4KQWA 1NM5A 1LSUA 1Y8RB 2EGHA 2TMGA 3F1KA 1E5LA 2P9CA 1QRRA 3GY0A 4ZQBA 2H9IA 4IY1A 1G6KA 3WFIA 4E2WA 2VZ9A 4PLGA 4GAEA 5ICSA 4UVEA 5F21A 4FJ2A 4WCFC 3LF1A 1YBVA 3V1YA 3KSZO 5TX7A 3UN1A 4D3SA 2B36A 2YV2A 2X0RA 1P0FA 3JQDA 4E12A 2UAGA 5EINA 4K26A 4IJVA 5A06A 4AJNA 4P38A 1WXDA 1XYGA 5EJ2A 3K31A 2VNAA 2E4AA 3KLPX 1O94A 2YHUA 3PQDA 2X0JA 5HS4A 1PQWA 2O3RA 2JHFA 3DBHA 1ADBA 3FI9A 3HSKA 2ZYAA 3KEOA 3LZ6A 1NWHA 4IDEA 1B8VA 1A5ZA 2YFHA 3AUUA 4IDFA 5BQFA 1PGOA 1T4BA 2VHVA 4JLWA 3VH1A 1EBFA 4CLDA 4MVJD 1YL5A 3E8XA 2AXQA 2H6EA 1KVQA 3NDIA 4H3VA 3ZWMA 1KETA 3CIFA 2OORA 4FFMA 4YAEA 4TZKA 3AM4A 3TQHA 3PTZA 2EW8A 4NJMB 5BNFA 4CM7A 4NBUA 1HE4A 1ZSNA 4P4GA 4PG5A 3OJLA 1X0XA 2R6JA 5G0TA 3E6AA 3W8DA 4ZQHA 2YJZA 4PLCA 4P8RA 1E7WA 4U0JA 4TQGA 4YT5A 1QYWA 1FK8A 1MGOA 1VC2A 2DFDA 2C5AA 3DZKA 5KKAA 4TSKA 3TZQA 3WBFA 2VWPA 2C20A 4PLVA 4M86A 1BSVA 2VT3A 3B1JA 5BT9A 2FPIA 3Q0EA 2BFPA 3ZU4A 4N5LA 3V8BA 3JQ7A 2ZTUA 1NQAO 1CERA 2Y68A 4B4VA 2DVMA 1QLJA 4DGSA 2CF6A 1E92A 2O2YA 2PWZA 3ANLA 1SEVA 2HJSA 2J5QA 3ITDA 4KZPA 3NRCA 4YDRA 5JNLA 2Q99A 1LBEA 3DWFA 4GWKA 5EQDA 4D45A 4B8WA 1YJ8A 3KB6A 1JWBB 3PJGA 4E13A 4RQUA 2QZ9A 5L4LA 4BHTA 3PZBA 2Q49A 4B4UA 1GR0A 1NQOA 4GSKA 5JY1A 4PLTA 2B0JA 3KSDO 3WGHA 2X5OA 3BXXA 4I5GA 4FJ0A 5FYDA 3N58A 4GBJA 4CJXA 5KJ6A 1V0JA 3ANNA 1JU9A 1HKUA 4K6FA 5CAEA 3NTRA 4LCJA 4ZU3A 4E32A 1LA2A 1KEPA 1IL0A 1H9AA 5I7EA 3OQBA 5AOVA 1LLCA 4ALMA 2PTGA 3INRA 5AXBA 4CMJA 5JMWA 3GVXA 5H82A 2DUUA 1X1TA 5G0UA 2XPCA 1UP7A 4QFDA 3C1OA 1E1MA 3I9LA 1JDJA 5G4KB 2BGKA 2ZKLA 4DPMA 5B4VA 4U6SA 1QG6A 1SEPA 2B4RO 4DVJA 1V3TA 3K73O 4HX5A 2PA3A 3DDNA 4FW8A 3MOIA 4E5MA 5BNTA 4J43A 1DJQA 3GNTA 3EDMA 2OL4A 4DRYA 2C59A 3IJPA 4HFNA 2GRAA 4AJIA 3OECA 4I9HA 4BO8A 2HO5A 3EVTA 1M75A 4CM9A 4MOWA 4GX0A 1HL3A 2O7QA 5CEFA 4DQXA 1UXHA 1A27A 3VPXA 5C7OO 1DB3A 4O59O 4XR4A 4CR7A 2Q4EA 4MO2A 2I9PA 4MKXA 3K9QO 4NU6A 2ZATA 3EC7A 5DP1A 1U4OA 1HYEA 4CMKA 5AYVA 1EZ4A 4KWHA 1UP6A 1ARZA 1PJSA 4NIMA 4CQLB 4OXKA 4XWYA 2JHGA 4BQPA 3PHGA 4YB8A 4F45A 3GF4A 1H6AA 2J3KA 3AM5A 1XLTA 3Q2IA 3W4KA 4CMEC 3QHAA 5ENDA 4N7RA 1NHGA 1AE1A 3E48A 2IODA 2NTNA 2QX7A 1NAHA 2PH3A 2Y0EA 5KJCA 2R00A 3I9NA 1FDVA 5IDWA 1DIAA 1UXKA 1M67A 5TJHA 3GEMA 2JAPA 3H65A 4ND3A 1GV0A 3M2PA 3PXXA 7ADHA 2XAAA 3H8VA 2Z1MA 3PEFA 4JN6B 4RVGA 5TS3A 5FEUA 1JLLA 3IQDB 4NJMA 3ROQA 3WQQA 4R1NA 4R3NA 1XIVA 1ZH8A 2PZJA 4J4HA 1R4MB 4MIYA 1SB8A 1IY8A 2JKVA 3P2YA 2HMUA 2X58A 3QV1A 3NAQA 2RBEA 3GN1A 1PWZA 2GASA 3DZIA 2JCXA 4PLPA 2GCGA 4G2NA 4YJGB 4HKTA 1T26A 1YB4A 4RPLA 1PJ3A 2UDPA 3RU9A 5IDQA 2J5RA 3HADA 3RFVA 3VPSA 4YT8A 3KV3O 1ZSVA 2D8AA 4FC7A 4JIGA 2V7PA 1BG6A 3PWZA 1VSUA 3TOZA 1GTMA 1SO8A 2FZWA 1Y8QA 2ZB7A 3JQEA 2P5UA 5C7LO 3W6ZA 1ONPA 2EKLA 1ZIDA 3JQ8B 3OIDA 4CM3A 3ZN2A 2F1KA 4TVBA 1VPDA 4ZGWA 4PZEA 4BV9A 4B4WA 4RPKA 4R16A 1I5RA 5A9RA 3UVEA 4OM8A 3DXFA 3EZLA 3JQGA 3KVOA 3NDJA 3JD2A 1HT0A 4AJLA 4N5MA 3ABIA 4ZQFA 4A10A 1UZLA 1M66A 2UUOA 4XKJA 4I8XA 5TNXA 2YUTA 2J5KA 4DBVO 1JQBA 3DR3A 1I3MA 4KMSA 3WGQA 4Y6PA 1XWFA 2W2LD 3R3JA 3I23A 2GLXA 3SVTA 2FSSA 4J4TA 4UAGA 4DL9A 3TF5A 3SEFA 1U3VA 3IDSA 3TN7A 3DZJA 1ZFNA 3JCZA 1E7MA 4DWVA 4INAA 3W8EA 2O4CA 4JQCA 4FN4A 1R4NA 3LVFO 2DFVA 2G17A 3IKTA 4CM6A 3JQFA 2HK7A 3PGJA 3QP9A 1G0OA 1UAGA 3WYCA 4MP8A 1LDMA 4Z3DA 4GMFA 1HEUA 3WIEA 2ZTVA 3HQ4O 4AG3A 1PS8A 2A4KA 1DFHA 1UXIA 4J7CA 1U1IA 4MVJP 2HUNA 2PLAA 2Y99A 3QVWA 1XG5A 4IJWA 5KVQA 1GDHA 2ZTMA 1SZJG 1C3VA 3NUGA 1LI4A 1WWKA 1BTOA 1LDBA 2HMTA 5L7WA 2G1UA 4FQ8A 3TOXA 3VH2A 3EW7A 3ITKA 3RU7A 1O89A 2ZQYA 5JFOA 4S3MA 2VWGA 3JQ6A 3LK7A 4OO3A 4RQTA 5JO9A 1DC4A 5L3ZA 1BXKA 3C85A 3K92A 1YONA 3ZWXA 4RO0A 3DTYA 1HDCA 3WICA 4XJTA 3JQ8A 2W90A 4CMBA 5KCZA 2X4GA 2WSBA 3DOJA 4WNCA 3LYLA 4A2CA 5KVSA 4E3ZA 1NVMB 1EE2A 3VVBA 2O48X 3AUAA 1ZUD1 1T2DA 4J90A 1OC2A 4UVGA 3RUFA 2W2LA 5IFLA 3ORFA 3EY4A 1QLHA 2ZJ1A 4J9UE 4QXMA 2AW5A 5DT9A 1LLUA 4B7UA 4DLBA 3JQFC 3BTOA 2VHXA 2Y1EA 4D0SA 3IKVA 1A4IA 4DLAA 2EHDA 3DZHA 1NPTO 3ZWCA 3GDOA 2ZB4A 3GUCA 3PDJA 3UCXA 3GEGA 2UUPA 3GOHA 1E6UA 3F1LA 2Q4BA 4MDHA 1EDZA 1YRLA 4LCEA 1NFQA 3KTDA 1A7KA 5L4NA 2I66A 4U6QA 4NQZA 4UULA 1ZK2A 1WP4A 3FR7A 4QECA 3TNLA 3WGOA 4Y9DA 1Q0LA 3QLJA 4J1NA 1U5CA 2VWHA 2QQ5A 2X0IA 1V9LA 2O50A 4HFMA 2Y0DA 5COBA 2B5VA 3A14A 2PGLA 4ONEA 2HMVA 5LDGA 4Q3CA 3OJFA 1LC3A 2BLLA 2YW9A 3S55A 3ZU2A 2Y67A 4GLLA 1ISMA 1E1KA 4XD2A 2DTDA 2D5AA 2G76A 2JD2A 2NV6A 2VTEA 4CV0A 4CM1A 5F1PA 1X1EA 5A9SB 4TRMA 2QHXA 1CWUA 2AG5A 2Y05A 1EVIA 1BVRA 3GQVA 4MJLA 1GL3A 3W4JA 4EBFA 4PVDA 3ZNPA 4BGVA 8LDHA 3ST7A 1Z6ZA 4FFRA 3K96A 3WYBA 4WLFA 3DHNA 4F6CA 2BRUA 2P91A 3VPHA 5T5QA 4XCVA 2YDXA 1FMCA 5A3VA 3KBOA 5ILOA 3HB4X 1ZNQO 3ZWAA 1JN0A 1ONNA 3GVHA 1P45A 3GNSA 3L9XA 2WTBA 2D0IA 3ETDA 1PR3A 4D46A 4DYVA 3B70A 4PG6A 3RI3A 2P4QA 4OOEA 1MA0A 1YXMA 1N2SA 3TL2A 4EITA 4R9SA 1LU9A 5BSHA 5TIIA 3PFFA 2RIRA 2QRLA 4NBWA 3WJAA 4AICA 