1CBUA

Adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase (cobu) from salmonella typhimurium
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
180
structure length
180
Chain Sequence
MILVTGGARSGKSRHAEALIGDAPQVLYIATSQILDDEMAARIQHHKDGRPAHWRTAECWRHLDTLITADLAPDDAILLECITTMVTNLLFALGGENDPEQWDYAAMERAIDDEIQILIAACQRCPAKVVLVTNEVGMGIVPENRLARHFRDIAGRVNQRLAAAADEVWLVVSGIGVKIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENOSYLCOBINAMIDE KINASE/ADENOSYLCOBINAMIDE PHOSPHATE GUANY
publication title Three-dimensional structure of adenosylcobinamide kinase/adenosylcobinamide phosphate guanylyltransferase from Salmonella typhimurium determined to 2.3 A resolution,.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Cobalamin biosynthesis
total genus 55
structure length 180
sequence length 180
chains with identical sequence B, C
ec nomenclature ec 2.7.1.156: Adenosylcobinamide kinase.
pdb deposition date 1998-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02283 CobU Cobinamide kinase / cobinamide phosphate guanyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cbuA00
1DAHA 1W48A 1CJMA 1DVRA 2QRNA 1AS2A 3B9PA 5L3VA 4JL8A 3GD7A 2YYZA 1HV8A 1JAIA 2ATXA 1T8TA 4DCUA 3EXAA 3CH5A 2IYZA 1OXUA 3QXCA 3PUWA 1YR8A 3VR4A 2PLRA 1HYQA 1SQ5A 3F0TA 5DISB 2V55B 1J8YF 1DAKA 4Q9HA 4X8MA 4IEIA 1KK2A 3ZD7A 3GJ8A 3GLHA 4NCNA 4OQLA 2NIPA 4RFSA 3MJRA 5HCNA 2BBTA 4JLVA 3WP1B 3CKLA 4LBVA 1RRGA 2A5YB 1M7BA 2OBLA 2PL3A 4OQMA 1JB1A 4BFUA 3DPUA 5CIWA 2J5XA 4AYXA 3LDAA 1ETUA 2EFHB 4UNSA 1KDOA 2J0VA 1GRNA 1XXHA 3CRVA 4PPNA 2YVUA 4LJ9A 3TAUA 3RABA 2C96A 3GP8A 4L8GA 2O8DA 1G64A 2FEOA 3UMRA 4ARZB 3NHBA 3AVPA 4B3DA 2W6ID 3S1AB 3KQNA 1GTVA 3EW9A 4Q9IA 3VKWA 2ZUDA 2A5JA 5BYJA 1LW7A 1QHXA 2EFGA 1N3BA 2RHDA 2OCAA 1KKLA 2EQBA 3BB3A 3HJNA 3QNUA 3Q8XB 2CE2X 3QKUA 1LVGA 4BLRA 3LFUA 3VQTA 1R0YA 3QBTA 3PUYA 4AKGA 4KVGA 4OK5A 2FV8A 1W49A 5EE5B 1OB5A 1YZLA 3AEZA 5EUQB 1FW6A 5SZIA 4DSUA 3OZXA 1P5ZB 1TL7C 1YZNA 1ZP6A 2QSZA 2G1KA 1Q3TA 2VHJA 3PFIA 5A0FA 5SZHB 3RLFA 2GKSA 3KB1A 1H8HD 2YC4C 3EA0A 3RS5A 3BERA 1JR3D 3P20A 1ZCBA 4FD2A 3W6OA 1QHIA 2VH5R 4Z51A 6Q21A 4GZLA 4OI2A 5JI2E 3IQXA 2GEUA 1G3RA 3DZDA 4KO8A 3N2IA 4Q21A 3PQCA 4BFZA 4HUQB 2AK2A 1KSJA 4D2IA 3VKHA 2G0NA 3T1VA 1JAHA 3ZS8A 2VF8A 2WWYA 3U7HB 2G77B 3GLIB 2RHMA 1ZC3A 4GOXA 1G8FA 2GAOA 4RD3A 4WXRA 3ZIAA 1N0WA 1YRAA 3TSWA 4LHXA 4YDHB 3ADBA 4YONB 3E70C 1FMLA 2JJ8A 2ZVPX 4LYJA 4QOSA 2GBLA 5AWFC 2VF7A 2GZHA 3W6PA 1X1RA 2QORA 2REBA 1V43A 3CF0A 3A6PC 2OCYC 1RW4A 1TUEA 3AUYA 3K0CA 3L43A 2Q3FA 3EIQA 5SZJA 4LRWA 1Z08A 4QKQA 1T3HA 2JLZA 2FSFA 2C8VA 1OH8A 2EWWA 1G3QA 3LO5A 5FBRB 3GLHB 4YXWD 1Z0JA 1HURA 1Z8FA 3BFKA 1QHNA 4QHTA 2EVWX 4TMTA 4TQAA 2MMGA 2ZJ8A 4YMUA 3MWJA 3LW8A 1XEXB 2QY9A 1H65A 5FBVB 4H1VA 4M22A 2HLDA 5FI1B 5M04A 4Z1MD 1UBGA 2EU8A 3KQHA 3C41J 1NN1A 2FOLA 4BGDA 2VL7A 3FGNA 5CITA 3UMSA 2YZ2A 1OJLA 4DCVA 1O3YA 3SJAA 1FFHA 2DWOA 5E7JA 3AUXA 4P3YA 1OLOA 3MSXA 2W6JA 2DFTA 1GVNB 4Q02A 3LVRE 2QA5A 3KUDA 4I1UA 4YMVA 4GT1A 4JLBA 5BN4A 2JLQA 2OUKA 4B3CA 2XTMA 3R9IA 2E1RA 3GFTA 1N6IA 4ZV4A 4HLDA 2RGAA 3ZS9A 4LHZA 1LF5A 4MGKR 3KXKA 1VDZA 2F6RA 2AK3A 4HB3A 1G9XA 4CIDA 3LQQA 1XU4A 3V4FA 4CVNA 5H1YA 5TVKA 2J0UB 1Z6XA 3SJBA 4II7A 2B6HA 2FN4A 1M7GA 2QQEA 2ZS7A 3EZ7A 2OE2A 4MRVA 1QHYA 3LA6A 2OCBA 5KO2A 2FPMA 3BC1A 3RRZA 1DAMA 3PG5A 3Q72A 4M9ZA 2F1HA 2ZE7A 4Q66C 2GVZC 4RZ2A 3KQUA 3UMFA 4RD6A 1E2QA 2H17A 1FNMA 1XTIA 1NLZA 4FIDA 3AF0A 2ERYA 1UBCA 4EQ6A 2NO6A 2R6CA 2GJ8A 1E1QA 2WMNB 2IYTA 4K81B 1A1VA 4ESVA 3NBZC 821PA 3AVQA 1GRRA 1LNZA 5C18A 1G3UA 2C9CA 5CYOA 5FUXA 1RYHA 2OV2A 5HCIA 1GZSA 4MKGA 4ASUD 3EZFA 4Z54A 3UWKA 1VMAA 5CK4A 3VR1A 2HUPA 1EXMA 4KJZA 4QNRA 2PBRA 1VYUA 2ZRHA 5G3YA 3L8ZA 4WZAE 2BWJA 5JJIA 4ZIRB 1JXMA 4AKEA 4M9SA 5FPYA 1D9XA 3IIJA 1QHHA 2P2LA 