1B2RA

Ferredoxin-nadp+ reductase (mutation: e 301 a)
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
295
structure length
295
Chain Sequence
DVPVNLYRPNAPFIGKVISNEPLVKEGGIGIVQHIKFDLTGGNLKYIEGQSIGIIPPGVDKNGKPEKLRLYSIASTRHGDDVDDKTISLCVRQLEYKHPESGETVYGVCSTYLTHIEPGSEVKITGPVGKEMLLPDDPEANVIMLATGTGIAPMRTYLWRMFKDAERAANPEYQFKGFSWLVFGVPTTPNILYKEELEEIQQKYPDNFRLTYAISREQKNPQGGRMYIQDRVAEHADQLWQLIKNQKTHTYICGLRGMEEGIDAALSAAAAKEGVTWSDYQKDLKKAGRWHVATY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (FERREDOXIN-NADP+ REDUCTASE)
publication title Structural basis of the catalytic role of Glu301 in Anabaena PCC 7119 ferredoxin-NADP+ reductase revealed by x-ray crystallography.
pubmed doi rcsb
source organism Nostoc sp.
molecule tags Oxidoreductase
total genus 92
structure length 295
sequence length 295
ec nomenclature ec 1.18.1.2: Ferredoxin--NADP(+) reductase.
pdb deposition date 1998-11-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00175 NAD_binding_1 Oxidoreductase NAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1b2rA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 1b2rA02
3CCMB 3VNVA 2DY1A 4UAJA 3VO1A 1KTVA 4DQKA 3MCAA 4HE6A 4YAOA 1Q86D 1CNFA 3ES9A 3W5UA 1SM4A 2HCJB 3CC7B 4YALA 1QGYA 3QFCA 2B7CA 4RCZA 3OZUA 2BGJA 1DARA 1R5OA 1KRHA 1OB2A 2BSAA 1KC8D 5DSZA 4ACBA 4B4DA 4TMWA 1KD1D 4Y7CA 1H42A 1QG0A 3OJWA 2QN6A 2QMUA 3CCEB 1ZUNB 1DDGA 2GQFA 3U6BA 1AIPA 3W2IA 1ZM4A 3CRZA 5TY0A 2VNJA 4NBSA 1XE1A 1E64A 1M1KD 4YAUA 5JBQA 2B5OA 1FNMA 3QFSA 3JQPA 4RD4A 1WDTA 2DCUA 1EP1B 4RD2A 1VQ4B 2HMAA 4RD6A 1OB5A 2PLFA 2OK7A 4FN5A 1VQKB 1W35A 1YJNB 3FJOA 4NCNA 4Q7JB 3W2GA 1UMKA 1YHQB 4TMZA 1CNEA 4RCYA 1A8PA 3ZZTA 3I55B 4FWTA 1CQXA 1KJZA 1KK1A 1KK2A 3QFRA 1GO2A 1QGAA 3ZZUA 3A1FA 2PMDA 1S72B 1YITB 4PC7A 5AN9A 4M4SA 3LYUA 5TV2A 2HDNB 3B8HA 4PC6A 3MHPA 1IJFA 2C78A 4K1XA 2OTJB 4QFMA 1NDHA 3WY9A 1Q81D 2BV3A 1AMOA 1EP3B 1W34A 4PC2A 4B3XA 3OZWA 1EWYA 4N3GA 4Y9RA 2R6HA 1YJ9B 1BX0A 4G5GA 1H85A 4P3YA 1N0VC 1EFUA 1I7PA 5GV7A 4C0SA 1D1NA 4ACAA 3CD6B 4DQLA 1EFTA 5H59A 4RD0A 4Y9UA 1VQLB 3CCJB 5FA6A 2BGIA 2PIAA 2ZITA 3W2FA 1VQNB 4LC0A 3G6EB 4IW3B 3LRXA 4R71A 1YI2B 3WNBA 2RC5A 4B47A 3CMEB 2DEUA 4J0QA 3CMAB 3JQQA 2DERA 3V76A 3B82A 4TMVA 3FPKA 1Q7YD 3VMFA 1BJKA 2DETA 3E1YE 1QUEA 1NJID 1DDIA 2BF4A 3AVXA 1U2RA 1K9MD 3AVVA 1N8RD 3AVUA 1GR1A 3WNDA 2BPOA 3CC2B 3J81k 3VNUA 1QGZA 2E1RA 2VZLA 4AF7A 1J9ZA 1JB9A 2BM1A 2YWGA 2BN4A 4PC1A 1K73D 4RJLA 4ZGNB 2QDXA 1N0UA 3ZZ0A 1E63A 2OTLB 3E20A 2VNKA 1HA3A 1S0UA 1FNDA 1QUFA 5TR9A 2EIXA 2BMWA 3CPWB 1ELOA 3G71B 2CNDA 1GAWA 1G7SA 3U2QA 1TTTA 1EP2B 3I1FA 4PGOA 2D74A 1JA0A 3W2EA 3I56B 5THXA 4U9UA 5KSWB 1JNYA 4M0LA 4H9GA 3G4SB 1EFCA 4LBYA 1W2BB 1E62A 3CCVB 4LBWA 1YIJB 1KK0A 3OJXA 3WBJA 2B7BA 4MYTA 4TMXA 2C77A 5HXBA 2QEXB 4YHBA 4FK8A 3AVWA 3CC4B 2XNJA 4WQMA 3SJZA 1FDRA 4M53A 4ZGQB 2FX3A 1D8TA 1TLLA 1IB0A 3P26A 3LVBA 4M1KA 5GV8A 4N3NA 1VQMB 4LBVA 1G7CA 4B44A 2GPJA 3CXCB 4PC3A 1D2EA 2YWFA 1IJEA 2CRVA 1B23P 2BM0A 1BQEA 3QFTA 1VQ8B 2RC6A 1B2RA 3W5VA 1QVFB 4HE5A 3MMPA 1ZM9A 3CCLB 2OK8A 2VNHA 1DG1G 1GVHA 4ZCLA 5EMNA 3B78A 4EH1A 3CCUB 3CW2A 1F20A 3WBKA 3ZC3A 1QFJA 1SKQA 1JJ2B 3AVYA 3CB4A 1R5BA 1FNBA 3WNCA 4P6VF 2QTZA 4ZCMA 3QE2A 1KQSB 1KK3A 1FRNA 1ZM3A 3ZBUA 1EXMA 2QTLA 2XNCA 1JA1A 1W87A 1GJRA 1QVGB 3AGPA 3U6KA 4RD3A 2YWEA 2YWHA 3P27A 4ZCIA 4BPRA 1OGJA 1R5NA 1VQOB 3CCSB 4RD1A 3OW2B 1ZM2A 4AC9A 1Q82D 2EFGA 1G7TA 1VQ9B 2NPFA 1QH0A 3QSYA 5H5JA 4ZV4A 1VQ7B 3W5HA 4YAWA 4G1VA 1XB2A 2J7KA 1TVCA 2BVNA 3WYAA 4M2LA 3CCRB 1K8AD 4F7DA 4TN1A 2QA4B 3AVTA 4QHYA 1GAQA 1VQ6B 1QFZA 1VQPB 2VYQA 3AGQA 2VNIA 2X3UA 3CCQB 1FNCA 4G1BA 2XEXA 3VO2A 1QX4A 1QFYA 3JQRA 2AHOA 3OZVA 4LBZA 4AF6A 1BX1A 1YJWB 4MYUA 1F60A 3ZBTA 4TMTA 1FRQA 3WXMA 4C43A 1OGIA 1M90D 4YAFA 3PENA 3W2HA 1TUIA 3LO8A 4B48A 1G7RA 4B43A 1VQ5B
chains in the Genus database with same CATH superfamily
3ZHBA 4ZVTA 3UUEA 2WU4A 3A36A 1P0QA 1D2RA 5IKEA 2IOFK 2AK2A 2JBWA 1MVOA 3GARA 4H0NA 3K2IA 2IPNA 5EJ5A 3DZFA 1VJCA 1HDIA 1IHDA 3T3MB 4PINA 1JE1A 2XOEA 2GZ3A 3HRKA 3M5WA 5T6BA 1E4OA 2DQYA 3DAHA 3SM3A 1Q0PA 1ZOLA 4YCNA 4PS1A 4IDPA 4RJIA 4KXQA 3WB9A 1JSRA 3C6ZA 1H05A 3K1TA 2IHZA 3PB3A 4GXNA 5FBVB 3C8HA 4XOTA 1SHTX 5JSUA 3CUVA 3DXFA 2EFJA 5BR7A 1JIVA 4PCVA 5HZMA 2G36A 2B6HA 4PO8A 1EUCA 3DBRA 1YS1X 3EN0A 2ATCA 2NSHA 2IY8A 4UZFA 1DAOA 4KUEA 1C1DB 4K9LA 2P2GA 5DHRA 2ZBDA 2JVKA 5E3IA 3W6UA 1KC3A 1KZGB 2XADA 1P1JA 5BQOA 1KO1A 4KRYA 2R1ZA 4EW1A 4U3JB 3SKYA 1CB0A 2O5EA 2LCFA 3L6RA 2HEIA 4DIKA 4DR5B 4QYTA 5IF3A 1DXYA 1YOVB 2NTYC 3FROA 5EKTA 3GG2A 1HT2E 5K9ZA 2SCUA 4C7VA 4L7QA 5AHOA 1JQ5A 3CESA 5E9JA 1UJ2A 3RT9A 1BE0A 4B82A 4D4GA 3U40A 4BIIA 2WF5A 5HZKA 1LBSA 4WXMA 1Z7BA 4ZQHA 1TTHA 2DWCA 2J08A 3EPPA 5BN4A 4GKVA 1E9DA 2XE6A 3B1KA 3OW7A 1OXMA 4MUJA 4RDIA 4TLAA 4B8YA 2H1FA 4G09A 3GIWA 5FUBA 3FHTA 4YP7A 1M1KD 3QQ5A 2VOJA 4FGLA 4JKOA 1PV2A 1T3HA 5JYEA 2WWYA 1XU9A 2WE7A 3FYCA 1C7FA 1AKMA 3JQPA 3FR8A 1DINA 3WMRA 4BVAA 3BRWA 4I55B 5FP0A 4BWVA 4UNIA 4E94A 2QT0A 1NW8A 1C7JA 2CLIB 2WU3A 5CW1A 3EQ8A 2Y0BA 4F7WA 2PLFA 1Z0UA 5BN3B 1YRBA 2XY4A 2E0IA 4O4IA 2ACVA 5DOZA 4MUAA 1CUZA 3EC2A 5B7QA 3GJQA 