3OJ0A 5G0SA 5JC1A 2PR2A 3AUSA 1I2BA 1PL7A 4A73A 1HE2A 1SCUA 5KTKA 3RUHA 4BS9A 2DAPA 1Z73A 3E18A 1ZZEA 1ZJYA 3GAFA 5EIOA 4RZHA 3LC2O 1EK6A 1RWBA 3K2EA 5L9AA 1GCUA 3U5TA 4WASA 4RF5A 1X15A 4PGFA 1OMOA 4FC6A 3I9KA 3WBBA 2P68A 4MVJE 3RAJA 1UAYA 4TKMA 4PLHA 3E82A 2UVDA 2G82A 2VHZA 1YB1A 4Z9XA 4NPCA 1T1RA 4IMPA 4ZA2A 4EUEA 1AXGA 2WJPA 4RCVA 3ZHYA 4CUJA 4J0EA 4J2OA 4WEOA 3H2SA 1K6JA 2C5EA 2Q3EA 1ADFA 4GKBA 4NBTA 5JMPA 5JW6A 2PKQO 4NMHA 1N9GB 4XDYA 3UF0A 3ICPA 1HE5A 1QV6A 3RC1A 1YQXA 3GNQA 4YJDA 4CMHA 4E5KA 1YE3A 1Y7TA 1U3TA 5GZ6A 3RKRA 1J5PA 4EGFA 4R3WA 3QQPA 4OKNA 1DHRA 3IIEA 4LK3A 1SOVA 2YQ4A 3QVOA 4YBZA 3SJ7A 4R51A 1BXGB 3M1LA 1K3TA 5IZ4A 4BOYA 9LDTA 3BMNA 4U8GA 2OOSA 3OIGA 4TVOA 1A71A 1ZK3A 1J0XO 2BF7A 2BH9A 3IL2A 4QO8A 4IQ8A 2NU9A 1ULUA 4LRSB 3D3EA 1ML3A 2Q1UA 4G81A 4IGFA 5GMOA 2GN8A 5CDUA 1HDZA 4BO7A 2GGSA 5AXDA 2BHLA 4YJGA 4E31A 3HUDA 2WYWA 3FPCA 4L4XA 1KY4A 3DHYA 1K2WA 4PRKA 1B14A 4Z9YA 1R0SA 3AY3A 3TFQA 2AEFA 1BW9A 1UH5A 3GVCA 3OEWA 2I67A 1HTBA 3I9JA 3RBXA 5A5EA 4CQMD 1RM3A 2GO1A 4OHUA 3X2EA 5A4DA 4DIBA 2OUIA 1I2ZA 1J6UA 2V6FA 4UREA 1F12A 1N1EA 4KQXA 1HE3A 1YJQA 2B4TO 4CPDA 1RYEA 3CUKA 2BI8A 3JQ7B 1BWSA 1Z7EA 3H9UA 3U3XA 4BNZA 5B4TA 4CM8A 4AL4A 4DC0A 1ZMOA 3OICA 3IP3A 1Q7BA 1LDYA 5T8KC 3TZ6A 3PYXA 2HMWA 3AK4A 3Q6IA 4R5HA 4BNUA 1GU7A 1E3IA 2CZCA 3BHJA 3DZBA 2PFGA 3CEAA 1RM5A 3LF2A 4XRRA 3GT0A 2BELA 1BXZA 4OL9A 2Q2WA 4Q3BA 2FP4A 2EF1A 1JAYA 4J6FA 2Q2QA 4AVYA 3WIDA 3DAGA 2PD3A 1ISHA 2DBZA 4GPD1 5IDXA 1RKXA 1GQ2A 2FRDA 3LSYA 4U5QA 1YS4A 1GQYA 5KJEA 1JWAB 1Y8RA 3Q1LA 4NDNE 4BNHA 3W4IA 2EEZA 1ENYA 3JD1A 1U8XX 4BKPA 2NNLD 2OO5A 1UDAA 4NNJA 3S2FA 4MKZA 3N74A 1K6XA 4CQMA 3P5SA 3GFGA 3ONDA 3UW3A 3L07A 4FCCA 3WWYA 4IDAA 5AXCA 4BV8A 2VZ8A 1U4SA 4HNHA 4YCAA 2HRZA 4GLOA 4R01A 1IOLA 1CRWG 5A1TA 4AJ1A 3UCFA 1K5HA 3A1NA 3WMXA 5KNLA 5DP2A 3TZHA 4CQMB 5B37A 4AJPA 3TWOA 3EVNA 3RROA 2EJWA 3TJRA 3E03A 3KM0A 4UUOA 3HDHA 1E7YA 1RM4A 1EUZA 4YYZA 4Q3DA 2GZ3A 1N1GA 2C54A 4XYGA 1TT7A 2I3AA 4J0FA 3I9MA 2AEMA 4NG5A 4K6CA 5IJZA 3GDGA 4IINA 1W73A 4A0SA 4F6LA 3RQSA 5JXWA 4GMGA 1DPGA 1PX0A 2JFGA 1QYXA 4MVJM 3TRIA 1GQQA 1VL8A 1JAXA 4NR0A 3KYCA 4HV4A 3PQEA 1VJ0A 4YACA 1LX6A 2B5WA 4DTIA 3MJCA 2NVBA 4RJTA 3MCVA 5G2OA 1KEVA 4FB5A 4BMVA 5DCUA 2A92A 4JBHA 1PL6A 3DTTA 2PZLA 3QVTA 2J8ZA 5CDSA 3GMSA 1TEHA 2WE8A 5CEEA 3PK0A 5CDYA 2VUUA 3ZDFA 5G4LA 4W82A 5JAQA 1ZXLA 3V2GA 1PGNA 3K6JA 4GGOA 2VRCD 2AQHA 2NTVA 4YRAA 5JDCC 5IG2A 2GPTA 4O5OA 1Y5MA 3ZHXA 2GN6A 1LC0A 3PIIA 3CPSA 4BUCA 4TRNA 2YZ7A 4NFSA 5LCXA 3CH6A 4JK3A 1KIFA 5EPOA 3C8MA 1DFGA 1R6DA 3AI3A 1NBOA 3CSDA 2IXBA 3VOSA 3ZWNA 4EDFA 3IS3A 1E77A 4WK6A 5F5LA 1IYZA 4E2XA 2HLPA 3GAZA 5L45A 4CV2A 1PJCA 5JDCA 5HTOA 2VRBA 3KYBA 3ZWVA 3Q2KA 1I01A 4GX1A 5H81A 2DLDA 2AEJA 1P1IA 2OP0A 4YQZA 1PGJA 2DPGA 1RPNA 4D0RA 2WE7A 3FBTA 1TT5A 4RF3A 3QVXA 2BFAA 1A4UA 1VL0A 3OA0A 1PJ2A 4JBIA 5L4SA 5TLSA 1C1XB 2UYYA 1EVYA 2Q1TA 4HXYA 4Q9NA 1F14A 1TT5B 5MDHA 1JVBA 2J3HA 4WKGA 2CNBA 2EV9A 3GG2A 3RUAA 3VZRA 1VI2A 2ZYDA 1I3NA 3L6OO 2Q50A 2DBVO 4JBGA 1DIGA 2JFFA 3RBZA 5CEJA 1A7AA 3C1AA 3GK3A 3G79A 1PIWA 1AHHA 1HYHA 5JE8A 4RV9A 5LC1A 1EK5A 2AQKA 3L77A 1N5DA 3GMDA 4YJFA 2Q46A 3HFSA 3IC5A 3KSUA 1XCBA 4TKLA 4H16A 5FI5A 3SLKA 5F5NA 4CMCA 4L4RA 4XQ9A 2WYVA 1R0LA 3I4FA 5COQA 1HZJA 2LDXA 4CMEA 1MC5A 4XIYA 5TGDA 3I1JA 3DFUA 3E9MA 2CF5A 1EMDA 4DQUA 4LGVA 2Y66A 3HDJA 3O8QB 3PYMA 2XXBA 4I1IA 3PGXA 2IZ0A 3PIDA 4L75A 3C7AA 4DPKA 3PP8A 4IDBA 1EBUA 2WDZA 4YAJA 2DKNA 5L95A 1MXHA 1YBAA 4RORA 2A94A 4CMIA 3G17A 3JTMA 2V6GA 1CJCA 3FPLA 5JYEA 4JXKA 1DAOA 3FWNA 1PS0A 1H0KA 1ZK4A 6ADHA 3RFXA 1I30A 4WOJA 4L4SA 1Y6JA 4RLSA 4ALIA 4HP8A 3DHEA 5CHEA 4BNTA 1N7GA 1QP8A 1R16A 1JKFA 1NVTA 2ZCUA 4B3IA 2PZMA 3CTMA 1LLQA 4NK5A 3O26A 3ZU3A 1SNYA 1IB6A 4JJFA 3S1LA 5CDGA 1OFGA 5A3JA 1LSSA 3O38A 1ISFA 3CMCO 1AXEA 1PQUA 5DBGA 5MGBA 3FTPA 3U4DA 5JSFA 2BFMA 1GEEA 4O63O 4BGEA 2NU8A 3AW9A 4CLEA 1OOEA 1C14A 1R37A 4PLZA 1P33A 5TT0A 3VKUA 1PQPA 3G3EA 3I3OA 3LT4A 1TI7A 1PJQA 1D1TA 3F5QA 2J3IA 3U4CA 3PWKA 4K28A 2AA3A 4CLRA 5GZ1A 3O4RA 1QORA 2JCVA 3GGGA 1WVGA 4OSOA 4EUHA 5KWEA 5DBFA 3PDUA 1YL7A 3PLRA 2W8ZA 1E6WA 3ZU5A 1OZAA 1IPFA 4QO7A 2OBYA 3H2ZA 1NHWA 4ALLA 1DLJA 5I7SA 3AI2A 4N54A 1M6HA 1WPQA 3M1AA 1QR6A 4EZBA 5G0VA 1I33A 4CLXA 4IDCA 1YH3A 4W99A 4IIUA 4BO9A 4YA6A 2ZB8A 1XR3A 3ETGA 3ZWPA 1X0VA 2CFCA 3GFBA 4IUYA 1LDEA 4R4JA 1PZFA 2D5CA 3QVSA 4FDAA 4XB2A 3ZV4A 3NT4A 4OKIA 4R1UA 1SC6A 3WG9A 1CQJA 4PLWA 1GFSA 1YVEI 3WNVA 4CM5A 2TMDA 4YWJA 5T6BA 4C4OA 4BMSA 4UUMA 1N8KA 4BKUA 3KRTA 1XHLA 2VTDA 3GHHA 5K6AA 4GGPA 1ENOA 1KVUA 1FDTA 1LRLA 1U3WA 3K2BA 4TMFA 4UUNA 1I24A 4EJ6A 3BHMA 4IDGA 4H7PA 3VAZA 1NWCA 4WUVA 4UVIA 5JY6A 2SCUA 5JDIC 3I5MA 1PZHA 1OAAA 2A35A 1AN9A 3QSGA 4XYEA 3MJ4A 4RLHA 4Z0HO 3ENKA 5ILGA 3R1IA 3RASA 1T2EA 1MG0A 4GWGA 4DXHA 3TSCA 2ZQZA 5EN4A 2E82A 2NTJA 4IM7A 