2JEOA 5F9FA 1QHSA 2XSZD 2EFDB 1Q22A 1BYUA 3TUJC 3TRFA 2JDIA 1AA9A 1F6BA 3SYLA 3I5XA 2UVQA 3KKOA 3PUVA 4IFEA 1VCIA 2VTKA 2W2XA 2ZRIA 5J4KA 1G19A 3UG6A 721PA 1WMSA 4E09A 2EWVA 3LNCA 3I1FA 4P33A 3S1AA 4DBLC 3GJXC 4KU4A 2GXQA 1DG3A 1E2KA 1RRCA 4US2R 3BXZA 3CRRA 3L82B 2ZSAA 3KJHA 1ZNXA 4U00A 3CM0A 2LKCA 1WXQA 3EIHA 2QSYA 5DH9A 4A0RA 2IYUA 4IHQA 5FUVA 1Q1EA 4PC7A 2OFOA 4Q1BA 4DJTA 1FQKA 1U98A 1SVSA 3B1ZA 5IHPA 2J7PD 2W0MA 5JCZA 3RS0A 1JPJA 2MSCB 3SFZA 5AJYA 5E3HA 2AR7A 2F1RA 2IK8A 3ZDQA 1SVIA 3FMFA 2ZANA 4DLVA 2KWIA 4KBFA 1W4AA 1DEKA 1TU3A 3CWQA 4LPSA 4HAYA 5EXTA 5K8UA 4YLGA 5F3WB 2R6DA 1NVVR 3AF4A 4TYQA 5FBWB 4LBZA 3B78A 4BLQA 4HUQA 1TEVA 2RMKA 1WB9A 1P9RA 3ND8A 2VQSA 3AKEA 4V02A 4RCZA 3TQFA 5KNBA 4LV8B 2ZAOA 1COWA 3KFXA 4MKHA 2RGBA 1RRPA 1G7RA 2FFAA 1GWNA 2QMEA 4RKEA 2VHCA 1KI7A 4ZI2A 2J1LA 4QM7A 1UEIA 4LYAA 2EFEB 1GUAA 4MGIR 1R0ZA 2B92A 3BH0A 3GJ0A 4GSYA 2UKDA 4LV6A 4F91B 4C2TA 3A1SA 4JL5A 1CP2A 5JFGA 3WYFA 2ZRFA 4AKHA 4D0LB 2F43B 4TLDA 2BBOA 2GBLC 2OESA 2IUUA 2JLVA 2HXSA 1Z0FA 2C03A 2FSHA 2QMOA 4DLXA 1NY5A 1NVXQ 1LFDB 2QL6A 5FTNA 2A30A 4TL8A 3TW8B 2PJZA 4JVNA 1J8MF 2VP4A 2VA8A 5KSPA 4BFWA 4M21A 3FKSA 1Z6AA 2CK3A 4PAOA 2F9LA 3AVUA 2WWFA 2ASEA 2WICA 2XJ9A 1KI8A 3A1VA 3EZ2A 3LX8A 5IF9A 4HDCA 4PSAA 4R2HA 2V1XA 2QQ0A 1W0KA 1ZUNB 4RZUA 3ZQ6A 2ZSDA 5KTYA 1X8LA 2ECKA 4RSGA 1N6PA 1Q1BA 1U94A 3SN6A 1CS4C 5IDVA 1NNEA 1XTKA 1E3MA 1MRSA 2ZROA 4PHTA 3AQ4A 4CDGA 1Z0KA 2FMXA 1DTSA 4N0EA 1OH5A 3EZ6A 4BLTA 4QG7A 2WJVA 2OXCA 3A4MA 4A0HA 3QY0A 2ZQ5A 3MWYW 3C5CA 1EWQA 1G6HA 2CL7X 1ZJ6A 3AF2A 1E2GA 3MWLA 1OSNA 1PLLA 4KLZA 3RS2A 3R7WB 2IUSA 1X86B 1DADA 3R8CA 4C0QC 2PZGA 2ZYVX 2ODNA 1CBUA 3K0FA 4TQ9A 4WBSA 2D7DA 2GESA 2O8BB 1BKDR 1A2KC 2D62A 4QGHA 5C46F 4G5SA 5IK2D 1OH7A 1W5TA 4HLUA 1TAGA 4W5WA 2OG2A 3TLXA 1PUJA 1GNQA 4P32A 2VP9A 4TTQA 1G18A 2A9KA 2F43A 2LWIA 4TYWA 4R71A 4IKEA 3DEFA 3B1YA 4B35A 2J9RA 5G53C 4K8OA 2TMKA 2WSSD 4QL3A 2IS6A 1NKSA 1M6NA 3CZQA 3SZRA 2GXSA 3RC3A 1E79A 1KAGA 3KJEA 4TLBA 2B7BA 4AD8A 2GK7A 3TGPA 1U8YA 4IJMA 3MAAC 4A2PA 5TXGA 2V3CC 5EP2A 3THOA 1NIJA 2RGXA 2X1VA 4MRRA 4LJ7A 2XB2A 3K70B 3TQCA 1AZTA 5EQTA 1QVRA 4DDTA 3GEIA 1Q3HA 1XZQA 1P61B 2J87A 3HR8A 4HYYA 2HCBA 1BMFD 1UEJA 3B60A 4DZZA 2I3BA 1P4SA 2V6JA 3TVTA 4GDFA 3G0HA 2ANCA 1Q1ZA 4NTZA 4IOLA 5JI3E 1XF9A 4M9QA 1X8JA 2W6IA 2HCJB 4POAA 1QF9A 1Z06A 4Q9KA 1GKYA 1IJEA 3CNNA 4ZKEA 1NIPA 1RE0A 4ACAA 4KBGA 2BOVA 4XWAA 1YJ5A 2QMUA 2XB4A 1GILA 1XTSA 1XD8A 5KSOA 1XJ0A 1NKTA 2O0KA 3SNHA 4FN5A 1U99A 4Y0AA 2XZOA 1OB2A 4IXMA 4B75A 2DYKA 3B1XA 4JYBA 2QTHA 5FPTA 5CDFA 3GJ7A 1G41A 3CRW1 3WP0A 3GLGA 2C78A 5G40A 5EP1A 3RSLA 3TAHA 4WZ6A 1M1YE 1WBBA 2QROA 1KK1A 3UKDA 1G3IA 3UWOA 3NWJA 1IN5A 3C8UA 4Q4AB 5GVRA 3LVQE 3TUZC 2IS4A 1E0SA 4LHVA 2ZJYA 2ZRAA 1XB2A 1YZTA 2ZU6A 1YVDA 1XTQA 3NBXX 3RWOA 2OT3B 1N0VC 5HZHA 2D3WA 4FMDF 4GRAA 4XTRA 3WBKA 3ZIAD 4NMMA 2PJRA 2OEPA 2C99A 2Z5FA 1QHGA 1K5GA 3OESA 4LV5B 4ON9A 4DLYA 1OT3A 4OJKA 3TR5A 1SKYE 3ZVMA 3ICQB 2CE7A 2BC9A 2XTZA 2B8TA 3QG1A 4FW9A 1KNXA 4ZCIA 3HPQA 3KJIA 1ZNYA 1RC8A 1D2NA 3FYHA 4EPRA 4G5RA 1G5PA 4LGMA 4PSVA 3NBFA 2GJSA 3DVLA 2ZYWX 2G9NA 2P67A 1HY3A 3KTAA 4XVRA 3T1TA 1OKKD 1BOFA 3K1JA 4BZPA 5H70A 4AKIA 2CEAA 1Z3IX 4TMXA 2IYWA 2ZETA 3WMGA 3C16C 3IBYA 121PA 1XP8A 4C30A 4PO8A 4A4DA 3RYTC 1OXVA 2BM0A 3LLMA 4MKIA 1N5JA 1RVDA 3MUFA 3LY5A 3T1OA 2QM7A 2QZ4A 4BWYA 3BH6A 4PZZA 4JLKA 3U3JA 5KU1A 3GLFE 2WWXA 1VTKA 4MH0R 4NCJA 3VU9B 4A36A 2QAGB 4OHYA 2O52A 2JATA 4NYIR 3RS7A 4HB2A 3VNUA 2ZJOA 3MJHA 3N2EA 1NBMA 4EFNA 1GKIA 3K8YA 2IX3A 3RAPR 2IEYA 3SQWA 4KI0A 1OIWA 2REOA 3CR7A 5JS7A 3RHFA 5DI3A 4DHEA 4Q7JB 1SKQA 2EYQA 3GLGE 4DLSA 2NO9A 2HJGA 4M9XA 2D2EA 1TQ2A 1EFCA 5HZKA 1M8PA 2RGDA 3PVSA 2PH1A 4ZO4A 4JKIA 5DIFA 2CXXA 2PEZA 3AB3A 3NC0C 3I92A 2W0SA 4NL4H 4JKYA 4BRUA 4OI1A 1TF2A 2J59A 1GL9B 