3QVTA 5E7JA 2NZVG 4EGFA 3TE7A 4IXWA 3VJRA 2RDMA 1A27A 3GPDG 3ZVRA 4DV0B 5F9HA 3R0XA 3V1UA 4M8IA 2PXAA 4YJGB 2C4VA 2OORA 1S96A 2YMMA 5AIAA 3OC0A 4EGSA 2R7AA 1OA1A 2JCXA 2IXTA 2GN9A 1CNEA 2O2SA 2P79A 2RFLA 3MTIA 4AS1A 5C81A 3A6DA 3FNRA 5FHQA 3CU5A 4AX4A 3ZZTA 2QG4A 1P62B 2R97A 2RKOA 3PKJA 3W8DA 5K0NA 4EFDA 1F8GA 2AE1A 5C8ZA 3ZH9B 2XR1A 5FEMA 4YT2A 1LPPA 1EZ4A 1NT2A 2WTEA 4X8LA 3R0IA 1EGMB 1E96A 1Z0AA 2FPLA 1GTZA 3ZZUA 2AEMA 4M37A 3CEMA 1SZJG 2TMGA 3AHEA 4ARVA 1X7GA 2JDID 2UYGA 4TXNA 5K03A 2GBPA 4MQFB 2QTWB 2DPLA 3I9OA 3NBYC 1G4UR 3QPWA 2PL1A 5ALHA 4B9EA 1QOQB 2IQ5A 3H8VA 1HC7A 2O2IA 2P77A 2PZEA 4PRLA 4XDYA 5IC5A 4AMVA 4EHIA 2EVWX 4C04A 4ZI2A 3T54A 4JQZA 3ZU4A 5LFAA 4PC6A 5LUBA 2GJSA 4DLVA 5BNIA 3FTCA 4YA6A 4YRNA 5AW0A 4RPBA 3EBPA 3QGMA 1YNSA 1QO0A 1VKRA 4OOXA 1KAGA 1KYTA 3H5AA 4OK5A 4R8KA 3VXKA 1YDHA 2H63A 1ZCZA 3HG7A 3PUIA 3T1HB 1ECLA 3PFCA 4ADSG 2VH5R 3FKSD 3WFZA 4PC2A 3GVXA 4EG3A 1A50B 1K8ZB 5B2ZA 1JKXA 2PFSA 2UUBB 5A4DA 1MX5A 5HRAA 3LMKA 2XCLA 4WCFB 2CJFA 1NUAA 4WESB 5CNMA 1YA4A 2CHQA 1UBKS 2YS6A 1NBIA 4OFZA 1CUUA 3LY8A 4JBXA 4O5OA 5E3JA 2PUDA 3FTFA 3KOOA 1AMUA 4BGIA 2YTZA 3B6EA 2DBRA 5BNFA 4A92A 2A5GA 4EY3A 4ZD6A 2VAXA 3CE6A 3M1IA 4G5FA 4A0QA 5B3AA 3CLTC 3W77A 5GV7A 1YRWA 3AJ8A 4GGPA 2Z5LA 4DQLA 1YQTA 3TVDA 4DCGA 5M34A 1TPZA 1LK7A 1G55A 2B92A 4ENTA 3CLUD 1U1EA 4RD0A 2G9ZA 1QP8A 3IVCA 1FLAA 1FP4A 1CY7A 4GI2A 3A4VA 2PT6A 4RTJA 3VUFA 3E27A 3S29A 4P2GA 4WZEA 1OLSA 3IAM6 4Q18A 1EYZA 1XZBA 4BNDA 2ZITA 1FMTA 1ULHA 1WVGA 1K9SA 1XP8A 2ZJ8A 3BJRA 1Q84A 1Q12A 4LC0A 2JIDA 1HL7A 4RE5A 4W9NC 4DUZB 1GM5A 4HAIA 5EWJB 4TLEA 1IY9A 3Q88A 4WNAA 4P1VA 4X95A 5BR4A 2GVDC 2CXSA 5K0ZA 3OEED 2RCNA 3CGWA 1KKUA 5KVSA 5T3UA 4XONA 1R4MA 1NBEA 4U1RA 4Z2AA 5KWSA 5IM4F 2VJJA 5J5AA 5CG1A 4XMYA 1D1QA 2QMEA 1QGUA 3KEMA 4FDLA 4OM7A 3DMRA 1SUSA 2NQ2C 3CMEB 1F2VA 3H8SA 3JATB 4PZEA 4ZI3A 5A2QA 4B3TB 3B5EA 2WB2A 2X2EA 2ZIXA 4ZQFA 1SQSA 5FDFA 1AH2A 2DERA 1NXPA 4G97A 3GEEA 1ZOSA 3DAGA 4TMVA 3DG9A 2GN1A 4HEHA 2WHPA 4UVEA 4MWDA 4WA7A 4ZZ2A 3ROXA 1UWKA 1Q7YD 1FFSA 3K0AB 4JQOA 3TI9A 1GNRA 3UK2A 1JT9A 2DETA 4XLCA 1NVDA 1O57A 1W2HA 1Y63A 3Q98A 2V7WA 4WFKA 3CF2A 2PAFA 4YDHB 1PTJA 2A84A 1QDUA 4P58A 5BR8B 4F1WA 3AM4A 1BS1A 4CL8A 3DB2A 4J49A 5BT8A 1ZKMA 3DFKA 5LD2C 2PR7A 3AVVA 2GCOB 1E1RA 2PL9A 3A31A 2BKXA 2E87A 5DHTA 4F1KA 9MHTA 4QOHA 3EZ9A 1EZ1A 1H2EA 2Y1XA 3HJCA 1FMFA 2C31A 3EF0A 4M99A 3CGGA 2RGCA 3WQBA 2QXYA 1AKUA 1KFKB 1J23A 2JB9A 2JGDB 4Y9SA 4BCBA 5I7HA 1K1EA 4X1IA 5JWHA 1I94B 1UJNA 2DHDA 2I7XA 2R8OA 3PGJA 4GBGA 3OM8A 3P2YA 3L7BA 1QPZA 3VU8A 1GNLA 2CXQA 2O2DA 1ULZA 2R6AA 2VPXA 4YMIA 1N2IA 2QTBA 1KZ1A 4WNYA 5AUQA 1WPXA 6ADHA 3P9YA 2XE4A 2O2JA 5ELXA 3A8TA 1JYSA 4CKCA 3WGGA 1YJBA 2VBUA 1FDUA 4PZLA 4AWBA 1C80A 2VBIA 4B40A 3BDIA 4OP2A 3GEBA 2PRYA 4N12A 4ZHQB 4RTNA 1N0UA 3ZZ0A 2X0NA 3UATA 3ORQA 4G0PA 1SBIA 4R9SA 2NU8A 2QNBA 3GLQA 3LW8A 4RF5A 1E61A 1E2NA 1U0GA 4CBVA 4E4RA 4HDRA 3I2JA 4LXTA 1NBAA 1ZU4A 2WTNA 3DTVA 2IYNA 1M83A 4ASUD 1K3FA 5NULA 2BMWA 2C4TA 2F1MA 5HKKA 5A1TA 3FIUA 4MVYA 2ACKA 5KYXB 3FSEA 1NXSA 2AN3A 4NBNA 2JAXA 4TUYF 3ZHRA 4A6EA 3U3KA 5DWDA 1F12A 5TX7A 4CDMA 3IO3A 1UT5A 4D97A 3KZCA 4OPMA 3TXYA 2A1TR 3G2IA 4UW9A 1XEWY 3MW8A 4ZAGA 4C0BA 3QVLA 4EGJA 4HBGA 2WJPA 3R9KA 3ETJA 3B36A 16PKA 4OJQA 4WN3A 1TD9A 2CK3D 4ZEXA 3WZ2A 2H1WA 1XDBA 4L95C 1IE3A 2GAJA 2H6EA 3GAAA 5B12A 3SSNA 4UBOA 4M38A 4Y2TA 1G4HA 1TAGA 2LCQA 1EHCA 4U6QA 3LA6A 1Z56C 3TEJA 4ARBA 1SMKA 3AXSA 1Y9ZA 4X84A 1DO2A 5F4OA 3GLSA 4ES6A 3BDVA 2QENA 3PQCA 3MELA 2GLXA 5DYWA 1RC1A 1O9GA 4HX5A 4ZYZA 4JC4A 5DN6D 4QFBA 4G9BA 4B85A 1QCZA 1ODFA 1U7ZA 1U8ZA 3VR6A 1DAKA 3DE2X 3MK31 2PZMA 4FGKA 4GC9A 2AH5A 1EFCA 1Z0JA 3AV3A 3DEZA 1NNSA 4NBTA 1P0CA 1ZCJA 2ZFUA 1CHNA 1RYNA 2ZJAA 4U2DA 1ZFNA 4CM8A 3TTSA 3ZJ5A 4PG5A 3RRMA 5IYNA 1Y6RA 3QBDA 2C0PA 2G1PA 1NY6A 1U5BB 2WSMA 5A4IS 1X0XA 3SFZA 3ZE8A 1HX7A 2SNIE 3TQTA 3ZTWA 1ZC4A 1R8XA 1Y8RA 5FNVA 4R5HA 3OPMA 5GZ1A 2NXCA 2VHEA 5EUQB 2QAGC 1KFJB 3QG1A 2LP4Y 4K8RB 4OQDA 1S7GA 3FCSB 3DWFA 2FX5A 3NYRA 2Y76A 1T15A 1CY8A 4I5DA 1XEWX 4IQ0A 2ORVA 3ONNA 2XNJA 2HO4A 4WQMA 4U7WA 1PFYA 5JZVA 2HZ7A 1G8AA 3PEEA 2FWPA 1AOXA 4RF3A 4BVGA 5HQ3A 3CZ5A 4NECA 1YB4A 4Y6SA 2V7XA 3NVDA 1VM6A 3NS7A 5GWXA 1JUDA 1QV7A 2GBCA 3I4FA 5KOHA 1PJSA 1U0BB 1G41A 1I4LD 1QZZA 2G4CA 4JX8A 1I2ZA 5HGJA 3V4FA 4LOHA 4A5OA 3RUFA 5BNWA 3EAFA 3W7VA 3JWGA 3NTVA 1Y37A 1YVEI 5G3YA 5BYBA 3TBKA 4D9NA 4H3SA 1D1SA 1NP7A 2WJZB 1XCMA 1C7EA 1EAYA 2EARA 1BWPA 1QDEA 4V1CI 3KKNA 3REQA 1DBQA 3WGVA 5KNBD 3VR4H 4G0NA 3V1TC 1KERA 2OESA 1H6BA 1T1GA 4S24A 1FVXA 4DNPA 1DNPA 3FDZB 3RBXA 5AQEA 2RC6A 3RB8A 1D6MA 2IL1A 3CPHA 1IZYA 3ILHA 1L4EA 4OA5A 1H2BA 3HE3A 1ORTA 2C8VA 3BFKA 1S1MA 3GFGA 4RQUA 3DBHB 3HN2A 1J2TA 1VYVA 4MR9B 3NVKI 3MBIA 2WILA 2A9RA 5F52A 4G0ZA 4I36A 3GN1A 1VPTA 4O02B 1L5LA 3TN7A 4QUDA 2F3SA 2H7VA 4YUZA 1SHLA 3T3PB 1UMDB 1NLZA 1XU4A 1OT3A 4XCQA 5K8IA 3S7ZA 5K0SA 1HZZA 2GLTA 3C6BA 3K7EA 3N0VA 5D5HA 3VO8A 4BO3A 1NR5A 4CKWB 5EXPA 3EDMA 3QK7A 5DMHA 4Q19A 5IYQA 4CKYA 5LJIA 1S01A 2IT1A 4P9NA 3LNTA 3U16A 1P45A 2P30A 4LRSB 1F38A 4KLRA 3UAWA 4AJ1A 5TMDA 3CB4A 3AFHA 1V8BA 1YAJA 3WNCA 3OM9A 4URZR 4DCSA 4YXWA 1E2IA 