1GCOA 2RCYA 1QV7A 3F9IA 1HSOA 4AJEA 2RH4A 3NTOA 5I8WA 1EVZA 4KWIA 4HY3A 4P4LA 1PTJA 3PJEA 2NSDA 3NT2A 4OIMA 2IZZA 1ORRA 1W4ZA 3ANMA 2AG8A 2F00A 2PGDA 4J49A 4MIEA 1E3WA 1S6YA 2DBRA 3VZSA 4BO5A 4TRJA 6LDHA 5ICMA 1ISGA 4II2A 4Z9FA 5JPIA 4BKOA 3RC2A 1EUCA 4WEQA 2DU8A 4ZN6A 1ZW1A 1W8DA 2VOJA 3U9LA 2V6MA 4A7PA 1U8FO 1GYRA 1D4FA 1U7HA 1YOVA 3AU8A 1GUZA 4ALNA 1Y8QB 2PV7A 3GN2A 4R1SA 5C3MA 2DC1A 1YKFA 3D64A 1U2DA 3KYDA 1TVEA 4R69A 1CIVA 4D42A 2GF2A 4GX2A 4WCFA 3WLFA 1ZK0A 2WMDA 4AJHA 4CR6A 3E9NA 3HN2A 4C7JA 5AQ1A 1SBYA 1KERA 3CMMA 3FBGA 5L53A 2VWQA 1LEHA 1LJ8A 3SXPA 2OZPA 2YYYA 2H5LA 2EW2A 1E1LA 3FNGA 3WGYA 3D5QA 1N92A 5T64A 4MIOA 5CFZA 1ZEJA 4ROSA 4BKRA 3OJOA 5A04A 2GD1O 3SC6A 3AOGA 2C2YA 2C2XA 3OH8A 2YV1A 4OSPA 2DTEA 5KOIA 3U09A 1JW9B 4BGIA 5CDTA 1CYDA 1DC3A 3A9WA 3P7MA 3IUPA 1P0CA 4WLNA 4OXYA 4UVHA 4LISA 3R0IA 3LC7O 1R12A 2X9NA 4A5OA 4S1VA 2C7VA 2QZZA 5A03A 3RSHA 1XQ1A 4ID9A 3UXYA 3R6DA 1O5IA 2HQ1A 2Y0CA 5IF3A 3D7LA 2R00C 2X7HA 3NT5A 3ASVA 2DPHA 4U0KA 3DZGA 1J49A 3ZHBA 4IBOA 1KVRA 1P1FA 4N5NA 4PZCA 3V2HA 2FPPA 1C0PA 2JAHA 2OXIA 4BMNA 3D4PA 1F8FA 1IUKA 3S8MA 2FZEA 2PKRA 3C24A 4FGSA 5DZSA 3ZH2A 1FDUA 1YQDA 1NFRA 1C0KA 4RVHA 5U9CA 4WJZA 4H15A 3VZQA 5DULA 3UFXA 4J7XA 1C1DA 1JA9A 2PZKA 3Q9UA 3OQ1A 2W4QA 5ENVA 3OM9A 1GPJA 2Q45A 4ALJA 3ZWWA 2X23A 4KTTE 3ROPA 3D5TA 5JAMA 3NKLA 2O4UX 2FHSA 4PZDA 3MWEB 4PG7A 1Y9AA 1NPYA 1VKOA 4TRRA 4GX5A 1P1KA 1MXFA 4MVJA 2EG9A 4M54A 1T4DA 2GSDA 3DMTA 4NK4A 2NUAA 5TT1A 3IJRA 4BIIA 2YHIB 4BB6A 1Q0QA 3CZMA 2V65A 4YAKA 1DDOA 3AU9A 4HBGA 1GYPA 1O6ZA 1LQTA 3N7UA 2FMUA 4LRTB 4QSMA 3VTFA 2BMAA 1X7HA 3BTSA 4I5EA 3RBVA 2VYVD 3FR8A 5F3RA 2VYND 3VC7A 2HJRA 1X14A 4CM8B 3C3XA 4IS2A 3RUCA 4YXFA 2NVWA 7MDHA 2HCTA 1MG5A 2HSDA 1XA0A 3GZ4A 5DCYA 1Y81A 1DRVA 3D1LA 5JCXA 3WFJA 1XQ6A 4HUJA 5IZCC 1D8AA 1I36A 4RPHA 3JYOA 5JDIA 1NP3A 1B2LA 1HXHA 1GUFA 1LUAA 3GR6A 4R5MA 1MFPA 4YPOA 1VL6A 1O8CA 2YDYA 4BNLA 5F1KA 3EUWA 3L9WA 4RPGA 2PY6A 5FFFA 1QYVA 2YQ5A 5DOZA 4DREA 4YRDA 1O0SA 4YRBA 4KUGA 3L4SO 3ONFA 1UDCA 3RIHA 1AGNA 4BNIA 2JL1A 1DC6A 3H9EO 4MPDA 4A27A 4BNNA 4BO3A 1LLDA 3U0BA 3NJ8A 5KVVA 2OMEA 4URFA 1YDEA 4XYBA 4ZVVA 1ID1A 2I6TA 1D7OA 3H3FA 1HYGA 4ND4A 1NQTA 1QYCA 3HN7A 1E3SA 2NACA 3KHUA 2G0TA 3L6DA 4L76A 1PGPA 5TJ9A 4IXTA 1RJWA 4YAGA 1F17A 3D0OA 3FCOA 3OFSA 3FNEA 4PG4A 4YVFA 4FOSA 4MP3A 1U3UA 1XU7A 4WGGA 3ON5A 1DSSG 2JFHA 2CVZA 2X6TA 2X1HA 1I2CA 2VNSA 4ITUA 3JSAA 3GDFA 5JLAA 4BNFA 4DC1A 3NEPX 1WZIA 1W0CA 1BDBA 1ISIA 4DMMA 5IZCA 3OA2A 1D3AA 4AJOA 1R66A 1T1SA 1V3UA 5AXAA 4KTVE 3SBOA 4N18A 2W98A 4JNKA 3FTNA 3W8FA 4FSHA 4E5PA 2Q1SA 4RF4A 2GZ2A 3DFZA 2P4HX 3WQRA 1P31A 4O1MA 2D2IA 4J9VA 1K6IA 1DRWA 1I32A 1EVJA 1I0ZA 5I7FA 1M76A 1PWXA 4I9UA 2FOIA 1PGQA 3PWSA 1P9LA 3AY7A 3QA9A 4M87A 3PFWO 2BGLA 3HB5X 3ZGYA 4UEJA 4CMIB 5U1PA 1T2AA 1SB9A 3QIVA 3NYWA 3PHLA 3WGIA 3VH4A 3PRJA 3Q3CA 1T2FA 3VH3A 3BHIA 2Y1GA 3GC6A 3DBLA 3ICCA 1TB4A 4XGNA 1O95A 4YT4A 1BRMA 1JKIA 4E5NA 3PHIA 1P1HA 1KVTA 1N9GA 9LDBA 2CDBA 2NQ8A 5CG2A 3OQ6A 4U7WA 3VDRA 4M49A 1GY8A 3VKVA 1MUUA 3GRPA 1MC4A 1ZCJA 2PKQP 3DC2A 4RVFA 2HMSA 4RPJA 3ZWOA 5F1OA 4ND5A 1B16A 2NM0A 3ZV6A 2CMDA 1Q2XA 4P22A 3FF4A 2CUKA 4WLEA 4G65A 4BKQA 5HWSA 2VZ0A 1P77A 1VM6A 1IULA 4JJIA 3F47A 1ZO8A 4CM4A 1OBFO 3OEYA 3A4VA 1I3LA 5K6AC 4CL3A 5A5FA 2OHXA 3MJEA 4MVJH 4NBRA 1KEUA 2GUGA 4IS3A 1YWGO 4OQZA 3AM3A 5HS6A 5EMHA 1PSDA 3F46A 2EP5A 4DIOA 3OP4A 1NASA 1R4MA 4MVJF 5IN5A 1A72A 2ZCVA 2CVOA 2I5PO 2ZJ0A 4X54A 1S7CA 2WM3A 3B20A 3PHHA 5KIAA 3AJRA 2EKPA 1E7QA 1C1XA 3DOCA 3BA1A 3AUTA 1EEHA 3IUSA 1GEGA 2HK9A 2VHWA 2J6IA 4B4OA 3NX4A 1K89A 1UXGA 1DHTA 1HWYA 2VT2A 1BGVA 1DIRA 1FJHA 1VJTA 4EUFA 3EHEA 3Q9NA 5C7IO 1EQ2A 1NYTA 4XQEA 3ZHZA 2PD4A 2YFQA 3K30A 3S2EA 1B8PA 3TZCA 3VPFA 1EUDA 1YO6A 2OP1A 1YB5A 2FN7A 3G49A 4AJ2A 1VKNA 1X13A 3WSVA 3JQGB 4RVUA 4XEHA 3KZVA 1XGKA 1B3BA 5BR7A 4MINA 4CUKA 1GV1A 1DEHA 2O2SA 3LT2A 4XGKA 3GLQA 2Z1NA 3W6UA 1AHIA 4MKRA 1F8GA 1HLPA 4IJUA 2QW8A 2WWRA 3ADPA 3BAZA 2OBNA 3BMCB 4R1TA 1A9ZA 1HDYA 2PD6A 1CETA 1PJLA 1TA4A 2P9GA 2QG4A 1DXYA 1UUFA 3LDHA 4FBGA 2C7GA 5C5IA 4O0LA 2W2KA 1HRDA 4E30A 1B3RA 3WR5A 3DBRA 3WS7A 2QYTA 3ZV5A 3HWRA 1JTVA 4LMRA 3VTZA 4BO4A 3WJ7A 2H63A 3FNFA 3BTUA 2X5JO 5JAZA 4EYEA 1I8TA 1T25A 4RZIA 1T24A 3FSRA 4J1SA 4RVDA 2I3GA 1E7RA 4MVJG 4JROA 5CPFA 4CM4B 2VYNA 1UP4A 3MJSA 3UH1A 2CVQA 3LU1A 4W6ZA 1HDGO 1V35A 4FOOA 3NDRA 3QWHA 4FD3A 3DMYA 3X2FA 2IEDA 5DN9A 4HFRA 5TQVA 3HZZA 3G1UA 4R68A 2D3TA 1BMDA 2G5CA 1XELA 1Y9EA 2DBQA 2EJVA 2EP7A 2FPGA 2NLOA 3D4OA 2VUTA 3HFGA 5CPBA 4I5FA 4XDZA 4J1TA 2HU2A 3AOEA 3PQFA 5JYDA 1P1RA 1HF3A 4IDDA 4HADA 5JBIA 4BNXA 4WNIA 3JQCA 4IPTA 4NH4A 3SJUA 1V3VA 3QW2A 1WDMA 2CDCA 3T7CA 3GHYA 3KUXA 3CE6A 3E5MA 4PFJA 2BI7A 2O3TA 4OOFA 1GZ6A 4RL6A 4NFYA 3UKOA 4ILKA 4RVSA 3Q11A 3WNQA 3VPGA 4YJFB 4J2HA 4PRLA 4R54A 4RGBA 4OXNA 3GZNA 5L7YA 1XEAA 3WLEA 