1L4YA 4A92A 1W2GA 1YU9A 5E7MA 3K0CC 1WP9A 1XWIA 2K5UA 2QI9C 2QGNA 3BB1A 3ECCA 5DHFA 5KDDA 2XXAB 3MD0A 3B7GA 3B1WA 5GADl 2WOJA 1DO0A 1LF0A 4DLUA 1II8A 3BE4A 3HU1A 1NVVQ 4IOKA 1EWRA 3FMIA 4FMCB 4NONA 4TSFA 3K0AB 3FHOA 4B76A 2RGNC 3WYGA 5DE3A 2X2EA 2YINC 4JZKA 3PEWA 1IJFA 5JEEA 1E0AA 4OQXA 2W2VA 4C0LA 4MDEA 1G291 4G5QA 1X8KA 1BIFA 1MOZA 4D6PA 4EIWA 4EFMA 3QPWA 4TL9A 3W3ZB 2XJ4A 3PCRB 4A1FA 5EXPA 4XJXA 1S2MA 4FWTA 1GDDA 2ZI7A 4M4SA 1WCV1 4ILEA 2Z43A 4EFLA 2IYSA 1ZVQA 3CO5A 3U6BA 5DN6A 4FCVA 3T06B 4V0NA 1EG7A 1XCMA 2Q21A 2QT0A 1ZM4A 1T6NA 2YHSA 3A1UA 4V0MA 3VU9A 2R2AA 2AKYA 3IGFA 4Q1DA 1TUIA 2PMDA 4RZ3A 1W4BA 1E9AA 5CK5A 2DWPA 3L0SA 3VR6A 2WPDD 2OZEA 3P4XA 4Z1MA 4P4SB 5JRJA 4QBFA 3LAWA 1WBDA 2J0SA 2CJWB 4OHZA 4UKDA 2FG5A 1AN0A 1MH1A 3B8HA 2ZUCA 1CJVC 2H57A 2JLRA 2VYFA 5J47A 2BM1A 4B2IA 4I1SA 2O0HA 4JBWA 4C0JA 1CXZA 4HI0E 1U8ZA 4MKFA 2QM8A 1E2MA 5TY0A 5FR1A 3FVQA 3OE7A 3UPUA 3OEEA 4PTLA 5KUTA 5K8IA 4CGZA 1OV4A 3LQRA 4LJ6A 3EPLA 3EAQA 2X77A 2GJ9A 3O47A 4NP6A 1PLKA 1Y63A 4PQYA 2VEDA 3NG1A 1K8RA 5LD2B 3A4LA 4HEJA 1I2MA 3QKRA 3EARA 1S0UA 1E79D 1FUUA 2VO1A 4C0KA 3GJ5A 3L8YA 3IPXA 521PA 3WY9A 3KKNA 2AKAB 4L15A 4HUTA 1FNNA 3QEOA 3IIMA 1ZUIA 1T5LA 2NOAA 2H8KA 2WV9A 4A0GA 1YRBA 1ZM7A 2AHOA 1D2MA 3KX2A 1LY1A 2QENA 1HQYE 3NXSA 4FCTA 2B21A 1NRJB 4S35A 5FPKA 3TIFA 4JLNA 1SVOA 4JVMA 1DO2A 4NCHA 5H8WA 1OXSC 3SQXA 3ADKA 1Z29A 2R8RA 3C15C 4IFBA 3ZZTA 5TARA 4B3GA 3GLFA 3SBDA 2VP6A 1E0JA 1G4AE 3MG9A 2NO7A 3VNVA 2P65A 4ITRC 2WKPA 3GPLA 2BV3A 4DEYA 4FCWA 2H5EA 4LPKA 3RANA 3TMKA 4D81A 2O8CB 4Q4JA 2YWEA 4FMCF 1S1CA 2ATVA 4YDSA 4PFSA 2FDCA 5FL7A 3CW2A 3LBHA 4OK3A 2JDID 1R5BA 2FGJA 3M4YA 4ZCLA 3WNDA 2VHTA 5TB5A 2IT1A 3FWYA 3QF7A 1T0HB 2ZR9A 2GJAA 2ZYUX 3M0EA 4DWJA 1MR3F 1NG1A 3CWZA 3H86A 2IHYA 5HPYB 3V4RA 4HLCA 2FF7A 4RKFA 1P73A 3X1DA 4BFYA 5JSZA 4TWZA 3TR0A 1JPNA 2FX3A 4IXNA 4EPWA 2RKOA 1XXHB 1N5KA 3RC8A 1CULC 1YZKA 4BFVA 1VYVA 4HDQB 3IO3A 3GLIE 1W4RA 4QM6A 1P9NA 2AD1A 3D7MA 5C1BA 4AC9A 4X8OA 4CRWB 3X1ZA 4F38A 4D25A 3QVVA 5EE1A 5DI9A 2GCOA 1OYYA 1ZIOA 1RPZA 2OCPA 4Y0VA 4PHFA 4C9BA 3C7KA 5EUMA 4DIDA 4JBYA 2UZIR 2JIZD 1SXJB 1GKUB 3K0EA 1CTQA 1KI3A 1Q1QA 2ORVA 4TTPA 1T3SA 4B2PA 4C7OA 1KY3A 3MGCA 4TL7A 3QUSA 3IKJA 1TPZA 5DYGA 3K09C 1NVWQ 3MLEA 1S9HA 2F55A 4TYYA 5HTKA 3ZJYA 5JWHA 5IK2A 2JLXA 1COWD 2CLDX 2CVHA 2D06A 2GJKA 2QRZA 2VP5A 4A8JA 1DAGA 3VX3A 5BXQC 4M2LA 4CEHB 2ODWA 1E2PA 1MO5A 2F1IA 1NF3A 2OSBA 1GG2A 1I2DA 1SHZA 3SE0A 3QIAA 3CUEF 1M74A 4B3XA 3QG5A 4GPTA 4LC1A 1XTRA 2CHGA 2HDNB 4AG5A 1OPXA 4D4KA 1P62B 4HZUB 2FEMA 3CX6A 3Q9LA 4CEIB 4KODA 3ZQJA 3ZD6A 3HDTA 1IXZA 1J70A 1KGDA 5UKDA 2PMKA 2VPPA 1DG1G 3AP3A 3EPHA 2C04A 3CNOA 3OAAD 3U44A 5EP3A 3EWAA 4QJ3A 2Z6VA 3T34A 2WKRA 3D3QA 5BW8A 1OH6A 3LXXA 1E98A 1JJ7A 1N6NA 1W5SA 1J2JA 2ZAMA 1T0JB 2ZJ2A 5FOSA 1BMFA 1Z22A 4D4LA 1Z28A 4TYPA 2IYYA 2P6RA 3SHWA 1OFTA 2OHFA 3FKSD 4DSNA 5JCPA 2GCPA 2V7QA 4PAQA 1XEWX 2BCGY 2ZE8A 2XTNA 4PHGA 3GQBA 4EUNA 2I4IA 4ACBA 1ESNA 3P4YA 1E1RA 1P2SA 2BMFA 3KKQA 2Z83A 2R6GA 2YWFA 3ADDA 4G1UC 4W5JA 1UKYA 3NH6A 4LUCA 1KSHA 5DGXA 3THWB 1R4AA 2IW3A 3VMFA 4DLZA 1ZCAA 3QI2A 4XWOA 4IRUB 5K8TA 1J90A 2ZVQX 3U44B 1N5IA 4DIEA 1UJ2A 1E2IA 1JJVA 2ZEJA 4RD0A 2RH5A 5EJEA 2YKGA 3PUZA 5GJBA 5FL7D 2DR3A 2R6AA 1IN4A 3AVVA 2ZRDA 1KDPA 4NDZA 4RD4A 1KO1A 3TH5A 2BJWA 4FMDB 4JLJA 4A8JC 4DRZA 4PSKA 3DHWC 5BQ5A 5ELXA 2HF9A 4LX0A 3PV0A 1NL3A 1P2VA 3QKRB 4NYJQ 4M1MA 4XOIA 2O8DB 2BVNA 2FWRA 4M0LA 4Z8YA 2XZLA 1XDBA 1Z2AA 3B9QA 4B34A 3O8DA 3K09A 4IDPA 4OQFA 4C0SA 4LJ8A 4EPTA 3U4QB 1GSIA 1TNDA 3WNCA 2C77A 3ZVLA 2O8BA 2V9PA 5JHGB 4I1VA 3B6EA 1DBSA 1Y3AA 3QEJA 4WZBE 3UG7A 3VR5A 3WMEA 1N2CE 1KJZA 1ZNWA 3D8BA 1SXJE 1TQ6A 4JJKA 2VBCA 4PZLA 3PITA 4C3ZA 1YE8A 3HU3A 1ZMXA 3ZVNA 5CM8B 1KDTA 1QG4A 2DCUA 3FMPB 3IIKA 1AS3A 1R8QA 3KXLA 3AVTA 1E9CA 1UKZA 4QJ5A 