4F1JA 2H51A 3L4SO 3LRTA 3UGJA 1QH1B 1ZX1A 1LD3A 2CLFB 2WG0A 2XWBF 1KK3A 4HDAA 3JYLA 2W2MA 5G4KB 1EVKA 4LZNA 4L6CA 3KWLA 2RHGB 2QTLA 1K86A 3ZHCA 2L42A 1TTQB 3NHSA 2YJZA 3PWZA 1S3SA 5LQMA 1I30A 4RY2A 2QTHA 5B4TA 3COVA 3WYEA 1M6NA 4KG7A 2VTVA 5JANA 4ZCIA 4JLVA 2ZYTX 3AX6A 1R5NA 5HF8A 5FEUA 1VJ1A 3CCSB 5ERYA 4ASUA 5K3DA 1N6KA 1M1UA 1MQAA 4UVDA 1MBZA 4GMKA 3TQIA 2LWIA 3AEKB 2GDJA 3S28A 4HEQA 2J7PA 2GN2A 2PSDA 1VKZA 1MB3A 4K6HA 4LDQA 5JAQA 1G7TA 3ROPA 1N33B 5KTKA 5KYYB 1EG7A 1XCJA 3N2KB 3NBQA 3NUGA 4FDUA 4IDGA 1PHRA 4N9WA 4IUBS 2A9FA 4P81A 5DHQA 1QRUA 3VTKA 3F6CA 3MS2A 3RC3A 3RUIA 4EKYA 4MXDA 3A1PA 3NIWA 4MRMB 8AT1A 4DJEC 4MMZB 2QP3A 4C7MA 1KYZA 4XGQA 1IXZA 1GCGA 4DK0A 2BKAA 7ABPA 4CT5A 4F5YA 2QJRA 4CF3A 2CKMA 1T0JB 4RPLA 4DQUA 1AQLA 3JQGB 1Y4UA 2K2WA 4ND4A 5BMVB 2V7QD 5GP1A 1KRWA 1PWZA 2YV2A 5LNK6 1VPEA 4B4VA 3CCRB 1TVKB 2HN9A 3NNNA 1NJ2A 4FONA 2PU5A 3ZWAA 4FFPA 5ENDA 1OAKA 1ZUHA 1PZMA 2WEKA 2I6XA 4QHYA 1YFJA 2AOXA 2VPTA 3WKEA 4NDNE 4MTCA 4EI7A 3KKQA 5BWBA 4Y8VA 5LZ4A 3NIFB 3OQJA 1Z0DA 1B93A 4LYEA 2I2BA 5JCOC 2X8BA 3ZXUB 3LS2A 4Q7EA 2MR6A 1VJTA 5AP9A 2XZOA 2XEXA 3RQIA 4YRZA 1JQEA 1T4BA 4G2TA 1DTWB 2J48A 5EJ6A 3J80A 1OCEA 5EIBD 2P5SA 2PKXA 4JNKA 4DV2B 2DYIA 1JDZA 1WZIA 1DQSA 3IERA 1R66A 4ND8B 4BFVA 4DC1A 4ENSA 2ZTGA 4AF6A 3L46A 1UEIA 2H2HA 4UPDA 1F60A 3ZBTA 1JW9B 1H5QA 5E9AA 4LDRA 5LYJA 3T99A 4C6SA 2VWHA 4XE5A 2W42A 1PX0A 3R5HA 1ZMBA 1PZEA 5K7SA 1NV8A 3FNEA 2IH4A 1K6MA 1A9ZA 1E79D 4MHTA 2HTFA 2V7PA 4FKBA 3UK7A 3GY0A 1E1NA 3U7QB 2VO1A 1KXZA 5K5EA 3R0VA 4UOQA 2W6CX 5KQRA 3ZY5A 1T2DA 5LMCA 2YJ3A 1WOOA 2NGRA 3CWQA 4UM9D 3F3KA 5CM2Z 2F3RA 3KCNA 4QELA 1KQGA 2OY0A 4FWBA 1HLGA 3RFTA 4MIEA 3EIEA 2AB0A 1OFUX 4NFYA 3JALA 4MDYA 4OHPA 1A1SA 4FYHA 4U02A 4ESEA 1KL7A 4TMKA 1Q6ZA 3HR8A 3PNKA 4K2HA 1CWUA 1TQ8A 1FFXB 1WG8A 4AY3A 4W8HA 4FBMA 2V45A 1ISFA 1DU4A 3O31A 3RU7A 4TTTS 4MRRA 1GPUA 1Y1SA 13PKA 2VKQA 3G5MA 5DP1A 3AF0A 4CL2A 5IU6A 4UARA 1RWPA 3PQFA 4DB4A 3OIGA 3BJMA 4DLRA 1O03A 1G2IA 4GEGA 3H83A 1XZDA 4UCFA 4KOEC 4BCCA 1HDOA 5B53A 4HPXB 3WHPA 2F3TA 1JEYA 5AJYA 1EM8A 4M1TA 2X40A 1S2GA 5F1PA 4D44A 4ARCA 3LUFA 1YASA 2Z1MA 1E66A 4B2IA 4EYEA 2ATVA 2HLPA 4N49A 4DCJA 2JLVA 2B7CA 2Q6KA 2Z0MA 3BXFA 3PX2A 4TVBA 3RBVA 5EXXA 3IA2A 3SMQA 4HG2A 4BVLA 1NRIA 1JFLA 5KJEA 3UMBA 2X3FA 1H65A 5DCYA 1OB2A 5K6AA 1USWA 3NH6A 4XYMA 5JCZA 2FHSA 4NE2A 5I5EA 3JAMA 2XGMA 3R3JA 3MLEA 1XZKA 4W82A 4GX5A 5CT5A 3GLGE 4C06A 2ZBRA 5EZQA 2GFQA 4ERXA 1O1YA 4GPAA 5CB4F 4FYMA 3CCEB 1U2DC 1UIRA 4NEHB 2IIBA 1JSLA 1ZUNB 2WYOA 1YE3A 2YY7A 4OV6B 5F51A 1U3FA 2I3AA 2JEOA 4EMTA 3V7NA 5IUJC 4Z4HA 2GPSA 2OBYA 4RPGA 1ZM4A 4B34A 3PGLA 2UZAA 4F2WA 2WT8A 5LXTA 1BHO1 4RSRA 5IJ0B 4FEYA 3RO7A 5SYAA 2G1KA 3A6HA 4O0LA 1G17A 3WLMA 3CR7A 3DVLA 2ZPUA 4ZO9A 1T8PA 3U7HB 4D0NA 4N8DA 3OZXA 4DMRA 1GUYA 5BNZA 2HK8A 3CZ9A 3LWBA 5DEIA 4ZYWA 1XVLA 2C2MA 4LYYA 3E0QA 4PYKA 1NGSA 2RBEA 1J8VA 1JHXA 1ZIYA 5EMKA 3RRNA 3P20A 1MH9A 3IB3A 5D1HA 1MVLA 4RD2A 1XKQA 1Y1PA 1ZRNA 1SU4A 4J0KA 4NAVA 1VPWA 5K0EA 4G6ZA 1OWOA 2JKZA 4G0MA 3PJRA 1N3IA 4NK4A 1SXJB 1L4GA 2ZR7A 3HB7A 3V8EA 3KAKA 3RHTA 3C7TA 5FRDA 5A4KA 1RM4A 3N5CA 4L0QA 3WJ1A 3UWKA 5BUSA 1CLUA 3H19A 3P9NA 4J75A 1AUPA 4FNGA 4DJJA 1KWKA 3FJOA 4NZ9A 1U0JA 1XN4A 4FEAA 1V71A 4U9IS 3CLHA 4U2CA 3QZUA 5D8DA 1RE1A 1Z6PA 2C9YA 4OMUA 1CZHA 2FLKA 2GOYA 4R8MA 3TR0A 4JYZA 1V4NA 3F90A 4A1OA 1IN6A 1V5EA 2AJ8A 4RYDA 4M6WB 1C9EA 4XUGB 3H9EO 4CFSA 1EUDA 4C7BA 1WCXA 1HG0A 3NBUA 2OMKA 5FNVF 5EE0A 3GDHA 2KX7A 1P6QA 4TYWA 3EGCA 2AOUB 3M6IA 1J56A 3E8XA 4ZYYA 5IWAB 2BFCA 5DRYA 4BJ6A 3KAQA 2DR0A 1P2DA 2V4ZA 5E6UB 2JK0A 4JKIA 3C8ZA 2IV7A 2FMFA 3WYBA 2I67A 3U56A 2W2QA 4S3MA 3NFYA 1IHUA 1X8XA 1Q7RA 2RI6A 2E4XA 3ZUPA 3K6SA 4BYMA 3EGXA 1E5XA 5A71A 2CF6A 1JDBC 3MM4A 3O2QB 3IR7A 4HUTA 3MEQA 1KDPA 1LGYA 1TIKA 3FCUB 2E4UA 5FBZA 5FTMA 3SOZA 4WLNA 4F6RB 4GOKA 1ADGA 5LA6A 1R00A 5M3BA 3RODA 5L7WA 1WU8A 2RAFA 4CR6A 5HZHA 2WJJA 4JR1A 3VZSA 5B2FA 2WUGA 2ODBA 5ERGB 5ICGA 2X8LA 3Q2IA 1B73A 4C7OB 4QYXA 4IH1A 1SVUA 1ZIXA 2WU8A 3R9XA 3OZWA 1C0EA 4RVFA 4LJKA 4UBMA 5AXAA 3D4PA 5JDIC 2YHUA 3HS3A 2C7OA 4KE9A 4Y9RA 3N1UA 3K3PA 3X2FA 4C7OA 1W8DA 5KOYA 1PZFA 3TFQA 3OY2A 3CLUC 1G59A 4MJ3A 3JQ9A 2RGUA 3IT2A 1DE0A 1TMOA 5AOAA 5EE3A 1OZAA 3NTUA 3TLJA 3THWB 3S2UA 1ZQ9A 1XQ6A 4AW9A 4ZVNA 3AG6A 2VHTA 3DV0A 2ISSD 4HAVA 3UMVA 5GVSA 2PKCA 3L7AA 5AM4A 1T9GR 3PYLA 4R7GA 2I6GA 3CT6A 3AEUA 3AHDA 4OXXA 3I23A 3K6SB 4CI0B 1X2BA 1SVMA 5CK5A 4UBLA 5CXQA 4JK3A 3DEIA 2BKLA 3AR7A 4UFOA 4W9MC 2H16A 3VHQA 1OLUB 2BGIA 1SC6A 4PO9A 1QIHA 4L76A 3HJUA 5J23A 1LTHR 5IDQA 1JAXA 3ZWMA 1Z5GA 3JVVA 2JIQA 3FLAA 4B75A 4CG0A 3ET4A 2GYUA 4R3NA 2QX7A 4S0XA 5HF9A 1YS9A 1PDOA 3LLVA 5HEKA 1YACA 2AJCA 4DDUA 1KAMA 5DNDA 3U4CA 1N2SA 4MUNA 5EHQA 4JB2A 1V1RB 4D9GA 1W76A 2F1RA 2QXUA 2XDYA 1K2WA 2XV1A 3HO8A 3O47A 3NPAA 5DBOA 5FUXA 3USES 4GPZA 4C89A 5KI6A 4HVCA 2F4VB 3ORRA 1QQ6A 2XA2A 3AONB 1Y5NA 5EP4A 3IP1A 2P3OA 4F86A 4NH0A 3GP8A 3S40A 1AN9A 3L0CA 3BTUA 5D3ZA 3TOCA 4URUR 2AZTA 1RLOA 3VMFA 1LBIA 4HUQA 3TTUA 4AJLA 1IUOA 4BO2A 4TS4A 1IM8A 1SXJA 1ONSA 1VHEA 1RRFA 1VJDA 2PLNA 3B6ZA 5KCZA 1V48A 1Y4AE 2GJ9A 3FYDA 3JARA 4LY9A 4UNRA 4Q3CA 3AILA 2NV6A 