4Q3EA 3I52A 2POQX 1SAYA 3RKUA 1PJBA 3U4HA 2PH5A 3JD3A 3K8ZA 3MEQA 5HBRA 1C0IA 4J3FA 4RDHA 3LC1O 4B3HA 4GKVA 4IZIA 5LDHA 3O8QA 1CF2O 1SPXA 3DBVO 3JQAB 4ZRMA 1WDLA 1IZ9A 3L4BA 4DQVA 1NFFA 1SOWA 2X9VA 1YDWA 1B7GO 3JYQA 4K1LA 3TZKA 1DBVO 1H6BA 1C0LA 1WLYA 4ZQGA 4UEOA 2VOEA 4Z3KA 2V6BA 5HM8A 2C29D 4B7XA 3LLVA 4IJKA 3BZUA 3GPDG 4EW6A 4L0QA 3W1VA 4BL5A 4XGIA 2IYPA 1D1SA 3ULKA 2EWMA 2Z5LA 3P19A 3VDQA 1ZVMA 3WQSB 4YT2A 5CG1A 2Q1WA 3AFNA 4L9RA 1WDKA 3OJEA 1FF9A 2BGMA 1CDOA 3BYZA 4GH5A 3P2OA 5JO0A 1HSZA 2FWMX 4W4TA 1U9JA 3HE3A 4D7AA 4EJ0A 4AFNA 3H4VA 3SC4A 2DM6A 4HNGA 5BSEA 4RF2A 4ESOA 4M1QA 2X9GA 4P4NA 4DPLA 2GN9A 2IRWA 3BMQB 4NBVA 1GZ4A 1ZK1A 1KS9A 5DF1A 4BNJA 1K0UA 3KOUA 4J1QA 3B1KA 2EKQA 1KEWA 2O3UA 3JQ9C 4LSWA 3LT1A 1E3JA 4IMRA 5TSDA 4J16A 5B12A 4I9NA 1F06A 3GG9A 5ER9A 4Y8VA 4AJJA 4WLUA 4CL8A 4OYRA 3WXBA 3DAPA 1PEDA 2Q2VA 2YY7A 4Q39A 2ZIZA 3S2IA 1R15A 4UUPA 4IIVA 2GERA 4KP7A 1DO8A 4WLOA 3JQAD 2VRCA 3HG7A 1Q0HA 2NQTA 1DFIA 2VCYA 4E33A 1VSVA 2EXXA 1PU2A 2PK3A 1NXQA 3JQAA 4WOKA 1H6CA 4EI2A 2Y1FA 4O6VA 5EESA 3QY9A 3JQBA 3JD4A 3M2TA 4IQ0A 3QWBA 3D4NA 1GD1O 2Y1OA 4IZHA 5L51A 5KVCA 3DBRB 1G0NA 1KC1A 1BXGA 1PZGA 3C7DB 3JYNA 5KJ1A 5B1YA 1XU9A 4Y6SA 1B15A 4XZ3A 4F3YA 3IOYA 4QEDA 1GADO 1HLDA 4NHEA 2B37A 5KKCA 3H5RA 3NJ4A 2C82A 3DB2A 3GRKA 1JVSA 1M2WA 2NWQA 3FRJA 1PZEA 5H83A 3I83A 3WYEA 4CMGA 2DTXA 5A9SA 1GUYA 3UOGA 1P74A 3H7AA 2WYUA 4Y98A 1JKJA 3NTQA 1U7TA 4W7HA 4QT0A 4C7KA 5THQA 1U2GA 4KDFA 2X0NA 2CD9A 1C1DB 3TDKA 2O23A 4YR9A 2ZK7A 2FY8A 2RHRA 4BO6A 4GQAA 1H94A 3AY6A 1MV8A 4GL4A 4XJSA 4Y6RA 5DNAA 5GZ3A 3OHSX 4XR9A 1PL8A 1WW8A 5ER6A 1O9BA 1VJ1A 1UXJA 1P44A 2B83A 1GYQA 2IEBA 1KOLA 2ILTA 4L74A 4W9NA 5G0WA 1Y5RA 5T8KA 1H2HA 3I4CA 4B7CA 4FFOA 1HDOA 3D3WB 3HHPA 5L40A 4QX6A 1BW9B 3E5RA 4Q3NA 1ZSYA 1NR1A 5DOVA 4KDEA 1E5QA 4OAQA 4E4YA 4CLOA 1LQUA 5JCJA 4GVLA 5KJFA 1U28A 3ROMA 4PLFA 1DC5A 5JCJD 4MP6A 4CLHA 1UZNA 2GN4A 2E6UX 3BTVA 1WMAA 1FXSA 3UGKA 4I08A 3V1TC 4CLOB 1Z45A 5FF9A 1QYDA 1ZJZA 4Z0TA 1LTHR 1IZ0A 4LSMA 3ZNNA 2YHIA 2XOXA 2AMFA 5K0ZA 4XX0A 4FR5A 4XYMA 3ONEA 2QRJA 1EFLA 3DEYX 4CUZA 4E6PA 1AUPA 4XQGA 1MFZA 1R4NB 3WTBA 4CV3A 1GAEO 1PR9A 1T2CA 1DAPA 1XSEA 3B6ZA 3NGLA 2DQ4A 1MLDA 2HK8A 1KVSA 4EJMA 2HAEA 4A03A 4NJOA 1PJTA 4A26A 1A9YA 1ZBQA 4FFPA 2J3JA 2NVUB 1HETA 4ND1A 1TLTA 3IAHA 2WD7A 4LVCA 2D4AA 3PLNA 3JQBC 1ZXBA 3O03A 4NFHA 3EYWA 3C7CB 4B79A 3MTJA 2X86A 2P5YA 3WOHA 5T57A 4HFJA 2QRKA 2X5KO 3DO5A 5I9MA 3ZNQA 4JCOA 1DIHA 1GZ3A 2ZTLA 4HWKA 5BNIA 5DBIA 4OGWA 4CM9D 1CEQA 3UHAA 2NU7A 4QTZA 1H2BA 2CSUA 4QFCA 2VHYA 3RUEA 1W6UA 3B1FA 3TFOA 2GZ1A 1QXSA 3CKYA 3KLMX 2B35A 3HDYA 1E3WB 1ADCA 4BNMA 1L7DA 4YTEA 2VUSA 2O7SA 4ND2A 3U62A 1Q7CA 3ENNA 1P1JA 4GVXA 4D43A 1X7GA 3HDQA 4J91A 4IQGA 1Z74A 4DA9A 1P3DA 1ENPA 4BNVA 3BMOA 1OC4A 3H5NA 4FJ1A 4ZJUA 4PLYA 4B3JA 1DRUA 1DLIA 3H5AA 3D3WA 5G4KA 4UVDA 2D59A 1ADGA 3H9QA 2IYOA 4W9NC 1YOVB 4Z6KA 5ES3A 1EQUA 3I6IA 4BQRA 3QWIA 4MVJI 2IZ1A 1LRKA 3KYDB 2VYVA 4JGBA 4NU5A 3T4XA 2B4QA 3GZNB 4EEZA 3QWAA 3ZZNA 1ENZA 4CMAA 4LN1A 2XF8A 1NNUA 4ZICA 3DONA 4OMUA 4I5DA 4BO2A 2LDBA 1NX6A 3TPCA 3G0OA 1UJMA 3WDSA 3WMWA 5IN4A 4JX8A 3BMNB 3PHJA 4WECA 4D3DA 1G1AA 4PIVA 3EMKA 4KUHA 3F3SA 1KC3A 3ADOA 5B4UA 1WAMA 3RFTA 1ZMTA 2FR8A 2W2KB 3RC9A 1LSJA 3H9GA 3GA0A 1ZKMA 5I8ZA 1PJ4A 1ONOA 2BD0A 4EEXA 3WGGA 4XB1A 3F4LA 3ZNOA 4ZRNA 4J4BA 3RJ9A 2WD7B 3GVIA 5IAAA 1VE9A 2B69A 1I10A 4XYLA 3LQFA 5EL0A 3NGXA 2VQ3A 1HZZA 5DDIP 4ZD6A 3WX0A 4FFLA 1FDSA 3G1TA 3GVPA 3IMFA 1RYDA 2RHCA 4CR8A 2ZB3A 3U49A 4E5YA 4WCDA 2GNAA 3MZ0A 4BB5A 4E21A 3ZWYA 1LDNA 2E37A 5JC8A 4DUPA 1NTOA 4Z0PA 3I9OA 3KYCB 2C0CA 4PG8A 5JAIA 2JCYA 3F4BA 4E2ZA 2RAFA 2HDHA 4XIJA 4QQRA 2YV3A 4ZQEA 1E0DA 2JD1A 4UEKA 5FI3A 1PS9A 1DJNA 1QKIA 3F5SA 1WMBA 1E6EA 1IHXA 3FN4A 3KEQA 3K5PA 1YBMA 5TRTA 3IP1A 1IPEA 3STHA 1KY5A 1EDOA 3EZYA 4DIFA 3ZWBA 3JQ9A 4CLRB 3MWDB 3JYPA 4D3FA 1H6DA 4AJ4A 2AQ8A 4DMLA 4JJGA 4OQYA 4WCFB 3OF2A 3V2UA 3WTCA 1SMKA 3CZRA 1N7HA 3QJ5A 2Y1CA 3RVDA 3COSA 3JV7A 3JYLA 4JP3A 3L6EA 2X22A 4OH1A 5I9LA 1VRWA 3E9QA 1Q1NA 3PJFA 3V1UA 3FWZA 3WSWA 5IDYA 4RDIA 1H5QA 4R9RA 1EE9A 1LSOA 3V5NA 2GR9A 2NVUA 5L7TA 4J7UA 4IGEA 4TROA 5BSGA 4DLLA 1I3KA 2EERA 4YQYA 4LW8A 5I7VA 3OMLA 4BGUA 4BNWA 3H9JA 3QRWA 1QMGA 4W7IA 4CV1A 1Y1PA 2QIOA 5AVOA 4D79A 3RUDA 2AE1A 2UV8A 3ZCXA 3FD8A 4CODB 3DQPA 3MTGA 3WB9A 1EFKA 5GY7A 1U5AA 5ITVA 1E7SA 2NU6A 3UICA 3AOEC 3NV9A 3GEDA 1H93A 4XA8A 3PYLA 2GYYA 3RCBA 1ULSA 3JD0A 1GPDG 3A06A 2EGGA 2FR1A 4K9DA 2VN8A 2X8LA 1B8UA 3A28A 3WWZA 3SLGA 3ETEA 3EAGA 3KO8A 3AI1A 2JD0A 1UR5A 3L4BC 2E49A 3E1KA 5IXYA 1F0YA 2RH8A 4DBZA 2FSVA 5A05A 1ISJA 8ADHA 1B26A 2I76A 3ZW9A 4YEDA 3S2GA 4ALKA 1B0AA 1KYQA 3BMOB 4GSLA 3INGA 1XDWA 4WE3A 3GUYA 1LDGA 4BO1A 4G5HA 1ZEMA 1YL6A 1NAIA 1M6WA 3DOOA 5U4QA 3RJ5A 3UUWA 1WZEA 3DL2A 2BFOA 3QE3A 2D1YA 2O3SA 1IE3A 3DMTC 3VZPA 4L73A 1R0KA 1L7EA 3ZW8A