1A5TA 1MT0A 1S3GA 4U5XA 4DT1B 3F3YA 3PUXA 1LTQA 2Q9BA 4Q1EA 3EC2A 2V8OA 4P4UA 5ANRB 2EYUA 2GEVA 3Q7PA 3EIEA 4D4MA 3TE6A 1WA5A 2G83A 3ICEA 1G5TA 3ONWA 2OO7A 1Z5ZA 3IBGA 1VG9B 2JLUA 1XJCA 1ZM9A 4MRNA 2XOKD 5D3MA 4QXAA 4CEIA 2JJ2D 3U4QA 3B13B 3HR7A 4XSGA 1GAJA 4NE2A 4D0GA 3OEED 3OEHD 5FFMA 1D2EA 3BRWD 2HT6A 2HT1A 5BYKA 2YOHA 4KHZA 4OK6A 4ARZA 1GOTA 1EX6A 2QAJA 4IOMA 3KKMA 3W3AA 4A2QA 5J4LA 4RD2A 1ESMA 3H1TA 4GOKA 1B23P 3X1XA 3E5HA 2JGNA 2OILA 4XD7A 3EA5A 2XXAA 1JNYA 2AXNA 2O8EB 2H1LA 2PT5A 2GHIA 2ZI3A 3FE2A 4NKRA 2KSQA 1ZNZA 2C5LA 2ZU0C 1HT2E 2P5TB 1ZM3A 4MGZR 2QMHA 2IWHA 3BORA 4PC2A 4TSFD 2BJVA 2IXGA 1XMJA 2LKDA 2GNOA 4B32A 2OAQ1 1XNJA 4GBMA 1C1YA 2ZIAA 2OLJA 5G41A 1NP6A 2ZR0A 3U2QA 5B2ZA 1CJUC 1NSTA 1Z0DA 4GP6A 1ZD1A 1KO7A 2WAYA 2GRJA 2IF0A 1XMVA 3EASA 2QGZA 3JVUA 1AQYA 2J0QA 3U7GA 3QOFA 1UPTA 3KFVA 1XCPA 1HE1C 2GAAA 3QF4A 2L0XA 3VHLB 1JR3A 3W8NA 4JLAA 2I1VB 1LB1B 2ZSEA 4O2RA 4HSEA 2FZLA 3RRMA 2D74A 1UBEA 2V7QD 2ZS8A 1YR7A 5FTMA 2CJWA 1PVOA 2QE7D 1IXRC 4M1WA 1MKYA 2BDTA 2WPDA 2ODBA 1WE2A 1KSFX 1E2LA 4BLOA 2GETA 1IONA 3ADCA 2CHVA 4LK2A 2MMCA 2A5GA 3AVYA 4IDOA 5AUNB 3VR2A 1D5CA 4OI0A 4AWXA 1SZPA 3SU8A 1U9IA 3U3OA 3WMFA 4Q1FA 4B47A 2DB3A 4MUAA 4DXAA 2WAXA 2DBYA 1TX4B 2JLSA 3B5JA 4OKSA 3LW7A 1NN5A 4O25A 1VYTA 4IVQA 4UXJA 1NMYA 5DN6D 4XTCS 2FSIA 2WWGA 1S1MA 4H9GA 3U7EB 5JHHB 1HT1E 3PIRA 4ERNA 4BLSA 3VKGA 4UNPA 4JVSB 1ZW6A 4BUJA 1G17A 4LOAA 2NZ8A 3BJIC 1H8EA 2IYVA 3VTKA 4QGFA 2BHRA 2WKQA 2BKUA 2C9OA 2ZRPA 2QPTA 2FH5B 2IYLD 4EJSC 4IW3B 3IDQA 4GNKA 3AVXA 2HV8A 1XTJA 1VCOA 2PX0A 3I73A 3NC1C 4LBYA 5C2JB 1OIVA 5HE8A 4QBGB 4TYNA 4IDNA 2J0UA 3BIFA 3EG5A 1L2TA 3CX7A 3B85A 2CL6X 1RJ9B 4PPFA 4BFSA 1JI0A 2IA5A 1R5NA 3KQLA 3W5IA 5L3QB 2CBZA 1ODFA 2Q3HA 2ZRMA 3SFVA 1TF5A 1TQ4A 2A5DA 1OIXA 5FL3A 3QJYA 4DLTA 4YMTA 5C4MA 2DWQA 2ZTSA 2PZFA 3K9GA 1TEXA 4IDQA 2ZJ5A 2EFCB 2ZRKA 4UJ5A 1OE0A 2WJGA 5A4JA 3OF5A 1NSFA 3NEYA 4C0AC 5FUYA 1A2BA 1B0UA 4DLRA 4XVUA 5F2EA 1IM2A 5FR2A 2MSDB 3TJZA 2NMVA 5E4FA 2W00A 5EXXA 2BEKA 1Q21A 2WSMA 4A8JB 3I62A 4Q4HA 2O0JA 1E9BA 4GFDA 4JMPA 2NZJA 5E7IA 4M1KA 4DDUA 1U90A 5HR5A 1Z0AA 3BB4A 4KLNA 4A6XA 3THYB 1T91A 4JSTA 2V6IA 1QDEA 4KFTA 4MA4A 4F7WA 5IRCD 1XPUA 1NJGA 4KYIB 3UXMA 2CK3D 1CF4A 3H2YA 4ASUA 5JBQA 1EX7A 1KHTA 1Q12A 2IYQA 2D2FA 4CEJB 3KQKA 3BGWA 5TDHA 4LJYA 1NY6A 5KSZA 1UDWA 2ANBA 2DHRA 2JAQA 2YOGA 3Q85A 3C5HA 3W90A 4V0ME 1YHNA 4B73A 3SR0A 1JEDA 2YWGA 3OIVA 1KZ7B 5B58C 3LLUA 5KNDA 2QT1A 1YZGA 5D3QA 3WHKA 3K0AA 2FGKA 3DO6A 1CEEA 3JZMA 4TLCA 1N25A 2BMJA 2IWRA 3A37A 2VLIA 1NN3A 4MITA 3KB2A 3NHAA 3NKVA 2GXUA 3T5GA 1GITA 1UDXA 1ZIPA 2NPFA 1L4UA 1A7JA 1HQCA 1W44A 1ZINA 1P75A 3A1WA 3GCGA 1SXJD 2RAPA 3K9LA 3K9HA 2Z4SA 4O0MA 3THWA 2VP0A 4LJ5A 1PZNA 3U3MA 4CT5A 5KHOC 1NLYA 4GL2A 4D82A 4Q7LA 2J41A 2IC5A 4C4PA 4W7SA 4UNRA 4MGYR 3K0SA 1FPMA 2A5FA 2NG1A 1SULA 2PCJA 4RCYA 4WW0A 5JSZB 3WHLA 421PA 3KDSE 3FB4A 1S96A 1ZD9A 3CBQA 4MYTA 1W1WA 1E32A 1QBKC 1S8FA 1BYIA 2HYDA 1R8SA 2WWWA 4DEXA 3G82C 2XNDD 1UBFA 4TL6A 1VIAA 3QKSA 4B6EA 3QF4B 1DAFA 3ZGXA 5SZKB 4JVLA 1T5IA 1OFIA 4DC9A 4Q00A 1SXJC 3CR8A 2CDNA 2ZSFA 1W47A 4HB4A 1C9KA 3N5CA 2IL1A 4KFRA 5EE3A 2O8FB 1KI4A 4JSYA 4TQUS 1L7VC 3Q7QA 1CR0A 1W46A 1X3SA 2R9VA 5KYKA 1ELOA 3ZYCA 3IHWA 1ANKA 1NG9A 2FPKA 3CONA 1QZXA 1KK3A 2Y8EA 3R9XA 3AGPA 1KI9A 3DKPA 3GLFB 4AY2A 2IXFA 4B3BA 2JCSA 4PC3A 3KTAB 1M7HA 5K8LA 2RGGA 2WIAA 4NU0A 1KDRA 3REGA 1E1QD 3HWSA 2KBEA 3DM5A 3HYTA 3G5UA 2R44A 3WYAA 1F2TA 4I99A 4BRWA 4FI3C 1SHKA 5F9HA 5AUOB 2AL7A 2FPLA 2XNSA 4EKDA 1L8QA 3LRPA 2G3YA 4D26A 2WJYA 3H84A 4YMSA 3BFVA 4CW7A 3EX7C 2CNWA 5FTKA 1A4RA 5DHAA 4TT3A 3QVUA 4PPGA 4E22A 2A3RA 3DMNA 1ZD8A 2I1QA 3DM9B 2W2TA 5GVSA 5AK0A 3QBVA 2H92A 4M1OA 3AVOA 3UIEA 1G21E 1DAEA 5CLQA 3HPRA 4G5OA 4PX9A 2ZI9A 3QXSA 4QBIA 1N6KA 4IDHA 5CLLA 5LBIA 1NMZA 3LD9A 5KDOA 