3MJCA 1QYIA 5IAGA 1QU3A 1RPZA 3CVOA 4RVHA 4X8HA 1YVRA 3QIVA 1SKMA 1DJPA 2ABWA 3O7WA 4ZU6X 3GRCA 5EZSA 3WNDA 3KT8A 3U4GA 2WF9A 1Q0LA 3UAYA 3WLFA 2R6ZA 2FQQA 3CZAA 3TKYA 1L5OA 5AXCA 5MF6A 4RPHA 4K26A 1EWRA 1FDTA 3H2YA 3D7SA 5EXSA 4NYIR 5IFLA 1CJUC 2V6MA 3ZPNA 4MQLA 1IVNA 4MRSA 3IVAA 3JX9A 5JSFA 2G0AA 1BWRA 1E2KA 3LPLA 3FSRA 3D3EA 4JJEA 4EUFA 5CNIA 4EYKA 2OENG 2WW8A 1W1IA 4Y9DA 4PRKA 1OTXA 2EKLA 4P82A 2OCDA 3U9LA 2IJGX 1GARA 4CCYB 4ZIRA 4ZQEA 3M6VA 4Q01A 5KKCA 4PX3A 1DADA 4U2FA 4YACA 4US2R 1EK2A 5KOJA 4FFDA 4ZMBA 3FZNA 1H3FA 2QW8A 4RZXA 5BPHA 5FOUA 1UKVY 4B46A 3OZIA 3E6AA 3RS9A 1NFQA 2Q4DA 3KQVA 1QSGA 4OBXA 3ZTTA 2NUAB 5B3JC 3RKUA 1E6UA 4RM3A 4A2QA 4ABYA 1F4LA 2ZRNA 1XJ0A 3OF3A 1O97D 2IODA 4KRGA 4R84A 4BLVA 1XNJA 3FBGA 1TTTA 3RYCA 4RLSA 5JRDS 2FMKA 1Z15A 2VPYA 4JELA 1YB1A 4L28A 5FR1A 1PKEA 4K8OA 2D74A 3C1UA 4X05A 1YMUA 4HEA6 1F8UA 1GOTA 2B83A 3MUEA 3LK6A 4BL5A 3AVOA 1UPFA 1SD1A 4IX9A 3BTSA 4L3WA 3KHSA 4PFJA 3TTVA 1UXKA 1XRQA 3H8WA 3NYIA 3FOEC 1ONPA 3ELYA 2Y1LA 1QYRA 1Z4QA 3BEOA 3GJXC 1Y33E 1U9JA 1YGYA 2D1SA 1FFXA 2AD5A 5TS3A 2XT9A 1UINA 4KQFA 2BJWA 3UWSA 3NHYA 3G4SB 4XLTA 3WYCA 4TWBA 3DMFA 3CY6A 3GRUA 2UZ4A 4LBYA 2I8LA 4QOSA 5B1SA 2VBVA 1WDLA 4U5QA 4A4DA 2O7RA 3QE9Y 1KVTA 1IYZA 4X6UA 1VE7A 3VX4A 1X8JA 2CFIA 1WKVA 2H7YA 2X7XA 1RRPA 4BB6A 1E20A 3EMBA 1MG0A 4URYR 2UYYA 1E1QA 4KFSA 2TSYB 1E2MA 2QRNA 4WLOA 1OYYA 1XWIA 4J07A 3CJRA 3CNLA 1ZVMA 4LHWA 5CDGA 4WADA 5L9AA 2FF7A 1AHPA 4YHBA 1FDWA 1S1CA 4XPIA 1P1BA 2Q45A 1E3JA 3A2NA 1MFPA 2QNRA 1RXVA 3KQMA 3ACBA 3I01M 3FR7A 1P4AA 1FDRA 2BE7A 2DFNA 2R48A 3CNOA 2XUFA 2ZUTA 3M3DA 4P34A 1HRDA 1QHGA 4MRPA 4BB0A 5LZ7A 3KQYA 2FEWB 1CR2A 5EZYA 3C3MA 1TLLA 3QW4B 1NKVA 3L8MA 2W2NA 4R1QA 3D5TA 3IYLW 3ASSA 5LJLA 1AGXA 1HFWA 1PSZA 1ARZA 4OQXA 4EECA 1B6SA 4IOMA 4JSRA 2RCYA 4HXFB 1JH8A 5FR2A 5BW5A 1NQVA 1PT8A 1XG5A 3N58A 2MINA 2CHUA 2QTRA 2Z2XA 5C3UA 1QP7A 4AKTA 3CXCB 3KL9A 3FUVA 4NCKA 2QRKA 2V97A 2XRFA 2Q1SA 4F3YA 3EVAA 1X42A 2ZWIA 2BM0A 1KY5A 4BKOA 1A82A 4F8YA 2QJWA 1RFGE 4LHYA 4QQKA 2NMVA 1DELA 1GZ3A 4U8GA 3QF7A 3HUTA 2GAFA 1ZMOA 3RWMB 4MI6A 1M1YB 4IYRA 3O1IC 1PFUA 3OJCA 5JI3E 1B2RA 2CJYA 1SCJA 2GTPA 4QSMA 4U6NA 2BELA 2CT8A 1EFLA 3RY8A 1BMQA 2D8MA 4C22A 4CEJA 1GZVA 4RENA 3N2GB 3WLEA 5EIOA 3UJCA 1S7CA 4EUNA 1Q0UA 1BFUA 3AB7A 3OQ1A 2AVNA 3MILA 1JBEA 2O6HA 2PD6A 1H1LB 3C6MA 1HDRA 2DPHA 4C0HA 3CR8A 4I1IA 4OFWA 3Q7SA 3AUJB 3WRWA 3RIXA 1G9XA 2QM7A 1OHHA 4AS2A 3QKRA 2YFKA 2HSZA 2Q0XA 1V7PC 4PWZA 3TLMA 3TDNA 2TECE 2YIMA 3PKIA 1ESZA 3AEZA 1J8FA 1BDHA 3KUDA 1VRVA 1YS4A 3H17A 2VRCD 3KELA 1CNMA 3E8SA 1JGTA 4V1CA 1ORHA 4NMLA 1QBKC 3EFEA 1CDOA 4URWR 2GJKA 2GGSA 4MS4A 3JU3A 1EK6A 1PG2A 2OBNA 3IAHA 4GZLA 5B6JA 1TT5B 3I6IA 1XTRA 3BC9A 3DT6A 3RC9A 3SXUA 4FB5A 2FQWA 5JSHA 4RM2A 3PDCA 1NBOA 2LVBA 3CBQA 1NN5A 2V0CA 4FFMA 1U31A 3HVRA 1XMVA 5AM3A 1SKBA 2CNKA 4UHBA 3UXMA 3Q5DA 1T10A 3VBCA 4UTNA 2PKQP 4GSLA 2Y05A 1X7HA 3I8SA 5D5QA 1II0A 4PM4A 1VKOA 4LW8A 2IW3A 3FMFA 5CH5A 5F5LA 3SX2A 4BS9A 1XLWA 4D3XA 2V7QA 1VLQA 4FINA 3OE5A 1V95A 4PPQA 4KX5A 3WMXA 3N6VA 4DM7A 5HKKD 5A2GA 5HS4A 2BISA 4C87A 1WE2A 4TUYB 1Q82D 4NMXB 1SXJE 2B98A 2AC4A 5C3MA 4WZAA 1XCBA 1TEXA 2VDWB 3BYZA 2O8CB 2FPGB 2YICA 4OK6A 4KPEC 1JFSA 2C98A 5FQOA 5BSFA 2GUWA 4OHFA 4BBAA 5H5JA 3C6KA 5HE8A 3PI6A 1NB9A 3MJFA 1UWVA 3DBHA 2XKJE 2HA3A 1WVIA 3V8BA 3IV6A 4DBVO 3A04A 2G76A 3FPLA 1RCFA 3P2OA 1QFSA 1J0AA 1TM4E 2GS9A 3DHVA 3HCOA 3LF2A 2BI4A 5JNRA 3UJPA 1TM7E 1PUJA 2ZIGA 2DOGA 3IESA 4RVOA 4ZOBA 3IEPA 1MHPA 4AMBA 4BNJA 5A5DA 1PJZA 1QG6A 3GZNA 3BB1A 3CWCA 3ME5A 4MINA 1QTNA 3DAYA 4KQ1A 5G4LA 5IBRA 2C7RA 5I9IA 3WYAA 4C2AA 2X8WA 4WN9A 2QP4A 3I53A 3VZRA 2QPOA 3RKSA 1MB9A 1K06A 2FGKA 1Y8CA 4O4LF 1KYQA 2HSGA 4Q9NA 5C1IA 3TB4A 4J2OA 1QP4A 4OLBA 1UBHS 3N28A 4TYMA 2FRVA 3AR8A 1IBSA 1JMVA 4R8LA 3X1JA 3PC2A 2JIZA 3CCQB 2ZZEA 1CUHA 3HYRA 4OU4A 1KEEA 1PQWA 1YQDA 2YWDA 3V48A 1MR3F 2G1JA 2IXGA 2X13A 2P8JA 3C3DA 3UWPA 1RC8A 1U81A 2GBLA 4U7HA 3PDIA 4AUKA 3BXZA 3PVZA 4CV1A 2VYVD 3C48A 3C97A 1YIOA 2X7JA 4D9HA 1YJWB 1BX1A 3K5IA 3QPCA 4EY4A 1G20A 4OI4A 1MQ8B 5FI5A 2YKGA 5GONF 1E79A 5JZSA 1WLSA 1E2GA 2VT6A 1MEOA 1Q20A 3ANLA 1HDEA 4HX9A 3B3FA 4C43A 3PD0A 1JIIA 5D2CA 1OPXA 4TV9B 2J3JA 1RWVA 1ODTC 4OP1A 4R1TA 3HUDA 4I3GA 3WKDA 3FOCA 3Q8XB 5A3JA 4QZVA 4QBKA 1SBCA 4LJ8A 5F4ZA 3R3VA 1O6FA 2NO1A 3A1TA 1FU4A 3IOEA 3NGMA 2FPSA 4RJ2A 2CBGA 4CMEA 4CM8B 2HF8A 1UOQA 3GL9A 4Q6BA 4QOGA 2WD8A 4TS1A 4NS4A 4X3OA 4N47A 3M7IA 4EEKA 3D6UA 1N6NA 1TO6A 2FKAA 2CY0A 4WLFA 4YJKA 3OECA 4B3HA 1Y4DE 3DH0A 4TVKA 1BD4A 1TIBA 3U26A 1C3LA 1BWQA 1YQEA 4MW5A 4DA7A 4TTQA 2A3NA 4E21A 1OR8A 5HKOA 2P6RA 4BGUA 2PD4A 2WZPP 5AI8A 2YIDA 1SQFA 1MD9A 3OAAA 4PQEA 5JVDB 2OXRA 4RA6B 1USIA 4P3PA 1WR8A 1ESDA 1O97C 1U7WA 3VH2A 4IUCS 2CFOA 2YXEA 1ML4A 1RHQA 2O23A 5CH3A 3KJHA 5D7NA 1FXWF 1JI3A 5KTRA 4YALA 3IHTA 4WECA 2RGRA 5HZAA 3WSWA 3QOYA 3ECCA 3HCNA 1ZBDA 4J43A 3VYTB 4PTZA 1O8BA 1LLFA 4CDNA 2BKUA 4MA5A 3H1EA 2YMPA 4M1OA 2CMHA 3NHRA 3BHMA 4YJFA 4BV3A 3C43A 1HGXA 3EZYA 4BE7B 2WDZA 2YRFA 1EAMA 1FUEA 1NU6A 4R9RA 4RO0A 1M6YA 3PRKE 3VU9A 1Q83A 3RRBA 3UMMA 3OQIB 1AS0A 3HABA 3O4FA 3O4IA 1JG7A 2OCLA 3QU4A 1P72A 4M1ZA 1XBTA 