chains in the Genus database with same CATH superfamily
3WGTA 1XNJA 3OLCX 3HXQA 3CHYA 5DK4A 1T9CA 2FSHA 2I99A 2JARA 3DLPX 3ETCA 3GGOA 3MQFA 1B93A 3QEJA 4MEAA 3FYHA 4M9SA 5EZYA 1JE0A 1T8RA 1JQ3A 1PFVA 1FMLA 4OQPA 3T0FA 3S44A 4B0PA 5BOSB 3FSGA 1CJBA 4M8SA 1P91A 1ZXXA 2ET6A 4Z4FA 3AVVA 2P1RA 4WPGA 5ITSA 4EO4A 4ZI7F 1F6DA 3PVCA 1UK8A 3QENA 4DDKA 5D3MB 2QY9A 4C7VA 2FQQA 1XCGB 1TQ6A 4PAGA 5MHTA 1X7DA 3EBOA 1JMVA 1I1NA 1FMFA 1QQTA 3AFMA 1H2YA 4GI2A 4ZPXA 5KS2A 2WQ6A 3E0QA 3FZNA 4U2FA 4EAQA 1KMMA 3C6YA 4RSMA 1ZJJA 4FKMA 1ZRSA 2AE2A 1KBQA 1VLHA 3FH0A 3K0EA 3MD9A 4OJNA 3PV0A 4OI2A 1J99A 4MI3A 4RXMA 2XB4A 2OGUA 1HTTA 5GONB 5TPWB 1JLRA 4YMSA 1TW2A 2NADA 1OTXA 4NZZA 2XCQA 3UW1A 1UEIA 5CT4A 4JC0A 2I54A 4BVAA 4BO0A 2DULA 4HRAA 4M0CA 2CHEA 4G0YA 4FEGA 4KRXA 5AKKA 5C37A 1OFUX 1DCTA 3IPRA 1INLA 4F4UA 5H3HA 2CLIB 2QR2A 3L7JA 1NBMA 4D2IA 3N2KB 1GTVA 4PHCA 2C88A 1Y1SA 3VHRA 3A6JA 3DLIA 3BMCA 2R11A 3BE8A 3UPTA 3FNHA 2YZ2A 1KDPA 5TC4A 1W25A 2FXIA 3FHLA 3L8ZA 3EGOA 4OHRA 4CFYA 1JHQA 3M6IA 4G4SO 1J4AA 4TWRA 4US2R 1N0HA 1QOZA 3U4IA 4R2JA 5JNVA 5K0CA 2YBDA 4UQPA 5AVYA 3T5TA 1J39A 4Q9LA 2ECQA 4B5KA 4S35A 4MUEA 4X41A 3LTNC 3IBSA 3RYHB 2GHTA 4EG4A 3ZTTA 3BAFA 2LPMA 1HDRA 3E9YA 2Q0XA 3KE8A 5BN5B 4JP2A 3DMHA 1IHPA 1KKMA 1AUXA 1DS6A 1UDBA 1Y9ZA 4RYDA 2AQIA 1CR1A 4Y6LA 5FWNA 2J4DA 5AKHA 3LUGA 1MN6A 1CQIA 3O5AA 4TZTA 4U7TB 1KP2A 2O3QA 3UGQA 2BGGA 4IIFA 2IV7A 3JZDA 4OHMA 2EAUA 3HPQA 5G40A 3VR5H 3P32A 2GESA 3F4KA 3IULA 3O31A 4Q02A 3BXOA 5F77A 4FS8A 5J23A 4YROA 4W7SA 2JLYA 3V8QA 3DKVA 1V6AA 2QL7A 5EJMA 5CFMA 4FCVA 2VTBA 1T35A 1EG7A 1U0NA 2BZGA 1EUCB 3WNDA 1I94B 4G67A 1CX9B 5JFGA 2OFPA 2W6ZA 2XBLA 7AT1A 4LJYA 3PUJA 1NQ5A 2F90A 1TXGA 4TLLB 2AJDA 2G1JA 4BNGA 2J3LA 2WD8A 1NBWB 2FEXA 1DQSA 4PCVA 4JQOA 4M89A 3I53A 1GQFA 5CDFA 2BBOA 2VDVE 4E70A 1ITZA 4O1HA 3STUA 3INTA 4KPFC 5K0SA 1LF0A 4Y67A 2B6NA 5FWDA 2FWIA 2WT8A 4G89A 3OFKA 3NWPA 4HNSA 1OGIA 1RT9A 3SK0A 3PVZA 3OURA 2GDZA 4GP9A 2WC1A 1SY7A 4RENA 3REQA 2GKOA 2V74B 5TB5A 5A62A 3AMVA 2XUJA 5D3QA 1NVAA 3P4UA 5F7OA 2EGHA 2LP4Y 4MKFA 4JB3A 4EA9A 2J1LA 1W0JD 2JIMA 2PG3A 3NYIA 5DTRA 2A2ZA 2A9OA 3WFIA 5C1DA 4HXFB 4ZHSA 3K2IA 4U9UA 2XTNA 4UVEA 4FJ2A 2FG7C 3B3AA 3V1YA 1TE2A 3KSZO 3HZOA 5TX7A 3UMFA 4F21A 4NZNA 1U04A 1LTKA 3QXSA 2O8EB 5FXMA 5EINA 2B8NA 2CNDA 4R81A 3U7FB 4C7XA 1UPCA 1WXDA 5ECGC 3WWPA 3K31A 1CF4A 1EFDN 3B6MA 3NHLA 1MO3A 3PQDA 3PNYA 4PINA 2C5SA 4GXNA 1MH9A 2AIRA 1X7YB 2RGRA 4LJLA 1ADBA 4BUJA 3N5KA 1LLFA 3SAJA 3RTGA 1I7PA 3QUBA 1PGOA 1T4BA 2Z6VA 1EBFA 2WU8A 3QX9A 3ZC3A 3JALB 4GOJA 1YL5A 3UWSA 3M3DA 3E8XA 2AXQA 1K27A 2C8VA 3G2QA 4JZYA 3SFVA 4X24A 5SYMA 3U3DA 3ZWMA 5CBPA 3ESAA 1S8NA 1ZD5A 3NH9A 4HDKB 2Q7OE 3M5CA 2WJJA 2XOKA 2X7JA 3V4SA 1MABA 1FFXB 5I4IA 1J25A 1KYXA 2CXUA 2V7QA 4PG5A 5FA5A 1YCGA 5CBPB 4ZAWA 4JIMA 1D03A 2Q28A 3CCCA 4PC7A 5D01A 5FB3A 2NUAB 2XDQA 4BE9A 3TCKA 1E58A 4RHYA 5E7QA 4EI8A 4I1SA 3UJNA 5FH9A 1MABB 1VLMA 4ZQHA 2XDAA 4M2LA 2FZVA 4P8RA 1Z63A 1E1QD 2R0QC 4HH4A 3FOAA 3RTAA 2YVAA 4YT5A 3ZTWA 2B92A 1MGOA 2DFDA 1GAJA 1Z4IA 2OK8A 1Y4SA 1YCHA 2QE6A 3L7DA 4RY9A 1V1RB 4ZOAA 3WLNA 2WVGA 4P4SB 4PLVA 2QN7A 4M86A 4M88A 3FFTA 4A8JA 4M99A 3T1HB 3EIUA 3B1JA 3Q0EA 1HLGA 4UFPA 3MNFA 4Z99A 3ZU4A 2C99A 4XWWA 4MHSA 4H7IA 1K7FB 1CERA 2WFLA 3GI1A 4TZ6A 2DVMA 2WF6A 2WMYA 4NEHB 2CF6A 3EMDA 2PWZA 3QYJA 5IH3A 5KTMA 1QCCA 4M22A 1SEVA 4NZMA 2PUFA 1MNAA 1BKSB 3ES9A 5JNLA 3L7NA 5LKAA 3LP6A 2PSHA 3B52X 3VUEA 1GGNA 4B8WA 1QNFA 1YJ8A 3KB6A 3K9NA 5IJWA 5L4LA 1UODA 2E1PA 1J9ZA 3PZBA 4KR3A 3E3OA 3ZLVA 1VSBA 4MW9A 5ICEA 4K8RB 3AV0B 4Y0AA 1NQOA 3LUJA 4GSKA 4BEVA 3C14C 5HDBB 1WTAA 3WGHA 4FEEA 3EF1A 4ENWA 2QNRA 1Q16A 4IV0A 2XT0A 3EJWA 3K5WA 3OQPA 1V0JA 4S1PA 4YP0A 2H1HA 4O4JA 1Z33A 4WXRA 4EMUA 2BH2A 1HKUA 3IHWA 3L6BA 3AVUA 3JWJA 5CAEA 5DGIA 3NTRA 1TUIA 4LCJA 4ZU3A 4E32A 1LA2A 3WLAA 1N6OA 1EWRA 2EL7A 2IU6A 1IL0A 1BHQ1 2JFZA 3M6UA 5F2NA 2QRHA 4HDMA 2YWRA 5AOVA 2R62A 1E1CA 1GP2A 1VIVA 4N47A 4EHHA 8OHMA 1SC3A 1RZRA 1WETA 3II6X 3L7IA 4OUKX 3ZWDA 3QVUA 1X1TA 5G0UA 4G5XA 3K0KA 4F85A 5CLGA 4PZAA 1VPVA 3OWHA 3RQIA 1AY0A 4K9LA 1QJ4A 2WF8A 1A50B 1UBOS 2H2DA 1ZUHA 1KQGA 1JDJA 4KO3S 5G4KB 2MU1A 2BGKA 5B4VA 4ZVPA 3GEPA 1PHPA 2VJCA 2FXVA 4FHDA 4U6SA 1QG6A 1ZGZA 4MA5A 4KO1S 3P1JA 4WZAA 3U7IA 3R0XA 3K73O 4HX5A 4MUFA 3R20A 4DV7B 4E5MA 4D4KA 4JLNA 3U3OA 4F92B 1DJQA 1SJ9A 2OL4A 1YVUA 4WK0B 3IJPA 1PT5A 1C30B 2WNHA 2RHBA 3L18A 5JYBA 5LPNA 4L4UA 5AW4A 2B8TA 5B58C 2BR5A 3HJTA 4EB3A 3KC2A 3ELYA 1MOQA 4PCAA 3HN6A 4AZ3A 4TS9A 1M8KA 4GD3Q 2O7QA 4EB6B 1W0KD 4MXDA 4DQXA 1RD4A 4BYGA 5CEFA 2OC9A 1A27A 4IX9A 3VPXA 2GVDC 4LHSA 3FMPB 3PENA 3Q5DA 1PFUA 4BRZA 1DADA 1EX7A 3MQ2A 4V2UA 4JA2A 1KI6B 3X0DA 4ZTBA 4KFRA 4G5FA 4F3CA 5DBHX 5I7WA 1R3DA 2XRZA 1HYEA 5DYGA 2QAGC 1J2EA 1EZ4A 3VO9A 1AGYA 5DSZA 5EUQB 1ULAA 3I1IA 4NZPA 4YCSA 5KBYA 4CQLB 