2BCJQ 5CJ2A 2OAP1 4EPXA 3WRXC 1F2UA 1OW3B 1XXHE 3IEUA 2PT7A 4KITB 3O8RA 2PEYA 2GA8A 3U3KA 1WF3A 4JT4A 4B3FX 5FH9A 4TZ0A 4PC6A 2O5VA 2F3RA 2YV5A 3LV8A 3CRMA 4Q7MB 2QP9X 2R65A 1EESA 4BASA 3R9WA 1KY2A 1S3SA 1JALA 2QAGC 4CF7A 1W4CA 4PZYA 5JEDA 1E9FA 3DL0A 2JJ2A 4Q19A 4US0R 2P3SA 3DDCA 1F48A 2YOFA 4V03A 4W5HA 3HYRA 4MRSA 2ORIA 4ZKDA 3AF1A 5FTLA 1GNPA 4EQ6B 2CHQA 2QNRA 1I4DD 4R7ZA 2VP2A 4S2EA 2VRWA 5FUWA 5J4YA 3QXXA 1XD9A 1S4QA 1CR2A 1J7KA 1VPLA 1G7CA 2OFXA 2ODEA 4NBSA 1P2UA 4LJ4A 2NQ2C 4XD7D 5AJXA 5E95A 2IEZA 2O8FA 3GJ3A 1XEWY 1VCNA 3IHLA 3NBYC 3U3RA 4G0NA 4NYIQ 1MABA 1A82A 1E99A 4G01B 3SC3A 4ESHA 3L0OA 3GLGB 3U5ZB 1YQTA 1KK0A 2HXYA 3M6AA 2R62A 4GI7A 2ZRGA 1II0A 3V9PA 2NO0A 3PJRA 1P3JA 1IAQA 1JECA 2XOKA 1IOZA 2RCNA 3BAFA 4DDVA 1OXXK 3FHCB 1WDTA 1NBMD 4A15A 5J5CA 3KL4A 3OEHA 3PEYA 1X6VA 1TADA 1ZU5A 2C98A 1KIMA 2XNDA 1QHHB 2ZJAA 3FDIA 2QTFA 2N46A 4Z8XA 3NTUA 2ZI5A 1D8TA 1XMIA 2F3TA 3ZZ0A 1G3MA 3T12A 3N70A 2QN6A 4HDOB 2VIIA 4L16A 2GZDA 5FPHA 5KOYA 1E96A 5J4HA 1XZPA 1E1RD 3EPJA 2F7SA 4B44A 4L9SA 1BH2A 1Q57A 4EAQA 4MQBA 3T15A 3W34A 3CZPA 1T3LA 3LH5A 2AN9A 4OL0A 1U0JA 2JLYA 4P0TA 2OM2A 1ZUHA 4AURA 1W0JA 4I4LA 4XWKA 1WQ1R 4HATA 1G1MA 1W36C 3UK6A 1MO4A 1UF9A 4RY2A 2XGJA 2G6BA 4QGAA 2IXEA 1TTTA 3K53A 4LCBA 3A58B 4X8LA 5AR1A 3H4MA 4EPYA 3Q3JB 1KI1A 4LJAA 5L3QA 8OHMA 2RGNA 2VSXA 3B82A 4OYHA 2P5SA 5DSZA 4TMKA 1C4OA 1G8YA 1FX0A 1AGRA 2WMOB 1UKEA 3TNFA 5KPDA 1NMXA 2IF2A 4KFSA 3AV0B 1FL9A 1RIFA 4KV9A 5P21A 3SOPA 4G5GA 2G0TA 621PA 3RNLA 1NI3A 2GVDC 1MRNA 4TZ6A 1D9ZA 1ZBDA 1EGAA 1E9RA 4LDJA 5L3RA 1E2HA 4DSTA 3V00A 3TVDA 4LHWA 4BE7B 1P9WA 4GOJA 4K46A 1T9HA 3QPUA 4QNMA 1JR3E 1U81A 1BO6A 2GILA 3CLVA 4LHYA 1MO6A 1XCGB 4RVCA 3TSZA 2Q6TA 4LC0A 5CDFE 4B2LA 2DY1A 3FMOB 3KUCA 1PV4A 5F98A 2IS2A 4UXHA 1KZGB 3OIWA 2N42A 3IO5A 1P72A 2KI5A 2B8WA 1FTSA 3OE7D 1T8UA 3QSYA 5JJLA 1IY1A 3T35A 5G3ZA 4EPVA 4PHHA 2ZXUA 4PAMA 4Q4LA 4R98A 5CM9C 1KO5A 4M8NE 3QE0A 4KSBA 4Q4HB 3R20A 2QUZA 1KOFA 3A8TA 2J45A 4Q48A 2PX3A 4WIAA 1VG0B 4AG6A 4LY6A 3O8CA 3BWDD 2V1UA 5FOWA 2RB4A 2RGEA 2WWIA 2HF8A 1P2TA 1FQJA 4RFSB 1KJYA 4ZDJA 2ZS9A 4PQRA 4R9UC 2CCGA 2ZITA 4RFVA 1OFUX 4DLWA 4NPHA 1N6LA 1JR6A 4A82A 3F5FA 4GMXA 4UNQA 2P6UA 4WA7A 5L3SB 1OXTA 2IYXA 2Q9AA 3H0KA 4BZQA 4TLEA 3K70C 1ZYUA 3GLHE 3OHMA 2WTUA 1Q20A 2RGCA 2Q0HA 1VECA 5AUQA 2VSFA 3AM1A 3VX4A 2ONKA 1IHUA 2D4HA 3I72A 2FFHA 1KI2A 2P6NA 3CF6R 1EK0A 2IYRA 1U0LA 1NLFA 3OFNA 4YC7A 3CPJB 221PA 4E03A 5D3MB 4F92B 2ZR7A 3K70D 3SJCA 2FU5C 5GJCA 2ERXA 4LYFA 4HZIA 4PO9A 3BS4A 1G8PA 4QGGA 1G5RA 1U9IC 4UQOA 2GK6A 5B30A 2G88A 1KKMA 3AP1A 5HKKA 4TLAA 5EP4A 3MMPA 1W36B 4JS0A 1D6JA 4KYUA 2QBYB 1AQUA 3THXB 2QBYA 1VG1A 1UM8A 2QP3A 3NVAA 1OKKA 4WOPA 5FPSA 5DLQC 3A4NA 4JLDA 3K9NA 4HB0A 1U8AA 2AFIE 4O3MA 4Q9LA 3VHXA 3KXIA 3NDBB 1KO8A 4PANA 1W7AA 1HEIA 2FFQA 3AKCA 2JJ1A 3ZH9B 2A78A 2BMEA 2LCFA 5JLJA 3P27A 4V0LA 5FBLB 4C0BA 3L0PA 3QPVA 4HAWA 3C4JA 4DCTA 2O8CA 1IBRA 2W58A 2AWOA 1N6HA 2OBNA 3ZVRA 2AD5A 1UKVY 4DVGA 3I4LA 4JLPA 4PO1A 2Z4RA 2ZE5A 2NGRA 4JYCA 5JWOA 4FMBB 3JZAA 3ZZUA 3O8BA 3IUYA 2KBFA 4FXPA 3UATA 3VR3A 2E87A 2WVJA 1FMJA 1KMHA 3X1WA 5JMTA 1UAAA 2WOOA 2FZ4A 3TUIC 3Q5EA 1E0KA 3SI7A 5LPNA 1GNRA 1AGPA 3X1YA 1F2TB 3RS4A 5DNYB 2GDJA 1ONBA 2NTYC 3K0FB 3AGQA 4DUGA 1E9EA 4AYWA 2N1BA 3SHFA 4L9WA 2ZJZA 1IN6A 2E9SA 5EE9A 3C14C 1CJKC 3JVVA 1KAOA 3NDPA 4CZ2A 4L5BA 3CNLA 1KSGA 5GJWC 2HEIA 4V0OA 4URUR 2AFHE 1CU1A 2FSGA 3SYNA 5LD2C 2DFKB 2ZE6A 1JXOA 1II8B 5AJVB 3PEVA 3PENA 3LBNA 3QENA 4JLOA 1NN0A 2Q3MA 4X8HA 1UFQA 1ZM2A 1E94E 1XBTA 2WJIA 3ASYA 1PJRA 2UZ3A 1Z07A 4EDHA 1RRFA 4OHWA 4HAXA 4HAUA 5DYIA 3SYKA 4ZI3A 3BK7A 5C4GB 4D0NA 5AUPB 4F93B 4MDFA 4I1OA 2REXB 3BBPA 1W0KD 3VFDA 2OBMA 1FX0B 2BEJA 4MYHA 1SVMA 2HJVA 1KI6B 5FBQB 4FINA 2X2FA 5DO9A 4OI4A 3EC1A 5CB8A 1CR1A 1TU4A 1W0JD 4BEBA 2IHBA 