3C5CA 4M0KA 3R9WA 3IV7A 1NHGA 4ZHQA 2JLAA 4JQYA 2ZT7A 4LY0A 1U7DA 4I1PA 2O06A 1O6ZA 3DLTA 3ZLVA 4DRZA 1O5IA 3RJTA 5C7YA 1AXRA 2KHZA 3KSDO 4Z1OA 2YXDA 4KV9A 4PAGA 4RQTA 4PZDA 3II6X 1N6IA 4E88A 3TPFA 2O0JA 2CNWA 7GPBA 2R79A 4DMCA 4WSOA 1U99A 4AURA 1E58A 1FBNA 3NCTA 3LQYA 2ZEJA 4I6EA 1TO1E 3FOBA 3EY9A 2QVGA 1XQVA 4HATA 4H1WA 5AVSA 2G08A 5D5PA 5C4GB 2ZPAA 5IXJA 4KRFA 1U8AA 3GJ4A 1Q19A 3DEJA 3HKEB 1YTUA 1O9HA 3FCAA 1XDSA 1EP1B 1NHWA 5EA2A 1UAAA 3BSFA 3DLPX 4AZ3B 4E1BA 4F06A 5A0VA 3MVEA 3GVKA 2DKOA 3D7LA 3JU4A 5L4LA 2E6UX 4IDOA 3OFVA 4AZTA 4Q3DA 2ZUFA 2XZLA 1GG2A 3T7SA 4FGJA 4ZVUA 2QT9A 5E8RA 3H11A 5B64A 1E3TA 4MEAA 1Y8QA 4REQA 4XSHA 3AESB 1AGPA 1DBWA 3JATA 2AS0A 3H87A 2PQ0A 3H65A 2XCQA 5TSDA 1PK7A 1YS2X 1PIWA 1RWXA 4LSWA 3U49A 3ZWDA 2KMLA 3V33A 3UUFA 4NFLA 4C0AC 4G7WA 2FGJA 2VCHA 4QWWA 4E7PA 1WXQA 1U3TA 4HEJA 4EDHA 1Z38A 3FG9A 3PTLA 4GBJA 1RQRA 1U9IA 5FBHA 1CEEA 1S3FA 1Z4KA 4OBBA 4RLFA 3WRXA 3QYJA 4KIGA 4LNAA 4OLJA 1OLSB 2FAXA 3HSYA 4BNDB 1P4HA 3EGDA 1FTGA 1L5FA 4PLVA 1AU9A 1L5VA 3LPNA 3OE4A 4J3JA 3RS2A 5EZYF 4HNSA 1OFTA 3K6RA 3MG9A 2B82A 2WZDA 4KXUA 4CGYA 5LR6A 1JN0A 1UT6A 2XVZA 1FRFS 3QH4A 4QGSA 4Y0AA 3NEAA 1FTWA 5TV2A 1HKUA 1XAIA 2B8NA 3WE7A 1VLLA 2Q07A 3J7TA 4IEEA 4C1NA 2QR2A 1DMSA 2OGZA 4JOCA 1YCGA 5KC8A 1P1HA 1YDWA 4PX2A 5SZHB 2D0OB 3PE3A 3O95A 4A10A 4RFSB 1U0EA 5HF5A 3FUUA 2JGMA 4RIGA 1EZZA 2NU9A 3BFPA 3CLRD 3MSCA 3DZHA 4DLUA 4HJRA 4IRUB 2VRNA 1W34A 4MAAA 3VGPA 4JJZA 5IHXA 2WIKA 2XKKA 1REQA 1TKRA 2EX0A 2UZ0A 3TVYA 3MAJA 1I1OA 5BRJA 4CTKA 1ODCA 2PX3A 4A8TA 1QNFA 2OSVA 2QGGA 3D3WB 3DB1A 1UFVA 4HAZA 4CMIB 1BX0A 5T4FA 4ZEMA 3H6GA 4OHXA 3VAZA 2O9JA 1Q5PA 2VL7A 4PSUA 4RNCA 4AG6A 3JQ7A 1HURA 2C2KA 1SO8A 1QF7A 4E5KA 2HCRA 4D98A 1ZU5A 5CVEA 3V8RA 4DMKA 4GKKB 3Q3VA 2C9MA 5UKDA 2OO5A 2EZUA 3MWLA 1NE7A 3LPCA 1S2MA 1NWHA 5ELLA 1HNXB 1FRVA 1W44A 3B6IA 3E5NA 4HB3A 1L7EA 3LF1A 4GQNA 2C5HA 1Z13A 2ALJA 1H4QA 1L8QA 4P36A 4FIZA 5H59A 1U4OA 1R4ZA 2X6QA 3PEFA 4JBYA 3LBFA 5EUCA 1MCZA 2LDXA 1S89A 4K6GA 3CYFA 4LZPA 2F4NA 4DYVA 2GM4A 1SZPA 3A1NA 4W7IA 2HA0A 2Q3JA 3UO8B 1WZCA 3G68A 3PF8A 5DRTA 5IVPA 1B0AA 4BCDA 1UBCA 1EPUA 2QK4A 3F6BX 3IPRA 4DPKA 1N3YA 4L02A 5K8TA 1U7HA 1JEOA 1Z6GA 5LMUB 1HRKA 1YRYE 4YCAA 1V16B 3AL0C 4ALKA 3VV3A 2Z8XA 2F7SA 1T43A 3EIQA 4CLEA 1NQXA 4OQNA 3DOHA 1V16A 2PTGA 4QUJA 5ALFA 1DOZA 2JIMA 4X54A 3LLSA 1XCGB 2W83A 4REQB 3A3PA 1WQ4A 4Z4YA 1AGRA 2J9ZB 3OLQA 5AK0A 3DGFC 3QE3A 1MN6A 3CVVA 2CJWA 4WHMA 3DMGA 2PQMA 3RWOA 1FS6A 1Z6AA 3KV1A 3MB8A 3VR2D 5DM60 5AM2A 2AA3A 2HA2A 2AI1A 1L8LA 1P5HA 2JGIA 3IELA 1ZMRA 2BF4A 2O3UA 3GRAA 4I1YA 3UJ3X 4BP3A 3HBAA 5JXHA 4HO1X 4QU0A 5E7IA 2V3CC 3TOXA 3NRCA 5HXAA 4W5OA 5C4IA 3FF4A 3OCZA 3HVHA 2HSJA 1IG3A 1AK2A 2VHXA 4L1KA 4TT3A 5FH9A 1UC5B 1LCIA 8ADHA 1NRKA 2HJRA 1VPLA 2C7PA 1ZAKA 3J81k 1F1BA 3T5DA 2E1RA 2PBLA 1MC1A 2ZCVA 5K45A 3LY7A 2ZQ5A 1KU6A 3TO5A 4CMIA 2OHOA 2ONYA 4ZJYA 3TX6A 2YWGA 1FSSA 2FNAA 4F45A 2FW0A 1M2VB 1U1DA 1LQUA 1SUDA 2J1LA 4QVKA 3RF7A 2HREA 2SCUB 1T6ZA 4G5HA 4H0CA 4CM6A 2ECQA 3WTBA 4EVSA 3SQMA 4K3UA 4MJXA 1WKBA 4OXIA 2C8JA 4RFSA 5KO2A 3GFPA 3NJ8A 4QJIA 4Q4HB 1NW6A 1FC0A 1QB7A 1TLTA 1UK6A 4QVAA 2QYSA 3HFJA 4FHZA 4HNGA 1T25A 5DIZA 1QUFA 4DN6A 2H65A 4Z7OB 5K0JA 5J63A 1VIMA 3GLIE 2F17A 4KACA 5A5EA 3G71B 3W90A 1TAQA 4DIUA 5F7JA 1RLUA 1SBYA 2Y1OA 3L84A 3OIUA 4ENUA 1RZRD 2VF8A 1RI4A 4G25A 4OGGA 2BR4A 4C0XA 3EPKA 1QE0A 3SR0A 3B1WA 2YUIA 4YRBA 2HWXA 2VYFA 4W7HA 2R7MA 3IJRA 4Y0NA 2XB9A 3UW3A 1XD2B 1X39A 1TL7C 4KGDA 5CBPB 1ENOA 4R68A 4ZT4A 3S3TA 2R62A 3SC6A 1U2PA 3WK9A 5HZGA 1RM5A 3TMKA 5FOVA 3GLHB 3U7IA 2XTMA 4E31A 2ZRIA 4DKXA 5JPCA 4RA6A 1F0NA 5TQJA 1YUNA 4X6YA 2AUNA 1WD7A 5B1IA 2ZRBA 4D81A 1U7XA 1LTQA 3B1VA 4ONEA 2YFHA 4IH9A 2E4ZA 1NUTA 2AZ4A 3KEQA 2UXDB 2YXPX 2WUEA 5FHRA 5KTSA 5IMBA 3NE5B 2OGTA 3DDUA 2V59A 3KL4A 4CODB 1ZGGA 2ZUEA 1V7CA 3BD8A 2JLWA 3AESA 4MULA 1FX0B 1O58A 2QXTA 3IVRA 4TS3A 1NVWQ 3U4QA 5G41A 2R8ZA 1J2RA 2YVLA 3THYA 1TT7A 3OWOA 3H11B 4D8UA 2GPTA 1HG1A 1MO5A 3C3EA 4C5AA 2YOGA 3JRNA 4HQFA 1I2MA 3H04A 4LRYA 3T7AA 5LN1A 3FUTA 3OJXA 4E07A 2EZ8A 1NN1A 2JI8A 2ZTHA 1XEXB 1NNUA 1G5PA 1ZD3A 1ZRSA 2HRQA 3DCYA 3IAUA 3IUQA 4R1NA 1FTNA 1R10A 3HBFA 4LCJA 5EPUA 3PTAA 4PGMA 1EIZA 4PONA 3DUWA 3T1OA 2Y92A 4U7PB 1KDYA 1G16A 1P0PA 4UVHA 5AOVA 2BZ0A 4B4OA 3QU2A 1J42A 1G8YA 1PGQA 1PEKE 4JLPA 2XMDA 3IMEA 2GN6A 4WY8A 2FW7A 1KPGA 3U44B 3QWHA 4UNPA 4YP6A 3HNPA 2FX3A 5A7GA 3U3JA 2JAOA 2CB0A 4LTDA 3GZTB 4OHWA 4V0SA 4YJ3B 1XXLA 1B8OA 2B4YA 4RK4A 1RAIA 4FKMA 4YONB 1G8FA 1HLFA 3C7KA 3JAWB 4C2TA 3PNMA 4PBRA 3VSBA 1X80B 2NVUA 5ECDA 5LU9A 4M49A 1L4YA 1O95C 1YS7A 1XQ9A 4KE8A 2JF0A 3LQ2A 1R6UA 4MZDA 2EJWA 4AVYA 4B76A 4JIMA 4G0VA 4Y2JA 3W04A 3TD6A 1DQYA 3KWJA 2XB6A 4JITA 3PITA 1KDTA 2E1PA 3PJGA 3PNQA 3UMRA 3WLKX 4CMKA 2KB0A 1E3XA 1ZK2A 4YJFB 1A77A 4YJ3F 5DNEA 2PVPA 3MFYA 1XCOA 3P9RA 6ABPA 3T9EA 2O5VA 4Q0MA 1HYGA 2PZ8A 3THSA 4J7AA 4NJOA 4NPAA 2Q0SA 4O4JB 1TF5A 1U98A 2EIHA 4R2XA 4JBGA 3IMCA 4N5IX 1CHDA 1VI2A 2ZB2A 3L1JA 2F90A 2Q3HA 3L7IA 4IH4A 4BTVA 3PC4A 4IDHA 5IZ4A 5GIOE 1RTKA 3DYBA 2F8TA 2D54A 3OQMA 3JWEA 1EESA 1HL3A 5ENVA 4WZAB 3ONVA 4ZQCB 2YNMC 1PJ6A 1Z36A 4GF5A 4J8PA 3U3ZA 3HBMA 5CBKA 