4F9GA 4OXKA 3N2IA 5GTDA 5J4LA 3HVIA 5CM9C 4JL6A 3PX3A 2JHGA 4WY8A 3SKXA 3I5AA 1C7ZA 4BLQA 1OXUA 2RDMA 3U7JA 2VDNB 1MJHA 2JJ2D 3L92A 3Q2IA 4KDCA 1ULHA 3QHAA 4KN5A 4PNHA 1JXQA 2BGRA 3AX6A 4WA7A 3E48A 2VP9A 1SELA 1A1SA 4RHCA 2IODA 1NAHA 3HCDA 3EQZA 4X44A 3SS7X 1JLLB 2WYOA 2ODBA 1RYHA 2PH3A 3CM0A 2R00A 4M0KA 1P6XA 4EHAA 1UXKA 2HJGA 1DTEA 1KH3A 3OEEA 4G5YA 2VXYA 4JCCA 5AJYA 5ALWA 4RL4A 1CY8A 1GV0A 3UXEA 3FAZA 1SR8A 4D3XA 3H8VA 3ZBPA 4JN6B 3WRWA 5FEUA 4NBNA 3BGOS 1YA4A 2BHRA 3CZAA 3IQDB 3KNZA 4C0LA 2YQZA 5TR9A 5HGJA 2XVZA 2X13A 4EFMA 3IAM6 2RGYA 2IYUA 3AY0A 3FLEA 3SIRA 2YZGA 1KJWA 1YU6A 3BGIA 2GTIA 4JLBA 4MIYA 1SB8A 2PMCA 3I76A 3IV6A 4I1RA 3NCTA 3P2YA 1PT7A 5H8WA 3L5KA 1CYEA 3VSEA 2XECA 2IYVA 3AERA 3KZCA 1AMOA 3WNZA 5AHXA 2REXB 2GASA 5FL7A 1VGQA 2BRUC 3CLTC 4KKVA 4YJGB 3ESDA 2WUGA 1GNTA 1T26A 4HKTA 1YB4A 4D8XA 3RU9A 2O14A 1OBVA 4M0MA 2D1FA 3KV3O 1TF7A 4UC0A 4BUZA 1XVVA 4CQJA 3U44A 2JIBA 2O8BB 2V7PA 3PWZA 1BD3A 1VSUA 2AK3A 3TOZA 3NBMA 3ZIDA 2OCGA 4MS4B 5C7LO 1NDUA 1XBTA 4X1IB 5AH0A 4HVTA 5BV2P 1TIKA 2IY7A 1ZIDA 3IPXA 3JQ8B 3LUCA 3KD2A 3W5VA 3ZN2A 4ZGWA 4G2TA 3FFWA 4LDNA 2OZVA 1GNRA 2ZI6A 1G98A 2A7XA 4RPKA 4URWR 4JASB 4PHFA 3ZWKA 1HTWA 1JG2A 2HHAA 1J23A 2IGBA 3IUYA 3CNOA 2C1XA 3JD2A 3QMPA 4MAFA 1GUBA 5ESDA 2VVTA 4BJ5A 4XVCA 4ZDKA 3G5MA 3AO0B 3GH1A 4AJLA 2SKDA 3ABIA 1POXA 3AHHA 2G1PA 3GPBA 2UUOA 1JB9A 4UOZA 1FS4A 3RF6A 5KHOC 3TZBA 2EQ5A 2I87A 2J5KA 5CVTA 1I3MA 1GSOA 2RGWA 4NOJA 4M0FA 3WGQA 3A25A 1CUXA 3PI6A 4Y6PA 5T6MA 4PIMA 4R8KA 1XWFA 4DWJA 4JI1B 3I23A 3SVTA 2CT8A 3BRSA 3ZJYA 2IU0A 2CUZA 2ZRQA 1S96A 3DQZA 2CYCA 3FYDA 2INGX 2FLKA 4HAIA 1E7MA 3IE0A 4H0FA 1VMIA 4IUBS 4G8JA 4QU5A 3VU1A 4BVLA 1B23P 4FN4A 3QFCA 4TQAA 4J0HA 1THGA 4KWEA 1JJBA 4OK5A 2ZREA 4DLKA 2G17A 3NGMA 2HTEA 5LJIA 5C53B 1CQPA 2PFSA 3PGJA 3U81A 3R8FA 2XUDA 1N0VC 3CBGA 4EHKA 4MP8A 1PSZA 2XTAA 3WNCA 5CJ2A 1P4SA 3WKDA 1HEUA 2ZTVA 3LV8A 2PKCA 1BFKA 1ZUNA 2GPAA 2A4KA 1DFHA 4WBNF 4O25A 4HUQA 5IUNC 4QVGA 3P97A 1XG5A 4H4CA 1M5TA 2ZTMA 1C3VA 4EUNA 5EAIA 2OPHA 4WOPA 2AZTA 2IXGA 5L7WA 2PLNA 2QJTA 3O3OB 3TOXA 4UU0A 4C9BA 2ZQYA 3EC2A 5FADA 4OLBA 4S3MA 4C2UA 4RQTA 2O1SA 1X39A 2DUNA 2J9RA 1PNVA 4LYHA 3WAGA 4Y2XA 4B3FX 3C85A 2BZ0A 3P9RA 5DEOA 1YONA 2GWRA 1V5IA 1TF2A 4XJTA 3SCZA 4Y1EA 5C5CA 1ZVKA 4RTMA 2W90A 3RVOA 2I71A 4GXTA 5FTMA 4CMBA 3PPVA 1N2EA 1NVMB 2OQ2A 4JI6B 2NU9B 1BJTA 4EB8A 5BN4A 1OC2A 3RNOA 2AYZA 3QW4B 4UVGA 1JYFA 2W2LA 3ORFA 3MT7A 6AT1A 1WVIA 1FX0B 1QLHA 2VA9A 2H4HA 2ZJ1A 4J9UE 4QXMA 3TZLA 4JYZA 2CXQA 4PCLA 2R6R1 1LLUA 4NBKA 3BTOA 2VHXA 1U0JA 1KU0A 3MCAA 5KAPA 2YVQA 4DLAA 4KBFA 2D7CA 3DVAA 1A7UA 2G9VA 3NORA 3RTDA 1GVHA 3LI2A 3ZWCA 2NZ8A 2FPKA 5AO9A 4OI0A 2O8FA 4EDHA 1RHKA 2UUPA 3GOHA 1E6UA 1WHTB 5DHQA 5B3JA 7GPBA 1U3DA 4H18A 4MHOA 2PZAA 2ZZNA 1A7KA 1FNCA 4EGQA 5IAOA 1KY3A 1WP4A 1Y7PA 1AC5A 1UKEA 4HB2A 4JXJA 3TNLA 1BHO1 1C9DB 2FGJA 3WGOA 4LJ9A 4IIJA 4J1NA 1U5CA 2AD1A 4JI4B 3T35A 2H4FA 1L7XA 2DB3A 1G6Q1 2X0IA 4L95C 1EWVA 4RKQA 1GGJA 1GPYA 1KDYA 4HFMA 1QFMA 5DM70 2MYUA 1DXHA 4XOIA 2XNCA 1OBOA 3A14A 4JSTA 1Q3TA 1CUYA 2H52A 1IM8A 2HMVA 4C6TA 2BIFA 4E5VA 3UB4A 4Q3CA 3HO8A 2CFSA 3OJFA 2VATA 4JOBA 3BXFA 4DR1B 5ES4B 2PE5A 1XFAA 3B7GA 5AOCA 1SUIA 2OBLA 3SJZA 3VR6A 1D04A 2O07A 3HYSA 1F7UA 1YULA 2YNMA 4EARA 3HYCA 2G76A 4QGSA 3VR2A 3FZEA 3OT4A 4OL0A 3PXAA 4CM1A 4CI0B 1FSZA 1XV5A 2RC5A 2VYCA 1VSQA 4CRWB 1E66A 1CWUA 3C8ZA 4Q16A 4MJLA 1BVRA 1JAHA 4QYTA 1GL3A 3NHBA 1SCIA 4L6CA 2NV2B 4NATA 5AT1A 3ZNPA 4BGVA 4WIAA 4ZDJA 4R0NA 3FIUA 4X9XA 3RRNA 4ZZIA 3WYBA 3D7MA 1F9AA 3ZGNA 3DHNA 2ZUFA 2XKAA 2LE0A 4JOQA 1N36B 2F8TA 2J0VA 1NXSA 3K8OE 3KDAA 4ABTA 3AKDA 5JWHA 1FMCA 1JUDA 4YN3A 3DO6A 1ZNQO 1ONNA 2NO4A 2ZBVA 3GVHA 2W22A 3WWEA 2OFXA 2QRUA 2BFFA 4RACA 2WTBA 1Y98A 4UNNA 1IN1A 1XAGA 3L2OB 1YR9A 3SXJA 4B80A 5JMTA 4LXHA 3RI3A 2JRLA 4L0DA 5K99A 4TM8A 3SIWA 2QG9A 3A1SA 4HRYA 1OJ7A 4C7MA 3ZZ0A 1SXPA 3OPXA 5TIIA 4O2AF 1GO2A 4JS0A 2WWIA 4NBWA 5HK9A 4F97A 4UTVA 4RANA 2X4IA 2XBUA 1QKJA 3QNUA 3P2EA 3WK8A 3AUSA 2CCJA 4N3BA 3RS8A 1WF3A 5KTKA 3K0AA 4BS9A 2XYVA 3E18A 4BEBA 1ZZEA 1Z06A 1PNRA 1ZJYA 3ESXA 4M1ZA 2SBTA 1QGUB 5J5VA 1KOJA 4HGRA 2PMDA 4UU1A 3U5TA 1KSHA 2WM2A 4WASA 4DLZA 4PGFA 5FL3A 5ICCA 3PRYA 5JD6A 3T3DA 2ORVA 4PHHA 3DF7A 7MHTA 3WBBA 4MVJE 1PK9A 3RAJA 4BIMA 1PTJC 3NKVA 2VFAA 2A0UA 2JDID 3OOYA 4ND7A 3I39X 4ZJYA 1OVGA 3EH1A 3K9LA 3KSRA 1XZKA 1YB1A 2VHZA 2YMMA 3CT6A 3R77A 4NPCA 1T1RA 4ABYA 1Z8NA 2AHOA 2Z98A 1WCWA 4Y2PA 5K20A 3KJNA 3ZHYA 4JGGA 1GM5A 3QK7A 3H2SA 3KUCA 3F73A 2Q3EA 3BB4A 1ACMA 4GKBA 2ZEJA 1ZN8A 2QRVA 2P30A 5JMPA 2R65A 5KYYA 3ICPA 5FAKA 4ZAGA 2Q4RA 3DWEX 3UMMA 1YE3A 5GZ6A 4V0QA 1OT3A 1LK7A 1NBME 1J5PA 2DR3A 5T7BA 2ZAYA 1CUGA 2BVNA 1RQRA 2GZRA 5I7OA 2I2AA 4YBZA 2Q0SA 3QVOA 1CSEE 3RKSA 5AW0A 2HMYB 1Y7LA 2R8EA 4MJXA 2I7TA 2W83A 5E3IA 1ZR2A 5IZ4A 2KSQA 2O54A 3WL7A 9LDTA 2O5EA 