4TN1A 2A7QA 1Z0IA 4GMDA 4YMWA 2ZRJA 3ASZA 3W6NA 5L8VA 1XFAA 2AWNA 1Z2CA 3GMTA 4ZDIA 2CLCX 5LDDC 1CLUA 2QEQA 2QU8A 3THXA 5TMPA 4P31A 1GFIA 1HA3A 1CRQA 4QFMA 1TMKA 3U60B 4TT3D 3E2IA 2PCLA 1XD2A 3CPEA 1G8GA 1IQPA 4JL6A 3J81k 3I8SA 1WRBA 1YKSA 4AK9A 2CLSA 4JT2A 5JECA 4Q5IA 1II9A 3W8RA 2FA9A 4A2WA 4RZXA 2JA1A 1IY2A 1CIPA 1XMSA 1KTVA 1LS6A 2H7VA 4B74A 1NVUQ 2FFBA 3Q5DA 1E4YA 3T5DA 2W83A 2KJQA 3L2OB 4OQNA 3I61A 2YWHA 4N3NA 1G7TA 4LBWA 2WSSA 2KB0A 4KXFB 3GEEA 4AIIA 4Q47A 4ZIRA 1AM4D 3LXRA 5FOUA 4NYMR 5DI3B 4OHXA 4HLQB 4E5UA 1P60A 4RJLA 3NEJA 5BN3A 2JIZA 4HAVA 2CCJA 1OYWA 1K6MA 2CMKA 1RJ9A 3FTQA 2HYIC 3QXHA 3ZLJA 3IQWA 1NJFA 4EJSA 1IN8A 3DMDA 3LBIA 1AJEA 3E1SA 1N6OA 1EFHA 4GZMA 4N0DA 1AKEA 3BD9A 1GP2A 2J3EA 2WHXA 4M1YA 1MABB 1US8A 1G6OA 1GM5A 2QP4A 3F8TA 1E2EA 4E07A 3SBEA 2QG6A 1H8HA 4URYR 3REFA 4A6PA 3HP1A 5L3SA 2FE4A 1S9DA 3I32A 4U7DA 2C9YA 5BN5A 1TF7A 3DKVA 2F1JA 1US8B 1E9DA 1XJQA 1CRPA 4KVAA 1E2FA 4BZXA 4LI0A 4CYMA 2CVFA 5LB4A 4Q1AA 3U61B 1IXSB 4ZDKA 2VHQA 4PC1A 4XSHA 4KCGA 5CYPA 2WBLC 3GEHA 2V54A 3CRQA 1RKBA 5JS8A 1I4LD 1LS1A 1G16A 3D6TB 4UJ3A 1OFHA 3QQ5A 4URWR 4HZUA 5EZ5A 3RRYA 1FOEB 1AIPA 1R0XA 4B6FA 2OFWA 2VSOA 3P1JA 5H68A 2CCKA 4US1R 1U2RA 2SHKA 4BFXA 1OHHD 2DFLA 4U02A 4NHOA 1IN7A 1O87A 1RYFA 2WWHA 4YXWA 4DB4A 1RFLA 2GF0A 3DOEA 5LB2A 2V4ZA 1EFUA 2JASA 1Z6GA 2GZAA 2GWHA 3BOSA 4PXAA 4UXIA 2XEXA 2ZYTX 3NH9A 2QTVB 3B1VA 3KKPA 1I4TD 4XIGS 3VAAA 1DAIA 2OLKA 2QAGA 3LX5A 1P6XA 4L4UA 2HLDD 3CPHA 2J46A 1J99A 2BKEA 2ORWA 5CJPA 4F4JA 2Q9CA 1M2OB 1VG8A 3DZ8A 2WJHA 2MSEB 3U7FB 1XRJA 3A36A 4QHSA 1SVKA 2WZQA 1RZ3A 3AP2A 2W6JD 1KYIA 4QBHA 4OHVA 4XH9B 5FTJA 1GL7A 2ZREA 4Q4AA 4BFTA 1FUKA 4C7OB 4QJ4A 5B57C 4HLUC 1VHTA 4LYHA 3GJ4A 2J7PA 2YNMA 1N5LA 1SKYB 4PPQA 1VIYA 3AKDA 2BBWA 5CIQA 1YR9A 1XEFA 4URVR 1R0WA 2ZPTX 5JRZA 4FWIB 3THYA 1F60A 1XPOA 3OIUA 1FP7A 4UNNA 2XX3A 1YZUA 1G4UR 3IPYA 1H8ED 2JJ1D 3EZ9A 4MRPA 3AVWA 4TMWA 5TV2A 2ZI4A 3CH4B 3HU2A 1BS1A 4URZR 4QHYA 3AF3A 4D80A 2P0EA 4Q1CA 4JJZA 4C2UA 1EFTA 2ZRBA 3TSOA 2H16A 5GJVC 5KSYA 2WIBA 3SS8A 3CX8A 3W5JA 4MYUA 1JQJC 3P32A 4IVRA 1Z6YA 4DCSA 4AYTA 4C0HA 4URXR 2NPIA 2XZPA 4DB2A 1GL6A 5AJZA 4CT4B 3FPAA 1QRAA 4Q4JB 4M53A 4DDWA 4BQSA 3OAAA 3R8FA 4OJQA 2YC2C 1PLJA 1KJWA 3FKQA 1QG2A 1E2JA 1CJTC 1R5OA 1DE0A 1G8HA 2NO1A 5FOVA 3W9YA 4AI6A 1HUQA 1UADA 3WNBA 4DUGD 3SEAA 5AJWA 1R10A 3BH7A 5JZVA 3ETLA 4D4JA 1KMQA 4QRHA 2X8AA 4A9AA 4YQFA 2F9MA 1AKYA 3TW4A 1OF1A 3GJ6A 2GCNA 3U6KA 3I8XA 2GXAA 5JJKA 3IILA 3MRSA 4JIMA 4DCNA 2ZJBA 1E6CA 1XEXA 2CL0X 4DKXA 1MV5A 1ZAKA 4O2LA 4P4SA 4RD1A 1W2HA 1E9SA 4NYMQ 2O8EA 1JEEA 3OFND 4KFUA 3RDPA 1Z63A 1E2NA 1DOAA 1SVWA 2ZRCA 3SDZA 1FTNA 4MUBA 4M1TA 1LV7A 4ZCMA 3FOZA 4JBXA 1XD2B 4PR0A 4WAUA 2PLFA 1E4VA 1EFRD 4NCIA 1N0UA 2DPXA 2BBSA 3UANA 1M34E 4TMVA 5B64A 1KNQA 1W36D 2ZSBA 3CF2A 4Q9JA 4F4CA 3TK1A 5HKKD 1Z47A 5KNCA 5J40A 3GFOA 4DSOA 4HAZA 4P4TA 1DELA 1GIAA 4Q01A 3RSOA 4Q7KA 2FJUA 2YJTD 4NZYA 4EJSB 2XSZA 1AS0A 1VHLA 4F4IA 1HE8B 1NBME 2B7CA 4LSGA 4ZDWA 4MYCA 3X2SA 1HH4A 3GLIA 1P7CA 3QKTA 5FOTA 2AX4A 4IOJA 2G1JA 2IBMA 3GFPA 4GP7A 2H18A 1IY0A 4Q03A 4QC2A 3B2EA 3KJGA 3RS3A 5A5GA 4Q18A 3AH8A 3WXMA 3R7WA 2C2HA 1T4GA 3FFBA 4V0KA 4DT1A 1F3OA 3T61A 2GEDA 3FFAA 1KI6A 4B71A 1KMHB 1YZQA 4IVPA 1E2DA 3M1IA 1SXJA 4CEHA 3L0IB 5HE9A 4M1SA 5EZ6B 4A0FA 3TKLA 2ONJA 1K5DA 4B48A 5CB6A 1XPRA 4IEEA 1X1SA 1VCMA 1E69A 5IT5A 1JBKA 5FI0B 4OBEA 1FZQA 5EE0A 2ZUBA 4W9MC 3ND9A 1AK2A 2VHUA 2IS1A 4R2IA 1V5WA 4WXPA 2WJJA 3QXJA 1Z6TA 1JQLB 5JWRA 3A1TA 4ABYA 1F2UB 2IUTA 1DPFA 3MCAA 5EXSA 3PXGA 5BWMA 2ZM5A 2QPOA 3RRNA 3IEVA 4XVQA 3DOFA 3I3SR 4CEJA 2KE5A 1N6RA 4I81A 4PQFA 4TMZA 3TBKA 4H1UA 2XAUA 1CR4A 4J0QA 4WVFA 4N1AA 3KZ1E 4ZPXA 1ZC4A 3RVBA 2PZEA 1DS6A 1Z83A 4BPBA 4NCKA 1PUIA 3PEUA 4NYJR 1F5NA 2OXRA 5J4VA 3MWKA 4TTRA 3RWMB 2XITA 1GRQA 2BIFA 1TQDA 1Q44A 1R7RA 1G20E 4LWZA 1G7SA 2ZRNA 1DARA 1R2QA 1R6BX 1ZRHA 3FHTA 4BEJA 2A2ZA 2DFNA 3EWSA 4LZZA 3EPKA 4KSCA 2GCOB 2Z0MA 2X19A 2AXPA 2QPAA 2EW1A 2ZI6A 3SJZA 1CKEA 4BECA 3NIBA 1SVLA 3LWNA 3AKYA 2FNAA 5FOXA 3WBJA 4B43A 2R6FA 2BMDA 5KPJA 1XX6A 3P26A 1ZU4A 1SGWA 1AZSC 2GF9A 1MO3A 1Q0UA 4G3XA 1U0HC 3MFYA 3WRYC 4B33A 2ZRLA 2C95A 3T1QA 3CB4A 2WM9B 2CNWD 1QVAA 2J7KA 1FP6A 1OHHA 5KDLA 4KAXA 4BLPA 4NH0A 1YR6A 3PR1A 3BFXA 3I5YA 4JLMA 2GTPA 2QE7A 1HTWA 1VKJA 3D31A 3OIYA 3CIOA 2JLWA 1EFRA 2D7CA 1KO4A 3QKSB