2X8KA 1YCFA 2DQSA 4G65A 1JHRA 3GGDA 2BJHA 2HO5A 3UANA 3DDHA 2G77B 4F5EA 3WLSA 3H9BA 1CB7A 4JVSB 3BJZA 3V6LA 1R6TA 4AFNA 5KYUB 1SKQA 1BCSA 5C9ZA 2QN2A 4MH0R 2CXRA 2ZIUB 1XIVA 1XTTA 1AB5A 1CUBA 4FHDA 1IK4A 2XJ9A 1DWUA 5PNTA 3OH8A 1B6RA 4GWGA 3DZJA 4ZQIA 2YWBA 2NN3C 1VBKA 3BE4A 4ER5A 1IFXA 3EVTA 3WMFA 4DLAA 4X07A 1ZN8A 2NO0A 3AP3A 1S8FA 4D9KA 5AVXA 3GU3A 4ZALA 4TV9A 2Y2VA 5EYPB 4KI7A 4BN4A 1BXGA 5ELMA 5LQAA 4QQFA 3N76A 1EH5A 3HCAA 1UZLA 1G4AE 2DBZA 3PEVA 2GO1A 4H18A 1OGJA 3K0CA 2DSTA 3TLBA 1G20B 2BKVA 4XA8A 4AUEA 1FW8A 1ESMA 3FCEA 3P45A 5BSUA 2IUSA 1OXVA 3WAJA 4FZ3A 2QYTA 3OW2B 1XELA 3LBNA 1ZM2A 4HAUA 3UV7A 4E14A 3FBWA 1ZXXA 4KQ6A 3SHTA 4X20B 3QNMA 3N0RA 1ENYA 4HRVA 1UH5A 2FVGA 1EBBA 4MUKA 1I51A 1H8ED 2DX7A 4BNTA 3LP6A 3Q3JB 1YIDA 3TNYA 4F72A 3LIIA 3WGOA 3R24A 3N2GA 4IIYA 5JY6A 4IG9A 5DBFA 4A0FA 1WP6A 5BMVF 1A3CA 3DE0X 3L1IA 2ORIA 3EEBA 3H9GA 3STVA 2RB5A 4F8EA 4JZYA 2AC2A 1JEDA 2DQ4A 1VQ7B 1W4ZA 3RUHA 4D8TA 4N3AA 5I9TA 1GKUB 1C3EA 4HR7A 2JASA 1JYFA 2PYIA 4URVR 1TYDE 3QG5A 1M54A 1XEFA 2JJYA 3GZNB 2H29A 1BPLA 3NAMA 3IMKA 4UVIA 5REQA 5C1PA 3KD2A 2O07A 1IWBB 4KJXA 2VQFB 4YRIA 1IJKA 1G9TA 3CHYA 4I4CA 3RVQA 5B4UA 2Z83A 5CYFA 3BOSA 2JLSA 1F6DA 1ODKA 4DLBA 1V4VA 2A57A 3HBNA 2VUTA 3CF4G 4G5SA 3ZOZA 4DDMA 2WFMA 2H1VA 4M8KA 1MX3A 1ISIA 2D7CA 3HSSA 1JQKA 2H2WA 3AIOA 3BH7A 4MW0A 4P4NA 4DABA 1ZGCA 1NW9B 1LDYA 1YC2A 2RJ3A 3DL4A 3ENNA 3JQRA 3L79A 3KQHA 1HR0B 3GA5A 3NYQA 3SHFA 5FPPA 3RAEC 4QXQA 1KIAA 2JAUA 2XUOA 1UCFA 5K3OA 1UP7A 1XZJA 3SBEA 1H4SA 1TAUA 2G07A 3O92A 3PT5A 4HEA1 2C2YA 3VTZA 1UXIA 1FNNA 4XNFA 1GPLA 4HP8A 2XWSA 3O2JA 4P8RA 4XLEA 1U2GC 2C07A 2QD1A 3WYGA 1KBOA 4W1SA 1AB6A 2JGFA 3NMUF 3D8TA 3D6AA 2AOTB 3F71A 1U3WA 2XUZA 3CZ4A 3QLJA 2WWVD 2JNWA 3O7MA 5I8ZA 4ND6A 4MDHA 2BONA 1ZW1A 3OAAD 3A1DA 4MNTA 3WYNA 2WNHA 2CD9A 3MNFA 4GFDA 1DP4A 4Y2PA 2CUNA 3ONWA 2HBZA 1SIUA 2ORWA 3IUSA 5ERXA 2EEPA 1W85A 3CISA 2JANA 4ILEA 4U7TB 4YRTA 1RRMA 4IY1A 3TQQA 4MVJM 3D64A 1I5EA 2FOXA 3EXIA 1R0SA 2PUWA 4IILA 2G82A 3G2NA 3SFTA 5BR1A 1Y7HA 2FPXA 1XQBA 3EGEA 3PHLA 5H82A 4DEYA 5B7NA 4DIDA 5JLJA 4KBFA 1GIAA 4OOEA 5EN4A 4A9AA 2EBFX 4BQFA 2A9QA 4OJKA 2JK1A 1MORA 1NIPA 4DM4A 2X0EA 1WCYA 4CV3A 4IRMA 3USCS 5JZBA 4F9GA 5ABPA 3KXDA 4OF4A 3FTPA 3RU9A 5EKDA 2ZTSA 4EQZA 4AUNA 1W581 2VSYA 2VYND 1KYVA 1YXMA 1JIQA 2FW9A 3W3AD 1Q14A 3U5ZB 3KPUA 1DARA 4XI9A 1KQ3A 3AKZA 4XGIA 3IOCA 3LY5A 4ENPA 2P65A 1L4FA 2Y4NA 1RBZA 2V6BA 1JXAA 1ESEA 1JJAA 4I4IA 4B0PA 1UKZA 1GDHA 1JNXX 5K4HA 4UNSA 5BSKA 1GA4A 3G7NA 1SOAA 5ALJA 3NHMA 4CCAA 3W4IA 1GPMA 3DT9A 2ZI4A 3NHZA 3UMCA 5J2TB 5K3FA 5AW8A 1Z68A 3O73A 4QQNA 5IULC 2FW8A 3GVLA 2QLBA 4FE3A 3GAZA 2MINB 1JHOA 1RWKA 2P91A 1DT5A 1BVUA 2QRVA 4PYOA 4XLAA 2HC9A 4NIMA 5ALYA 2R0QC 2DUWA 1ST3A 4OK3A 3CJTA 3DBOB 2Y4OA 3D6MA 1CJTC 3LM8A 5JRZA 2XSZD 1HVXA 2P3QA 4LE0A 5TY0A 2CXHA 2HIAA 4OSPA 5L7YA 5C4MA 3BZUA 1RXUA 2FJUA 4RL6A 1XC7A 4BO4A 2J9GA 1IOVA 2ZE6A 2DY0A 1LNZA 1LDNA 1B26A 4M9QA 5JBQA 3V34A 4N5DA 2ZG6A 5E2AA 3H97A 3FYSA 3SE0A 4JUFA 2NZ8A 5DLYA 5IAJA 3LYHA 4JHXA 4AP5A 1HO3A 1WDTA 1C8KA 3IIJA 2XCRB 3M1LA 4D1YA 3DYVA 1ZN2A 3OT1A 1II8B 1XZAA 4JP1A 1MEJA 2B1IA 1FXSA 1Y4SA 4YR7A 4KKSA 3N2NA 5DHFA 2V5VA 3E03A 5DSXA 3UYKA 3LHFA 5KNDD 5K8LA 4ZI7F 1K6JA 1SOVA 1KI7A 1SC9A 4QXOA 1BDMA 3DMTA 3PLNA 4UAGA 4DFDA 2HYIC 5E0OA 2X6WA 1KMHB 1D04A 1GGFA 2VZEA 3NHLA 3VC3A 1BDIA 1KYIA 1E5DA 2YRXA 2A4MA 1J1UA 3R5TA 1Z6ZA 3I30X 4URFA 3WL5A 1A72A 2F59A 5HZBA 2IZZA 1I14A 1V8PA 2Z5VA 3L6OO 4HSGA 1KH3A 1PJ7A 2R6GA 4Y1RB 3AU9A 4NAUA 5A4AA 2R8XA 2DHRA 4HWRA 3RT1A 3HQ4O 2QZPA 1IOZA 3NIBA 3OCXA 2LIVA 5B7GA 5JD6A 1GO2A 3VJMA 1LEHA 2D7JA 2IZ5A 5E95A 5AIBA 1GR0A 2QRLA 1N5DA 2HGZA 1VE5A 1SB8A 4MHOA 4R9VA 3BGIA 3E9ZA 4CZ2A 4JC0A 4KR2A 2JIBA 4K81B 4YRQA 5AVJA 2Q99A 1OXBB 1EFPA 2E4WA 4B4UA 1RHJA 2F9MA 3LH5A 1V45E 4XN0A 2FUG6 2P8SA 1PD1A 3MSXA 5JRJA 2QTVB 3CCCA 1C8BA 2QL9A 1DO8A 1ETUA 1VCIA 2HWUA 2J9RA 3IE2A 1RRKA 2F9FA 2NUAA 5LP6C 1C4XA 2DLDA 2QQFA 3EY4A 2PA0A 1R6VA 3EIWA 4MP6A 1KSJA 3W5DA 1XD8A 4RC9A 1KR2A 3OPXA 4KQ2A 1SCQA 3BX1A 2PV7A 5CFMA 4PGHA 3C8UA 5I7RA 4ZA2A 3GMSA 2CL6X 4PTLA 3RROA 5CR9A 2J45A 3WY9A 4OGFA 1PSWA 2R3SA 1AMOA 3I0ZA 2WKSA 4NFHA 4M9ZA 4RABA 1TU3A 4BUCA 1PJRA 2C3UA 1Y7IA 4L0DA 2CK3A 4BRSA 1LFAA 3ETDA 1H5UA 1R9NA 2XXBA 4NHOA 2G5CA 1RVDA 3TK1A 5IT4A 2H1SA 2I6FA 2W2PA 3H8JA 1DRUA 1IVYA 2EFYA 2ZRGA 3GC6A 4OEHA 4EYOA 3INRA 2H8GA 2BHLA 2RIRA 4HQKA 1UKCA 1HTWA 2EBHX 4AXXA 5DHAA 3WL4A 3HAGA 3Q39A 4DGSA 1T4MA 4CWAA 2RHLA 3KHKA 1P4SA 4F6RA 2EZ4A 4KR0A 1OX4B 3UM9A 1NQAO 4XOPA 4L5IA 3UMGA 2R1UA 3FGOA 1V5WA 2ANBA 4IIJB 1GZ7A 5L6LB 3HZZA 4J29A 4G5YA 4JBNA 3VR4A 2D7DA 4H1HA 3U3MA 3ZJVA 4BVKA 5AHRA 1ZAYA 4QE3A 1EB9A 3L7MA 1WUYA 3Q3HA 4UD6A 5EEGA 1VLJA 5HJEA 2RD2A 4KE7A 3KQSA 1EFHA 2PEZA 3Q38A 2D6FA 3PX3A 3SDSA 3VMMA 4JQCA 1FF9A 2NXWA 2WYHA 4IV5A 5IBQA 1NL3A 4M7RA 5CIWA 1JJVA 3HSKA 4E6EA 3MMNA 1Q7BA 2IPXA 3EQZA 2HCBA 2WYRA 3QBEA 4O2BB 4OHOA 2F9LA 4DCTA 4R71A 1YI2B 4BYGA 5E6RB 1P9NA 2FZKA 1QG2A 3HY3A 3L0YA 3TW8A 3PFHA 1RLTA 4N6NA 3UMJA 1UDWA 5KQLA 4Z6KA 3AUYA 1GFIA 1P81A 3ZVKA 2BOVA 4GR4A 1IAVA 3O8OA 1A1VA 3GX1A 3E3OA 4LOKA 2FN9A 3QMVA 3DNFA 4MWGA 1JT2A 3QXJA 