3BMNA 1P8AA 5AVKA 3VR6H 3WWDA 3OIGA 3GJ8A 4HZUB 1NVFA 4HWTA 4C2TA 3FNIA 2X2PA 3HKEB 3MQ4A 3ROEA 1DTWA 2BBSA 1Q6YA 1P7ZA 4RY8A 1C1YA 1BX3A 2B98A 4QO8A 2NU9A 2OCXA 5H02A 4Q1AA 3K70B 3M49A 3C4QA 3E4DA 4D25A 3QI7A 4G81A 4DA6A 2GN8A 4Z53A 3QBJA 1C9YA 1HDZA 1Y63A 2GGSA 3C6BA 1JKXA 2E4VA 2FU5C 2ZYRA 4DIUA 2BHLA 4XARA 1ZOOA 1KY4A 1E9SA 3LQ1A 3C3AA 1S2DA 3AR5A 1PEAA 4Q4AB 3RVMA 5JH7A 1R0ZA 3AY3A 3ODGA 4FHEA 4Y18A 2AEFA 1BW9A 2W37A 3NG1A 4TLDA 5DU2A 1CUVA 3GVCA 2ZDHA 3TDMA 4K0RA 2I67A 3X1MA 1WHTA 4WZBE 4CQMD 1EVQA 2KPOA 1Z0ZA 4MI1A 5JYCA 1GN9A 3SSAA 2GK3A 7ABPA 1Y4UA 4OHUA 3X2EA 5BW5A 1CUZA 2QRQA 2FVXA 3D7NA 5G1OA 3IJEB 4KQXA 2O59A 3C3YA 4WBNB 5J1TB 4CPDA 4NCNA 2BI8A 2OYSA 1KFBB 4PANA 4BNZA 3VMMA 3HKBB 1TMGE 2HIHA 3VHLB 4AL4A 1KP3A 1ZMOA 2Z04A 2H8KA 2WHRA 3IMCA 4FGZA 1TEXA 2C57A 5IAGA 2PA0A 2WJAA 4C76A 5KX5B 4LXYA 1U2EA 2PJZA 3IH5A 4PY2A 3PYXA 4MUYA 1G5FA 3IDQA 2ZRFA 1F3OA 3IXQA 3OZCA 4MAAA 1YR2A 3BHJA 3MIZA 3MMZA 3QX7A 4V0SA 1E1DA 2PFGA 3L7CA 3RJZA 3PDIA 2I8LA 2IW1A 3BZBA 4RH1A 4BQNA 4ETNA 2HCRA 3D59A 5DFAA 5JALA 4C7OA 3R8CA 3E05A 4R8RA 1BXZA 2E18A 2AI1A 3KS9A 1U7XA 3QXXA 4GOMD 4HOYA 2Q2WA 4ZO8A 2W42A 3D6VA 2XWPA 3ODPA 4WI1A 4Q7QA 4WAUA 1VYUA 4NCBA 1PJ8A 2R4UA 1NOKA 3T0IA 1YS7A 4EA7A 3K0FB 2EFCB 9GPBA 1RKXA 1BMTA 1T8TA 1T0BA 2DHQA 1GQYA 1NULA 1YRAA 3ZCQA 3OIYA 1WCYA 2PX2A 3EH2A 2A58A 5ELMA 3GU3A 1X8XA 4S1OA 4JHXA 2RK3A 1JR3D 2ECOA 4JITA 4AS3A 3HKDB 1Q7RA 2PRJA 2ZUBA 3B2NA 2EEZA 3M5WA 4W8OA 2XY4A 3W4IA 1LI5A 3MMSA 1RP7A 3O92A 3MUNA 3STTA 4NBSA 3EPRA 4D81A 3R3WA 3N74A 1A98A 3GJ3A 1JPVA 3ONDA 2ERYA 2Q6LA 4WNAB 2B30A 2UXDB 1T3LA 2V8BA 2APJA 3QU2A 4YCAA 3H86A 4GLOA 4R01A 1W5FA 4NENB 3WMXA 3IYLW 3TZHA 4O2RA 1V45E 3N6RA 4V0LA 5GAJA 1JEDA 3U3MA 1YBHA 3AEKA 3I2YX 5BQXA 3KM0A 2AFIE 2G6BA 1SKAA 2PWYA 3QPDA 3E61A 4Q15A 1N1GA 2GLUA 2X1LA 1PAUA 1TT7A 2I3AA 2V7XA 4INOA 5HX7A 3QU4A 3H8SA 2AEMA 1BU5A 1CIPA 1MVLA 2ADFA 3F3MA 3PC4A 2IXEA 3HJUA 3K1TA 3ZK9A 3LHFA 3NCHA 1QANA 4I4IA 1XXHB 5A7HA 5IJZA 3SHVA 3D6FA 4G3XA 5MFZA 1SKBA 2CB9A 5BRJA 1EYZA 4L7VA 1WD5A 4JLPA 4F6LA 4DLUA 3EIFA 1WZ2A 1DPGA 4MVJM 3SR0A 4WMLA 2ILVA 5EZ6B 1NF2A 1S4MA 3TLKA 1ZP6A 3KYCA 3V6MA 4I3GA 4QRDA 3L1JA 1KHTA 1IY9A 3PQ4A 4M0LA 4PZ0A 4YACA 5CLJA 5IULC 5K3EA 4ARIA 5LQKA 4RJTA 1XPOA 4N82A 1KEVA 2H4WA 4GHWA 1DCMA 3CNQS 4X7PA 3K1ZA 3GCWA 3HMQA 3IT0A 5DCUA 4ZVUA 4BMVA 2EBHX 4C0JA 5JNUA 2OCIA 4YAFA 5E6RB 5CDSA 5AVQA 5IHPA 3RO7A 4DA4A 1BNCA 1C30A 2WE8A 1CP3A 1NUTA 4Q12A 4XSGA 1KJIA 1U65A 3TYXA 2ZROA 2QD4A 5G4LA 3HLKA 3QU9A 4K9RA 5JAQA 2WTUA 3AFIA 3G5UA 4D98A 1TM1E 5TQ0A 3HCEA 5KNDH 3V2GA 4GOOD 2CJPA 4TS1A 3OU6A 2R1VB 3D2BA 3DUWA 4KQ6A 4O2LA 4WINA 4NPHA 4DAOA 2NTVA 5CA1F 3OJCA 5EA2A 4OI4A 2GPTA 1MTOA 1QE3A 1HEYA 1Y5MA 2XUAA 3HR8A 3PIIA 4FW9A 3CPSA 3DKKA 3L8HA 2D74A 2XUKA 2J6CA 4HDCA 2YZ7A 2HDNB 4NFSA 1UADA 5AUQA 5IEBA 5K3FA 3AF2A 4EH1A 3EPHA 3F6PA 1LBSA 5EPOA 4WK4B 2Z3WA 1M7HA 1YQTA 4AJ9A 1A2BA 4D0GA 4P0QB 4LZNA 3G7SA 3ZWNA 4NENA 3VOSA 5DYIA 3N2YA 1CUIA 1E77A 2XZOA 3LCRA 4HS9A 4CV2A 5HTOA 1GDTA 1KPIA 3KYBA 3ZWVA 1L4KA 2QW1A 3D4LA 1GUDA 4AZWA 3PTAA 1O96A 3AEUA 1A3CA 4M0DA 3BPSA 3EUFA 3B6KA 4DBLE 4X6XA 2AEJA 2OP0A 3EDYA 1PGJA 2IHVA 5JLJA 2AZMA 1RPNA 4BN5A 2H31A 3FBTA 4KXXA 5K51A 5HIAA 1XKTA 1ZONA 4R1LA 1UPBA 1A4UA 2CXXA 2WP0A 1PJ2A 521PA 1Y3CE 4O4HF 4M4SA 3W04A 1EVYA 2VIIA 4RDCA 1VRCA 2WWGA 3TE7A 2NUTA 2HY7A 2MMGA 3WWCA 4Q9NA 1F14A 1DAEA 2HA2A 4LA4A 2ZXUA 1W85A 5KYVA 1DAGA 1N0IA 1NE2A 5HKKA 2J7PA 1U28C 3DT6A 2EV9A 1GNPA 3V1LA 3MBKA 3U0VA 4H1TA 2B6HA 2OM2A 3OZDA 1AOXA 4JLSA 1VI2A 4HEQA 3L6OO 4NV3A 1U8TA 2XKBA 3BL5A 5CK4A 2J9FA 3ZCPA 4DLTA 1F2UB 4AUNA 2H1LA 1CE8A 4MDYA 4UUQA 4JV5B 4U3JA 5DRTA 1MX5A 3G79A 5ALUA 4GZ5A 3TNYA 3T54A 2C31A 3HI6A 4LJSA 3I01A 1MEOA 1PDWA 1S2GA 4TLEA 5LBTA 4DRXA 1ESMA 2HCJB 1KQPA 2ZANA 4DG9A 4GF5A 1EK5A 1FW8A 2DPXA 1QO9A 4B74A 4MTLA 3HFSA 3V97A 2FPMA 1Z3IX 4O8CA 5TQ0B 5EKUA 1GA1A 2ZUEA 1RADA 4N8DA 5LVAA 1AK1A 3AETA 5FI5A 1MT3A 3LBYA 3SLKA 3BQMB 3G8YA 4KZKA 4PWZA 5E1BA 1N9KA 5CW1A 4XQ9A 2Q21A 5CMLA 1TZJA 3TD2A 4LXTA 3SS9X 3ZV7A 3I1JA 5EJFA 1F5SA 1H2XA 2J0UB 4LXGA 1CUAA 4V39A 2ECKA 3AETB 1GZ5A 1ZD1A 1X74A 2D3WA 2Y66A 1PUXA 3ABSB 3HDJA 2AOXA 3O8QB 3PYMA 1Z29A 3T9CA 421PA 3PDHA 3O95A 1I4OA 4D4JA 1F0KA 2WDZA 4YAJA 4HQFA 2N47A 3QUCA 5TMBA 4B45A 4YRNA 4Y1GA 4Y9RA 3NDBB 2GPNA 3EXAA 2GPSA 2ZWMA 3EARA 3I92A 3IR5A 3ZIUA 1DG1G 2SKCA 3JTMA 2C9YA 2CCGA 5G1PA 2F2TA 4OBEA 3VVLA 4JXKA 3E3MA 1DAOA 2Y0PA 4G5QA 1SUEA 6ADHA 1ZK4A 4DKXA 1VIDA 5AKXA 1EPUA 1ST2A 5BWNA 5HQ3B 1RAFA 1K7EB 4AX4A 1I14A 4URVR 3JPYA 4QXAA 1DJLA 1QM5A 4TTJA 1K8XB 3LX8A 2Q3BA 3AHIA 2QUHA 4BNTA 4C2BA 1R16A 5KYNA 1KWGA 1NQWA 2E55A 4OQNA 2IUUA 1RXYA 2CN1A 3CTMA 2YY6A 1LLQA 4JSYA 3O26A 1T4GA 1IN7A 2FTKE 4XPIA 5DK6A 5C46F 2CNWD 3EY9A 1I2AA 1K3UB 1YI1A 3ESRA 4RZUA 3KQHA 5A3JA 1LSSA 2HLDD 3O38A 