chains in the Genus database with same CATH superfamily
1TFUA 4E88A 3G7NA 1U3GA 1J8DA 1H6AA 3B9PA 5DIZA 4B4OA 1EGHA 1NXVA 4HNAB 3GD7A 4MUNA 1HV8A 5L3VA 2R8ZA 1T8TA 1MA0A 3OCXA 3MWEB 1D6SA 3CH5A 3NM6B 3P2JA 4P08A 4ZAXA 3RPEA 3WB9A 1QO7A 1Q0RA 5H83A 2H9YA 3ZK8A 2EL7A 5D8DA 4XX0B 1KZ6A 2X9QA 2BCEA 2W2OA 3CUWA 4M83A 2PLRA 3F74A 2WMYA 2Q7OE 3VR4A 1UDAA 4YCCA 1SQ5A 4BKPA 3NDRA 4Q9HA 1VIMA 2PGXA 3LBYA 4LDRA 1KK2A 3GJ8A 2R8XA 4JR0A 4OQLA 1MLDA 1JTVA 3K2BA 4S3MA 1M2HA 2JFBA 4HYEA 3O95A 4ZWNA 1I0ZA 1RAFA 1ENPA 3W77A 2W4QA 1K66A 4AMZA 3HCBA 4EGSA 3UGKA 1NNI1 3MJRA 5HCNA 4W1QA 5A9SB 4HQOA 2QRLA 3EHEA 4EB3A 4J3NA 2A5YB 2W43A 1XZIA 2OBLA 4OQMA 1JB1A 1ID8A 3D7RA 3LDAA 1ETUA 3LCUA 1Y5LA 1JI3A 4C9BA 3EVGA 4GLJA 3L7KA 2J0VA 4BTLA 3UH1A 2OBXA 2YVUA 1RQ7A 3TG2A 4YP6A 4BP9A 4JI0B 4IIXA 4CTJA 5ICFA 2Q4TA 1B8VA 4L8GA 5CLGA 1G64A 1CY8A 2FEOA 4IIFA 5KI6A 1TK9A 1LBTA 2ZJ3A 3AVPA 4I1PA 4DS3A 3AY0A 4LKRA 1KBOA 2ZUDA 3JASB 2PNFA 3GMIA 3VOBA 1S6YA 1LW7A 1N36B 1TZMA 1ECJA 3E84A 3QWBA 3VU1A 2SECE 2OCAA 4L76A 3HJNA 1LNSA 3TI9A 3C98A 4KE6A 3VMMA 3Q8XB 1ULSA 3NYWA 4HEA6 1E20A 5AI0A 4YGYA 4OA5A 1C2TA 3ER9A 4TKMA 1U8EA 4GWGA 3ZV4A 1OB5A 4OEHA 5BVHA 1NJ8A 4DG5A 1J23A 1I36A 1QORA 2NO5A 2QSZA 2YIJA 4J6FA 3PFIA 1EP1B 5A0FA 1H8HD 1Q17A 1K7XB 4TWIA 3RS5A 1KBQA 2D8AA 2WWTA 4FD2A 2HMUA 4A1OA 6Q21A 3E2MA 3A70A 3JZFA 4XQGA 3FLEA 1ZO8A 4DR4B 3ANLA 3DZDA 4YLEA 5JD5A 3KEQA 2RIRA 3OPVA 4NESA 3IA7A 3PQCA 3MRVA 2WEKA 4HUQB 4LQDA 1AKVA 3VKHA 1J21A 2D54A 3BA1A 3M8KA 3W9UA 5KTOA 3LL4A 2XNHA 4G1FA 4WXRA 3NHFA 5EC8A 4PCAA 2UYQA 4C7XA 4JMLA 4LHXA 4YDHB 2J07A 4RQUA 4B7XA 4RA6A 4K3UA 4LYJA 5MHTA 1EPUA 3O91A 4HNUA 3P5SA 1LWNA 2DERA 1VE1A 2B1GA 3W6PA 5AKHA 1DXQA 1CW2B 2YRXA 4U6SA 4B0OA 2XDQA 3CUVA 3SC4A 3DKRA 5IXJA 1WLYA 2YRFA 4KYTA 2AI3A 1CCWA 2Q3FA 1Y3CE 2GS9A 3EIQA 4O4LF 1RFGE 1HDYA 1SCJA 4LRWA 4V3CA 3AFNA 1Z08A 2VJOA 4CKEB 3EFHA 4QKQA 5G0TA 3LO5A 5BSTA 1P45A 4BRZA 1Z0JA 8AT1A 4IYJA 1Z8FA 4RNDB 5K09A 1NMSA 2AG1A 5DEIA 1GXSA 1MG0A 3IPAA 5ALSA 3SSMA 2HD4A 2EVWX 3ELWA 3IBCA 2CY0A 3ILYA 3IVGA 2Y0BA 3KVNA 2WU3A 1P1FA 1T2VA 3G02A 3KQWA 2VN8A 1BE6A 5AI9A 5JHHB 1XEXB 2QY9A 5FBVB 3HGMA 4NBRA 1Z34A 2CNLA 1E18A 2ZJ1A 3ZBTA 1NN1A 2FOLA 1H3EA 1CS0A 3FDXA 4OMFG 5HQJA 3UMSA 3K72B 3CB2A 4DCVA 2FWMX 3QLUA 5E7JA 1P4HA 3AFOA 1AO3A 2P69A 3ICCA 4PYIA 3JVDA 4BNFA 1OLOA 5JAIA 1I7QB 1TAQA 3TDKA 2GEJA 1ML4A 5FI3A 2YJNA 1KQ3A 3LVRE 2PGNA 2B8EA 3INYA 3KUDA 3A28A 3PB3A 4I1UA 4JGIA 4N49A 3EVEA 4B3CA 5FLEX 5KYNA 2E1RA 1NF2A 3RB8A 1N6IA 3VSBA 4HLDA 4RY9A 4J29A 1WEKA 1W9HA 3NHJA 4NXMB 4I50B 1E3LA 4NJEB 3UFBA 1GNTA 2YYYA 1SK8A 4UE2A 1NI5A 3CE6A 1KVRA 4NH4A 4NOJA 3SJBA 1ISGA 4FNMA 4II7A 2B6HA 4GKBA 3AZQA 3RVQA 3IELA 5KVCA 4RYLA 3CLSD 2OE2A 2YWXA 1QHYA 3EZ7A 2RGYA 2J3QA 4WJZA 4WQMA 4Y7DA 1X1DA 5KO2A 2I2BA 1P1IA 2FPMA 2FZEA 2W6ZA 1GT91 4OD0A 1ZJ5A 3R3XA 4M9ZA 1VC2A 2GVZC 1SKAA 1Z75A 2PX8A 1NLZA 3OZDA 5T6BA 4UTZA 4ZI7F 4UREA 5IVPA 1ISPA 1L7OA 2WG2A 2NO6A 2MYTA 3IRUA 2Q2OA 4WKPA 3QEKA 2O7SA 4PGGA 2AF4C 3CLSC 3NBZC 2H52A 1GRRA 3HVRA 3FCSB 3X43A 2PXCA 3P9NA 3Q9UA 2IU4A 2C9CA 3K6RA 3SHOA 3FM9A 4CU2A 4W8GA 2A7XA 1ZJZA 1IH8A 1ZGZA 2G5CA 3JQ8B 3EZFA 4PG5A 2H65A 4ASUD 4Z54A 5F7XA 3V1NA 1PT9A 1VMAA 2WSIA 1IU9A 5CK4A 4QNRA 5HWSA 5IWCA 2PMCA 2PBRA 2ZRHA 3EGEA 5CP8A 