1L5HB 4NPHA 4CF4A 3ASYA 3MPUA 4QDUA 4L72A 4QJBA 4IHQA 4UUMA 3HU1A 1LJ8A 5TMBA 3I3OA 3N6RA 4EHNA 1DSSG 3JWIA 1FU7A 3IQXA 4M3NA 4WZAE 2AN1A 4BC0A 1W0JD 1JU9A 4XM0A 2JHPA 2XOXA 4BQRA 3SS8A 5IW8A 3SQNA 2RGNC 2PK3A 2X4DA 4D02A 1CW2B 3R77A 4KI0A 1N8RD 3HV2A 2QSZA 3KK0A 1SUPA 3EWSA 1X86B 1TU4A 1C0KA 4I1UA 2EQBA 3GLHE 5TXGA 1WCV1 4I3FA 4JUCA 3C0KA 3SYLA 1EJ6A 3GBPA 4TZTA 1JWBB 3UKOA 5C1DA 2LZJA 4Z8YA 1K68A 3RSZA 3MTQA 1CZUA 2AG0A 5AI9A 1Z2EA 1J9ZA 2P1DA 1SGWA 1GNPA 4ZAFA 4YUAA 2WKWA 2ZAYA 1TYCA 2OBFA 1QANA 2P1RA 2CDAA 4GOLD 2Q7XA 3I01A 4M88A 4N5NA 4AU1A 3KQLA 3VZQA 4HSEA 1PAUA 2QUJA 2FDXA 4CM4B 3U9TA 2VN8A 4D4MA 3RYHB 4YRMA 4DDWA 5KOIA 4UJ5A 3UOGA 2VNKA 4FXPA 2AW3A 3A8KA 4IEFB 1NF9A 4L50A 2VQDA 2OYSA 3F49S 1JU4A 4G0OA 1JLKA 4G67A 1M2FA 4RVCA 3A4MA 2C2OA 2FW1A 2P41A 1NFFA 4V2IA 4N0DA 3JD2A 3PK0A 3C5HA 4BP8A 3TAUA 1U3UA 3QELB 2EWWA 3H5WA 4DHWA 1XP5A 2X6TA 3K96A 5CHEA 1QAMA 4MQ5A 4YBRA 5DGXA 5DLPA 1OYWA 3RBZA 1ZD2P 1IOWA 1EX6A 3H0CA 1X8LA 3I1FA 1P80A 4RHXA 1GQYA 1QRAA 4EPWA 4LFAB 2PAAA 4I66A 5DCUA 2H18A 4J7CA 3ZLJA 4I4TA 2WMDA 1BN7A 1B43A 1N8TA 1WM1A 3P7MA 4X7BA 4BZPA 1JA0A 1DBVO 4O0MA 5TQ0B 1OZ0A 3JVIA 4GLLA 1ZHFA 4MYHA 1HDGO 4XUCA 5JS6A 2IXFA 1KOFA 3KOWA 3Q3EA 1ZR4A 1UFKA 2H9YA 3OFJA 3L93A 3GVPA 2AG1A 4DUGD 3KOMA 5KEIA 2VXCA 3OE7A 3NIGB 5FTNA 4EG0A 4B09A 1AKRA 1WW8A 5KNCH 3QSGA 3N86A 5FBLB 2WHXA 2J32A 2ZR8A 3A6FA 2IP2A 4YJ2F 3BWCA 5ANRB 5EKXA 5H3CA 5BQ5A 1KE2A 1QTQA 3L8YA 3SC2B 1YIJB 2Z5GA 3TJZA 3ILSA 1XDGA 2GRUA 4CHTA 2I29A 3SEAA 4KIWA 1AKNA 2FY8A 2HFJA 2QSJA 2VT7A 1SOUA 5SZIA 2VT2A 4MYTA 3H16A 3TF5A 4KSYA 3VVCA 5F1KA 4ZK6A 2O8BB 1HF3A 1U9CA 1F3OA 4PY2A 1QRTA 5DI9A 3O38A 3WQRA 3HCRA 4F5ZA 3KNZA 3JW8A 4BY9E 2XBMA 3DBVO 1UK9A 2Q21A 2V9CA 3E23A 1UBEA 4DQDA 2DIEA 2IYEA 5J5VA 1RXEA 4H59A 3DJYA 1D4FA 3F6RA 1N8NA 4QOFA 1ZD8A 3WQHA 3NASA 5D7BA 4CUJA 1RM0A 4E0FA 4BV2A 4CIXA 4E6PA 3LAWA 1PJLA 4S0ZA 4W9NA 5IT0A 3FPCA 1GL3A 4ZOQI 1WSWA 2BC9A 4ZV9A 2LTAA 5HE9A 2UVDA 4NMHA 4HB2A 1AN0A 1NVXQ 3BVPA 3IEMA 2P75A 3L0ZA 5L51A 3NGLA 1I2BA 1PW5A 2OFFA 2GFIA 4N7BA 4NULA 4BX8A 4TQUS 4BU1A 1QIEA 1XTVA 2ZB8A 5CA1F 5IKPA 1Q1EA 4LPKA 4DJFC 1X92A 4G4SP 2CSUA 1TZCA 4RF2A 5LSAA 1IQPA 2J87A 5T4EA 1CRZA 3RS7A 1L7RA 3DXYA 1A9XB 3ZE0B 4HWOA 5KTYA 2Q4TA 4AJ2A 4Y18A 1UANA 3ZK9A 4NWIA 3A3YA 3RSGA 2B1JA 4QUEA 3KRTA 2WJAA 2C9CA 4S1OA 4KWEA 1X1EA 5I9MA 1T0IA 2VP5A 2PZGA 4QTTB 3TZLA 1G60A 2QTMA 2R1VB 2DC1A 4FYKA 5H9VA 2FUG1 3DKPA 3C4QA 4MI1A 4UTXA 2FEOA 3HCFA 5FBKA 1YJ8A 2OZVA 1K5GA 2GJAA 2G83A 4J9VA 1JEYB 1WB4A 4O8ZA 4Q3LA 4HZUB 1YLOA 1MAWA 1PR2A 4I1OA 1SCDA 4OSOA 3KG2A 2R5NA 4ZPJA 1P7VA 3AEKA 5LBUA 1WXFA 2NXEA 1F20A 4BVFA 5HJ7A 1WW2A 3QRWA 4HNAA 3KUUA 4EFMA 3C1AA 5CYOA 4H1TA 3HJHA 1PYOA 3CRNA 1K7FB 1BRTA 3CURA 3DL2A 3GA7A 4QBIA 4UEJA 4YXFA 4Q1VA 1R5BA 1CZNA 5CDFA 2O50A 4Q3NA 1NLUA 4LWQA 1KSHA 5I9SA 4Z4ZA 3ABSB 4KYUA 4NR0A 2OP1A 4KGVA 1EE2A 2P78A 1CRQA 1RJWA 3I2HA 3WWPA 1ZLXA 2W90A 4JJAA 3QEMA 4NV3A 3RH0A 1F8XA 1ZRHA 1GFZA 1PQ4A 3U7QA 4BNXA 1IXRC 1PP4A 3EFOB 5IZCA 2VYVA 3GMDA 5IEJA 1SNYA 4P2BA 1HV8A 2XGOA 3GWGA 3L4KA 1PNRA 2VDRB 3SZRA 3F8WA 4RHFA 2WOJA 4WA8A 4F9TA 4BE4A 5LYJB 3IKLA 1XFOA 1BHQ1 2V9PA 1PT5A 1CFJA 1BOOA 2AX4A 1CJCA 3GSIA 3ZZMA 4I1SA 4MQ6A 2JGKA 1KF0A 3QVVA 4UHHA 3P1JA 2Q8QA 5JG7A 1D9XA 4RPCA 3A28A 4KUHA 4R41A 1VSQA 3PUNA 3V7AA 3ETEA 4FFBA 2PX2A 1P2SA 1W5AA 4I55F 2B4RO 4TMYA 1GUAA 4NOLA 5DU2A 2QL7A 2IE0A 3OPVA 4IICA 1B00A 2W2XA 1VBMA 2VTBA 4F9EA 1HYHA 4BRUA 2QMOA 3VSDA 3EQ7A 1OFHA 4NNPA 1UAGA 2VJQA 1KI8A 2YIJA 5TQVA 3THXB 2CJXA 2J3EA 4LZOA 2BW0A 4MX8A 1NOIA 4WZ6A 2I87A 1K75A 2AWNA 2YZGA 2YBEA 1JBQA 1FZTA 1QWOA 2Q1UA 5BMVA 3TWOA 4W8OA 5WRFA 1BGVA 1ZA1A 2J09A 1BQ3A 2I76A 2HPHA 2PN1A 4U7GA 4X7MA 1O94D 3TUZC 1WCIB 3AM1A 2QA4B 1GCUA 3RIHA 1OROA 3BWEA 3F2VA 2HDWA 3BRSA 5A3QA 3FCOA 1SQ6A 1JAZA 1C1XA 2D5LA 3PNLA 3AZPA 4UM7A 5F21A 2W71A 3AGQA 3LT0A 1CUJA 1X9IA 3B1JA 4F3RA 2VNIA 2XYVA 1RD4A 2XUAA 2Y0DA 3TZHA 3G7UA 3G1UA 5JPIA 4G1BA 3DLCA 4BLRA 1CXZA 3LUHA 4YCLA 4FZRA 2H48A 3FVQA 3ASVA 3KS9A 3TE6A 4W1PA 3OZVA 4ZVQA 5A0TA 5K3CA 4PAAA 1L4HA 5IYWA 1L4MA 2AZMA 3FYUA 4TVOA 4ZT6A 3SSMA 1PK8A 3RRJA 4PLZA 1XZMA 2NVOA 4QARA 1OA0A 1PG5A 2PXCA 3NIDB 1E7SA 2WZCA 1EXWA 1F8FA 3FKSA 3KEGA 1TA4A 4FFNA 4PZ0A 2I03A 2RB4A 4BMZA 1RXSA 2VZ0A 1IB6A 2V9ZA 1UJ6A 3X1KA 5HNKA 2OFXA 4KFUA 2HR1A 3VR1A 3T1VA 4ETNA 3V8NA 5JJBA 1AKTA 3STTA 3UQZA 2BFDB 5C1OA 5IX8A 1Q7GA 3JWHA 3PR3A 4P4UA 2ZWMA 3ND8A 4B48A 1X7WA 1RQPA 3AWDA 3K2EA 4LI3X 1M1NA 3F5QA 4O4LA 4TM7A 5BQ3A 2F1JA 2ZJFA 3WLQA 2BMDA 4L15A 3LFHA 4COOA 1P4GA 2CCJA 2XZPA 4QA9A 1OJLA 3D6JA 4B3IA 3L7OA 4K9PA 1CKEA 1HMPA 5A6SA 1E3ZA 3V1LA 2XBUA 1YNOA 3NI2A 3WMGA 4ETWA 3I45A 3D7MA 4DR3B 3GQBB 4BQNA 2XHEA 1D09A 1N2OA 2XNKA 3FCXA 4YAOA 1RMTA 1W5FA 3C2QA 3OD1A 4IVQA 2VTEA 4J4HA 4PAQA 3VC7A 2YASA 3G8AA 3VR3D 4B9AA 4E2WA 2ZM6B 2CSXA 3TTWA 3ORSA 3OWHA 3DE6X 5JFOA 5EGSA 1N32B 2B8TA 4QOJA 2NV4A 3CC7B 3EDYA 1QV9A 1FDVA 3COZA 5DXJA 5IM4A 4C5BA 1Z2OX 1B8UA 2BWJA 3LFUA 2G9VA 3NBFA 2PU7A 5EESA 2A88A 3NM6B 1G8JA 2O2EA 4MICA 1SUFA 1PFGA 2QPTA 1H2WA 2JA1A 2GBLC 1KOJA 4KMRA 1G63A 4LC9A 3ENZA 3FNHA 4AKSA 1GADO 4B0OA 4M8LA 3FDZA 3FKJA 1HPLA 