1ISFA 4WSOA 3R8XA 3RWMB 4CQNA 1H3NA 2ZRAA 5DBGA 2M32A 5MN5A 4O63O 1OOEA 3HPRA 1QH8A 4HXEB 2IOFA 4JELA 1HBJA 3OTQA 3CE9A 4X45A 1P33A 2F48A 2X8JA 3JX9A 3VKUA 2BKUA 5D84A 4AF8A 3K9GA 3LT4A 4LOLA 4CN9A 2QL6A 1KKLA 1K06A 3R5FA 3HO1A 4EMTA 1DZ3A 4R2MA 1P9OA 4G36A 3C8UA 3TZEA 4WKNA 2MSKA 1BWRA 5K3CA 5EMKA 2J67A 3P9SA 1HQKA 2Q6TA 3X1WA 2ZWPA 3IAAA 3QHQA 3SSNA 2BFEB 1W2WB 4HRXA 3AJEA 3ZW8A 4Z1MA 5DBFA 5KWEA 4HAYA 3PDUA 2DP4E 3MYYA 3Q41A 4HG2A 1E1YA 4Q4JB 4Z1MD 1TADA 2RFLA 3I09A 1F2TA 4G8DA 4HH3C 4WKBA 3RSGA 1T1EA 1L5RA 1MAVA 3UAOA 1U1DA 5JI3E 5FLXA 2OBYA 2JJQA 4OLJA 1O2DA 1VA5A 4IH1A 5JXIA 5GIOE 3H05A 3RU2A 4FZ5A 1XEFA 5AQEA 1WMSA 1OBHA 2BBTA 5J47A 1JU4A 3DEIA 1BWQA 3AXSA 4IDCA 4QGHA 5G0VA 4W99A 3A6KA 3QKSA 1DBWA 4IQFA 4YA6A 1QHHA 2XUZA 3H4MA 3IGFA 2PGOA 3QPWA 721PA 2WFMA 5BOSA 3ZWPA 4Q24A 1M34A 5BMVF 4IUYA 4R4JA 5GV7A 1DQRA 3DT9A 1BDJA 4FD2A 2D0PB 5TMPA 5AM1A 3UENA 1QTRA 3IUQA 5GPBA 1HT3A 1KY2A 1FZQA 3NR2A 3OO1A 2ZRMA 1XB2A 1VI5A 2YMPA 3E7WA 1KZGB 1GFSA 1YVEI 3WNVA 5JS7A 2TMDA 1BDHA 4BMSA 1T0HB 4BKUA 3PL1A 1W93A 1Z4PX 1VHDA 2P9HA 3A3NA 1XHLA 4ZU6X 1K68A 4AURA 5LD2C 5K6AA 3VNVA 1ENOA 2J4FA 4QE3A 2QD1A 2I6QA 4B47A 4EJ6A 3EAFA 2X6RA 5EUBA 1R4ZA 4WUVA 3KEGA 4ZALA 4I3HA 1P4GA 2FZLA 5E8RA 4NAHA 2VNHA 4L2IB 4CF4A 2QVCA 2EIXA 4DF3A 3HSSA 1ZYUA 5AM4A 1AN9A 3CX8A 3QSGA 3JATA 4CGZA 4XYEA 1BC5A 1YJ5A 1U9CA 3IUNA 3MJ4A 4HX2A 4Z0HO 4G0XA 4LKRA 5ILGA 2NPIA 1RJGA 1FY2A 1MG0A 2QDKA 1G2OA 2XWQA 2ZQZA 2NTJA 2YMLA 3LPDA 2A3NA 1TLLA 3TL6A 4EVSA 4X6UA 1Z4OA 2C98A 3Q10A 5FEMA 1J0CA 4S2EA 3RSZA 5EJ6A 4IXDA 1MRSA 1P0IA 2NSDA 1EXMA 1U7PA 1UM9A 3NT2A 2NPFA 2VF8A 3KQTA 2IZZA 4KE7A 1T6XA 1ORRA 3ANMA 2OCLA 3HR7A 2DBRA 1N2IA 4KMOA 3VZSA 3KT3A 3TNDA 4BO5A 4TYWA 1TX4B 2ZSUA 3VR6D 3EG9A 1M6EX 1U3FA 1VKZA 1NF9A 3BJRA 5LDDC 3JQQA 3P71T 3TIGA 1ISGA 3T5CA 1VI6A 1DKMA 4Z9FA 4YYEA 2N1MA 3PQ5A 1TEVA 1KAMA 1UKCA 5CB4B 1JX6A 1Y0BA 2LR0A 4C2AA 4YRLA 3PQ8A 3TSOA 4KSBA 1P7CA 5E2BA 1JF8A 2WABA 4DT1A 3W7AA 2V6MA 2NSHA 4QJBA 2JBWA 1IK6A 3GGJA 3EXG1 3VPCA 1YOVA 1GUZA 5ALKA 4MWDA 1EWTA 1IQ0A 4R1SA 5FTWA 1LNSA 3WHKA 2C3OA 1QRDA 3KYDA 2RGEA 4OM7A 4CG1A 4AJHA 2BEVB 3KU1A 4C7JA 3HN2A 3KKEA 5EJGA 1VB3A 4HK4A 1XN4A 3CMMA 1CY7A 1OTHA 1LEHA 1KDOA 2OZPA 2ZR9A 4GYYA 1ZGCA 3GEEA 2CYBA 3FNGA 4CNQA 1TVMA 2Y1KA 1K4MA 2PT6A 1N92A 2WZBA 3D02A 3MS2A 4QIHA 1ZEJA 3DTNA 1I80A 3OCCA 3EIEA 3SR4A 2EWWA 4NC9A 5ICGA 1ESNA 1VBKA 2Q9UA 3OJOA 3SBXA 2YOGA 1RJFA 4KG7A 1AKRA 2GD1O 3SC6A 1QCZA 5ALVA 5TVGA 1HMPA 2IPOA 2PGNA 4BGIA 1NUPA 2FUG1 3O0TA 3P7MA 2FKAA 2X2OA 4WLNA 4P3YA 3TUJC 3E2IA 3IOBA 3PUHA 3R0IA 4HX9A 2Q9AA 2BFBA 1IBKB 1VBFA 2X9NA 3S2ZA 2QR5A 2C7VA 4S1VA 4Q34A 3KEMA 2FKNA 4W5WA 3ZI0A 3HV2A 3TNJA 5A03A 2O8NA 1P5FA 1ZRNA 3W5SA 3FPBA 1ZIPA 1IONA 3CUUA 2C9BA 5CLQA 5IF3A 5AIBA 4AY5A 2R00C 2WINI 2X7HA 3TECE 3MYRA 3BKXA 3OTHA 2PX8A 2AC7A 4TV8A 4X1YB 1KOFA 1KVRA 2KBEA 3HYNA 4YMHA 3OX3A 1GFZA 2VP6A 4TM7A 2I8CA 3SEZA 4D8WA 1ML4A 1XLUA 1OREA 2Z30A 1YFKA 4HNVA 1C0PA 2JAHA 3DQQA 2ZRLA 4GP7A 1VHLA 5E1MA 5J4YA 3D4PA 2IJGX 1UINA 3GBSA 1URPA 4IV5A 5HEKA 4ZMBA 3LUBA 4AMUA 4DILA 3COWA 2NSLA 4LQCA 2HOQA 5DZSA 1YQDA 1CPYA 1PFGA 1CULC 3TJMA 4OJMX 4UBOA 5FBWB 4MLZA 2VSXA 4H3HB 1GKLA 2PANA 5U9CA 4H15A 5CVEA 3VZQA 4BVGA 1RAAA 1ZMXA 3M70A 2M9MA 5EHXA 4ECEA 1GTRA 2W4QA 4EG7A 2FZ4A 4C1NA 3T3EA 2XCIA 1QIJA 3MLEA 4RAQA 1M2NA 3ZWWA 3C74A 4BDTA 3D5TA 4YH1A 2HM7A 4EJSC 2O0LA 1SZDA 1P1KA 5DIFA 4Y6GB 3D54D 1JKMA 4MVJA 4DABA 4DJEC 4KVZA 4F72A 4TXJA 4B2PA 4LZPA 3KEFA 1JDSA 5D85A 2YHIB 3UK1A 4HNTA 1Q0QA 3CZMA 1ELOA 3PUYA 4YAKA 2J48A 3COJA 1YJXA 3CB4A 1VKRA 1CK4A 1GYPA 1G19A 1G64A 1O97C 2JIZD 3OCJA 3OAAD 3P8ZA 5SY9A 3WDMA 5B55A 5C2JB 5FOQA 4RTLA 4ED9A 4MB2A 3QV2A 4MQFB 3WGJA 3LH5A 1UEXC 1Y48E 3FR8A 3RPEA 3CONA 5I7UA 2WJHA 3VC7A 3HCRA 2HJRA 3T52A 4UCFA 3C3XA 7MDHA 2KX7A 3MIIA 4D0LB 4KV7A 4I1PA 2HSDA 5DCYA 3LA8A 1Y81A 5JCXA 1C8LA 3PCTA 4E1AA 1KYVA 3V48A 3ESQA 1HGXA 2X3YA 1QZTA 4M36A 4C4YA 2OV4A 3HJHA 1ID8A 3B9RA 2J7KA 3LVRE 2JJ1A 4RPHA 1B2LA 3EXEB 4MAMA 3SHWA 3GR6A 1VL6A 1O8CA 1KKUA 2AF4C 1DG9A 2HRCA 2YDYA 3DLTA 3EUWA 5FFFA 4BNLA 4BFUA 4DHWA 2WJWA 3H7IA 4HLUC 4DREA 3FDXA 3GT4A 4K88A 5D3KA 2UUAB 4YRBA 4KUGA 3L4SO 3S7ZA 1SBHA 2A6PA 2WZDA 4MPDA 4BNNA 1YR3A 5LZ2A 1IRIA 5KVVA 2BDEA 4FFDA 5ERGB 1MORA 5FBQB 1NKSA 3ME5A 2BFNA 2OEPA 3JR7A 5KNCA 3H3FA 2H8GA 2Y4NA 1FFSA 4ND4A 4XUEA 1E3SA 5AJTA 4L76A 3QOFA 1QF7A 2HW8A 5K0LA 2PGAA 1WB6A 5JUWA 3LQQA 2O9JA 4KI7A 2XMBA 3KTOA 2HC9A 2UZIR 2HRRA 3NXSA 4MP3A 5DH9A 2C96A 1Y6GA 5HYVA 2YKGA 3OUZA 1M8JA 3JVIA 3ON5A 5E38A 1KMCA 1KARA 4LOIA 4XWAA 4M9ZA 4ITUA 3CCBA 2WQZA 1L0BA 3QMVA 4JB8A 2BTQA 3B2EA 1U9IC 5T4BA 3UJAA 5GVSA 1N34B 2L0XA 1P8JA 1VHTA 2AFVA 3K0BA 4JENA 3ETJA 3UUGA 5IZCA 4IIJF 3OA2A 3IALA 3NEAA 4JKIA 5AK6A 4EKEA 2BSXA 1P2VA 1RYNA 1ZWLA 3KB1A 1R66A 1T1SA 2PNJA 1WHSB 3LVQE 3THWB 4M3NA