4TRRA 4ACBA 3CNBA 1V43A 2FG5A 3KTFA 4IS2A 2QRZA 5LOVA 5B37A 3D3KA 3S2SA 1F0PA 2PT9A 3C3PA 1DZ3A 1ZVQA 4CPDA 3R8XA 3QU7A 2REQB 1X7DA 3U7EB 1PT6A 3O90A 4J76A 1DDGA 1RPAA 2P11A 3U6BA 2A0KA 4P2NA 1LDBA 2A7XA 2ZDQA 4JT9A 1P39A 1ZZGA 5L45A 1I9CA 4ZREA 3TZBA 4I5EA 4NYMQ 4QSHA 4MUMA 3ZK7A 4NXNB 4NY1A 4TLCA 1NBMA 2QROA 1H22A 2R4QA 3K4PA 2C92A 3CUEF 4GOMD 3A1UA 3GAFA 4ARAA 1WAMA 4IYJA 1NQOA 2W2KA 1OE0A 4H1VA 3RYIB 4BFUA 5K09A 3S8MA 2OTCA 3FWPA 5TMEA 3WWDA 3I28A 4QUAA 3WL3A 1JWAB 4PAWA 2NXNA 2ADFA 2GCOA 2V0NA 5JD4A 1PWHA 3OPOA 3IIMA 1RCTE 1CQWA 3G13A 3OMWA 3QWBA 1JDTA 3P0JA 2VBSA 2FPWA 3RJ5A 3Q8LA 1GPJA 1V8ZA 4E4YA 1GXSB 2BFFB 4OQZA 4UDOA 1RQNA 1N9ZA 3ZQUA 4WFIA 1WSRA 4X6LA 1M0WA 4WKBA 4CHGA 1LI4A 1TQ6A 2WUWE 3DCJA 2PNJA 1YL6A 1BEEA 3HLYA 3DFFA 1N2CA 3WYDA 4YP0A 4P4SA 4W1RA 2ZJ4A 1YWGO 1DGQA 1EWTA 3ECAA 4Q1DA 4CIWA 4G4IA 1XE3A 2AOVA 2SKCA 2QRMA 3X43A 2C9DA 1AF7A 1DQNA 2M1XA 3CUTA 5ER6A 1JAYA 4YWJA 4YV2A 4NI5A 4Q05A 1LWOA 4YQEA 1N57A 3ZZ1A 3WJ7A 4G1UC 3B9PA 2C4HA 5T3YA 3NX4A 1FVHA 2E49A 4LRXA 4HN9A 3HR4A 5FWYB 2ZOSA 4K3VA 4X61A 1U3CA 3ZBQA 3FPHA 3H1AA 4ZOLF 2H11A 2ZSKA 4S35A 1WV0A 3EX7C 1QVAA 2BR5A 2VFAA 5DLEA 2B9VA 3RTEA 1C9JA 4G7XA 4MDEA 4UBKA 1R15A 2H06A 3TLKA 5JFTA 4TZ6A 1ZD4A 3QHPA 1I9GA 1DJNA 1K6IA 5IEBA 1NC1A 1W88B 4F5DA 4NJMB 4BGDA 3OSZA 5HUJA 2GF9A 4WESA 3COPA 4FMCF 4ZQGA 3RIMA 1K4YA 1LI7A 3DOEA 4LXYA 5CGZA 2A9VA 1E94E 5LD2B 3GJ7A 1IHMA 5EXDA 1X1DA 4KAXA 3TD2A 4U63A 3VI4B 2JAPA 1QH9A 4XRGA 2CHGA 3CZRA 1Z4PX 1MXFA 1R0RE 5DM1A 4IDAA 4R51A 3NAGA 3MMXA 3T9BA 3QVJA 4C4PA 1ADYA 1H85A 4X1IB 3K2QA 3MBKA 2B7LA 3TKLA 3W34A 4DG5A 3Q8MA 1TMGE 1TCBA 2BEWA 4ZOAA 2A8YA 1ACMA 1U4NA 1EFUA 1FYVA 1K63A 2ZS7A 2BDTA 3OSUA 4H6PA 4JL6A 1F51E 4W4TA 5ALDA 5LCXA 5EJAA 2ID4A 5TGZA 1ESCA 2F1OA 3AOEA 2FWJA 4NONA 1TUEA 3J7AC 1MJGA 3TLZA 1SCUB 3LI2A 1XPJA 3WV4A 2X58A 3LX5A 2ANCA 3DOFA 4EQ6B 3AI3A 3NQ41 4YYZA 4M46A 3LYAA 2BAGA 5EXTA 3WRYC 4RYLA 1BHJA 2YW2A 3GRVA 2WHPB 5J4HA 1OHHD 2CCGA 2FN3A 2VWQA 3T5GA 4Z4TA 3TLGA 4EKDA 3DO5A 1PZXA 2ZIXB 3PZBA 5CTJA 2OBBA 4XD7A 3F46A 1N2GA 2HPAA 1U2DA 4C4AA 2VRCA 2FR8A 2YVUA 1RJEA 3OF5A 2GYWA 1R4MB 5AW1A 2D00A 4MLDA 4PX9A 4JV5B 1UXGA 4OAOA 1CVIA 4OJMX 4BLTA 4AAYA 5KSZA 2XIJA 3CMAB 2LE0A 3ONFA 1WETA 3H2ZA 3ZLUA 3V76A 2DT5A 2HB6A 2COKA 3ZV4A 1EG2A 1U0LA 1N1MA 4Q4LA 4AZ0B 4BVHA 4DR1B 1HLPA 5LDGA 4PN3A 2MIIA 4M0EA 5I7EA 4DL9A 2PL3A 3E1YE 1F6WA 2LZ0A 3OZSA 1KYYA 3NATA 5DSTA 5AYVA 2HRDA 2CMGA 2Q2WA 3I34X 3VR6D 4RVNA 4BJ3A 4M8SA 4ARSA 4QLBA 4I55A 2QRQA 2HQOA 2YVQA 4RPIA 3UGQA 5EEHA 3QVWA 4XDZA 2ZCJA 3M8KA 2VDPB 2HMYB 1QHXA 4XWGA 3FOZA 3U4DA 4X94A 3IP9A 4KNVA 1QGDA 3HJAA 2CL0X 2YYZA 3T0IA 3ROFA 4BP1A 2JKVA 2OM2A 4DMFA 3ZWXA 2ZUDA 4N6GA 3LX6A 4NP6A 5GM2A 4BMSA 3TOSA 4B2YA 1JFFB 3AW9A 3N7AA 4G4SO 4CF5A 3UG6A 2O8DA 4G0UA 1P2UA 1XRMA 4CV0A 2JA2A 2DT8A 4A6DA 1C9MA 3JZIA 4MCJA 2A86A 3X1YA 1YOVA 2L82A 4PS0A 5JO0A 3GCWA 4QOEA 2XW6A 2YDXA 3PFWO 4NJMA 4IMJB 3CNEA 3B2EA 2BGMA 4X91A 4BN5A 3BZBA 3WFIA 1V39A 4E46A 1ABEA 1QO9A 4JYCA 3S1AA 4FDMA 4JCCA 1CUCA 1HWYA 4DDHA 4XFKA 1Q21A 5JARA 2NVBA 3CFYA 5DM4A 3A6ZA 4RDHA 4XIFA 4PXAA 3RFCA 4IQFA 4GLJA 2CMKA 2F1LA 1Z07A 1CLEA 3K09A 3C16C 5GJVC 3OQOA 1J22A 1MO3A 3B60A 3C39A 3BE6A 4FU0A 4OQMA 1SPXA 4BHTA 1IZ7A 5IJZA 1CRLA 1PD0A 3C6XA 3PIRA 3HTXA 4UUOA 1NI3A 2AEEA 3M89A 3HEMA 4C4XA 4AP6A 1FDOA 1SBTA 4GBED 4AQ7A 1YK1A 1CUAA 2P4UA 1UXJA 2X6XA 1ANKA 2Y1GA 1OI2A 1ENZA 2IYLD 3G59A 3NOXA 2AMFA 2NQ8A 4M76B 4TTSA 4E33A 3HVUA 4XOUA 1T9CA 2Z9DA 4HDCA 5MHTA 1SCIA 1PF7E 1N4AA 2QVLA 4HAXA 5U4XA 2EJBA 3EF3A 4U9UA 1L8AA 4Y3UA 4D8XA 1N2CB 4KPGA 1UWLA 3BT7A 3ZW8A 1LPSA 1R0CA 2FSPA 2BZSA 4G23A 3H6HA 5GOZA 4EPVA 1ECFA 3RS0A 2WTBA 3IQIX 1R88A 3H2HA 4PZZA 4OI2A 1FP1D 4NNOA 3ZX4A 3T95A 1DO0A 2XUGA 5KQGA 3ERCA 5F64A 4IS3A 4NS1A 4WKNA 4ZVOA 4EK9A 2GN4A 2E89A 1L3IA 4NE9A 4GPBA 3ESAA 4KW7A 4OVKA 2AEFA 3VKGA 1N05A 3EWAA 4FNAA 4TMXA 2QEXB 3CKYA 2H0QA 4N9QA 4BE9A 2YFQA 3M6WA 4FHEA 3BXXA 2FWBA 3NKVA 3R3HA 3HGTA 2X5NA 5CFQA 2IZ1A 2MSWA 2XXJA 2VNAA 3FYUB 1CG6A 1VSTA 2J0VA 1WNFA 1MA3A 2YZMA 1FFEA 2JRLA 2P7HA 1QVVA 2ZSJA 3OOEA 5ESXA 5HIIA 3GJ5A 5BN4B 2QE7A 2B8WA 2R6R1 4BUJA 1QGOA 3LZDA 4MVCA 4ZO6A 1YZQA 4IEIA 3OLXA 3FI9A 4FQ5A 4YI3A 3SSAA 1N08A 2YC4C 3BTVA 3NUZA 3SZUA 5IDWA 1FYEA 3ILXA 3WJAA 3M6UA 3QF4A 3T41A 1C1XB 3IMGA 3AEXA 1JPVA 3MT7A 4DAEA 4EG8A 2OYRA 2FZEA 4DEXA 4ARUA 2JVJA 1VIVA 5F1OA 1T4DA 3IUBA 2ACWA 2Q0QA 2ZJ0A 2H7CA 5JAHA 4L73A 3EIOA 3PXEA 1QE3A 4HH0A 4EJSC 5L6MB 1ADFA 1NVFA 1LJUA 1J24A 1P7PA 2MSLA 2PGIA 2RG7A 2ETXA 4NYIQ 4WV3A 5D85A 5FA8A 1FTSA 2FPMA 3L06A 4JUBA 1W4BA 1JEAA 2C5LA 2IDKA 4XZ3A 4E51A 1M7GA 2FWMX 3AP2A 3T0GA 2QVYX 3BRQA 4HE5A 3F9RA 4OREX 4C01A 3WGNA 4L9RA 4R2JA 1I0LA 1L8XA 1DG1G 1GVHA 2EX1A 1CT9A 3ID6C 4XR4A 2HLDA 2JBHA 2VP0A 2YYSA 3AI2A 3P94A 4Y6RA 4XLFA 1VHOA 2DECA 4UMFA 4TKOB 3WRVA 721PA 3ZNQA 1CQJA 3E5HA 5I8PA 3AW8A 1BO6A 1TX4B 2BBWA 1NXQA 1DFGA 4IDCA 2NP7A 3QVXA 1FFCA 4NHEA 2YZ2A 2ZYGA 2EBWA 3ETHA 4RX1A 3G05A 1B41A 1UEJA 1IATA 1Q6YA 2OCPA 4BV8A 4D9CA 4HTAA 3L8FA 3NTLA 3VR5A 4Q4JA 3CPSA 1CDZA 3IUMA 4Y2QA 1VI5A 1W9HA 3K15A 4IIVA 4YEDA 2NAPA 5CIYA 3R5XA 5HX7A 1NW5A 4FILA 4MWBA 4OB8A