2D8MA 3J7TA 4RH1A 5G3YA 5TQ2A 3TSCA 3WDKA 3ZI4A 4ZIRB 5CDHA 4KPEC 5FPYA 4RVDA 2B35A 4KWHA 1TA4A 2DJ5A 1QHHA 1WX1A 2P91A 5F9FA 4KDFA 4JJ7A 5AESA 1MOSA 3B6MA 3CV3A 1BYUA 2VT3A 4XFJA 3SBOA 1UMBB 1EFDN 1F6BA 5AVVA 3TCNA 2UVQA 3O82A 3I5XA 2VHEA 2JFXA 3LP8A 1VCIA 4C4XA 2PUAA 2ZRIA 1THMA 2VDOB 4XJSA 2B5WA 4KGXA 1R6AA 2PSEA 3ZHZA 5DBOA 2EWVA 5AFSA 4O8CA 3VR6D 1JYEA 3LNCA 5CD9A 4U7GA 1YAHA 1HXHA 4UBKA 2JGDA 4E30A 2GXQA 3QU7A 4RMIA 1DG3A 1E2KA 1RRCA 3SFTA 2AOXA 5T7BA 4LIPD 4P6VF 2ZZMA 3RYHA 5SV2A 1P5JA 4LMAA 1M0TA 1Y6QA 4WADA 1FK8A 2E5FA 4IIGA 2LKCA 3EIHA 4AO6A 1ZD4A 2IYUA 2P3OA 3DXZA 5A4IS 1SUWA 3LLCA 4PC7A 1HNZB 1MENA 2C1EA 4L5JA 1FQKA 3B1ZA 1SVSA 3ZC3A 1RWNA 5EKXA 3OE5A 5E1DA 2NSDA 2AJBA 5JCZA 2UUCB 4RGVA 3W8FA 2MSCB 3A11A 2AR7A 2D4AA 2G67A 1Z15A 1K75A 4FYYA 1DLIA 1A1SA 5DDIP 4KBFA 1V0JA 2BM9A 3UT5A 3GAAA 4WNYA 5EXTA 4L4YA 1ZVVA 1LX6A 3D6HA 5F78A 1NV8A 2W2QA 4EYGA 3CG4A 3AF4A 4WXYB 3RV3A 3GYGA 1PJ3A 2WAAA 3Q7EA 4RWZA 1J97A 3DV0A 5CTAA 5JH7B 1KMCA 1T13A 1V71A 4HUQA 4X7MA 3QE2A 3OLYA 2YUTA 2P2SA 3N1UA 3V4LA 1EUCB 2RMKA 1WB9A 1P9RA 4HN9A 4JVOA 3HNRA 3UH0A 3L7LA 4V02A 4E2WA 2YDXA 5AI8A 4F9TA 5KTRA 2LGJA 2FOXA 4GW3A 1E1KA 5H9WA 3VVLA 1JDUA 2AQ8A 3CISA 3CYFA 3K6JA 2RGBA 2G8LA 1VZ2A 3KFXA 3WYEA 2TMYA 1VBFA 4IYRA 2B2NA 3OT1A 1UEIA 5C8DA 4ZCQA 3CEHA 2AFHB 4H6PA 4MGIR 1BGVA 2AR9A 4I1RA 4F9EA 2UUBB 3BH0A 1S7GA 3WO0A 1R9JA 1VPEA 1CUBA 3RI3A 4YV1A 3P4UA 1Z74A 1NDUA 2DHQA 4LNHA 3OQOA 3IAHA 4WZAA 1T6YA 1C7FA 1NQOA 3C3YA 4BATA 1ZJWA 5A05A 1G9TA 1VE7A 5GV7A 4B46A 2ECQA 3RS8A 3F6BX 3M5PA 1AF4A 4J2OA 4RTRA 3R3VA 3T3IA 4UAJA 3TIGA 4YUXA 5JPDA 1VL5A 1Z0FA 2JLAA 4NDNE 1O6BA 4PX2A 4DLXA 2QW0X 5CD1A 4WMLA 3HP7A 1QJCA 3HYSA 1LFDB 4CR8A 4ESEA 5CFRA 3RIHA 5EIBC 4E46A 4FYWA 4FQ5A 3MUOA 4F97A 1SOMA 5JVDA 1J8MF 1J8QA 5EJIA 1VB5A 4KTTE 1Z6AA 1BEUB 2VUUA 4GOOD 1ZWKA 4B3SB 1K0FA 1E8DA 2WWFA 4YB8A 2ASEA 2XJ9A 1L3CA 1FF9A 1KI8A 1QTIA 3GIWA 3M6WA 3PJDA 1RQPA 3ZCXA 4F6RA 2Q4DA 4HDCA 4GKJB 3V4ZA 1MXHA 2QQ0A 4NV1A 4RAOA 3P0EA 1BN6A 4BMXA 2NZYA 4ARIA 4RZUA 3SMQA 1B2LA 2H1RA 3UENA 3JQBA 4QECA 4JT8A 2AZ4A 1U94A 3I04M 1YRHA 4HH0A 3SN6A 4FLFA 4M38A 1KEEA 4MINA 2D5IA 3LK7A 4MJ7A 4PHTA 3QU2A 1J6UA 4NATA 3A1FA 1TCAA 2OHGA 3C3EA 2WG1A 2XE8A 2NU9B 2OM6A 3VTZA 2C58A 4NBWA 1XO1A 2QL9A 2OXCA 1JMVA 4LFCB 1VSVA 2C7OA 3PC8C 3A4MA 3GEPA 2BKVA 3WWDA 5DM60 5KB3A 2BHLA 4DDKA 3T1TA 4BBAA 1JX6A 3LIIA 5AKZA 5GZ1A 4NBUA 1G6HA 2CL7X 4NZZA 1ZJ6A 4GGMX 3W1EA 4ARUA 1U7UA 3MWLA 4PO3X 1RC0A 1DKLA 2IUSA 3KUXA 3PQ5A 4IJ5A 4ZEWA 1NP7A 4IG9A 3QEMB 4NIMA 3G85A 2G4CA 3GELA 5ALLA 1CBUA 1I7LA 4GPAA 4TQ9A 5DCUA 2O8BB 1Q0SA 5BYBA 1BKDR 1A2KC 1M2WA 2D62A 1VIDA 2XQJA 2ZJ0A 3EDRA 4KPGA 3AY3A 3C70A 4UOQA 5AI5A 3WK6A 3D6JA 5FQNA 5C32A 2QYTA 1L4GA 3EW7A 4HLUA 4X20A 1VCHA 3DL4A 3S2UA 1GSAA 3RVMA 4EHIA 3I0MA 2VJLA 4D97A 4P32A 5EZSA 4TTQA 1QOZA 2VJQA 3B38A 2X3FA 1ARZA 5FLYA 5CH3A 3DEFA 2HA0A 1H1LA 1D2RA 2J9RA 3EQZA 4RMHA 3DGFC 2UV8A 4DQVA 1GYPA 3AOGA 3FD8A 3KB6A 1VDMA 2CF6A 2IS6A 4ND8A 1M6NA 4FHZA 3SZRA 1U2EA 1L7MA 1VRCA 2CXRA 1E79A 3MHPA 2J4DA 3CH6A 3F9CA 3PZRA 4OH1A 1KAGA 1RXSA 2X76A 3EJWA 1FSSA 2FPIA 4GVXA 4AD8A 1Q1NA 3MAAC 4A2PA 5AVZA 1OI3A 1X7WA 4IIYA 3CXUA 3C8ZA 3K70B 1LU9A 1H0SA 1R0RE 2OD7A 3GYBA 4NHEA 1STOA 4RXUA 5KHLB 3KPYA 2OC9A 3UMVA 2OTCA 1VXOA 3WQSB 3KEOA 2YXNA 4HYYA 3PQ2A 2NV6A 5HCUA 4HT3B 2Q3DA 3KYCB 2VSYA 3SIPA 3TVTA 3O8LA 1TRHA 3OX1A 3HN6A 1CE8A 1HSZA 2ANCA 4PLWA 1MEEA 1SUBA 1Z5GA 2D2XA 5JI3E 1LTKA 3Q3VA 4M9QA 4NQZA 5I7EA 4IXDA 1PBNA 1V16A 3GPIA 5IH3A 4Q9KA 3T9FA 1IJEA 1PJBA 1BD4A 2JKVA 2D1SA 1CUYA 2B1RA 2BY4A 1L7DA 3JQBC 4KBGA 3VRHA 2BOVA 4XWAA 1R8YA 6REQA 5TGZA 3LZCA 2JBWA 1XD8A 2WJ6A 5JAHA 3JWJA 1DBWA 1VI5A 3EZYA 3LYUA 5EINA 3ZCTA 3FWKA 3F47A 4FN5A 4UD6A 5BV2P 2QHXA 4MVJM 4B75A 2DYKA 3B1XA 4JLUA 5FPTA 2IH4A 1G41A 3DUFA 5BYAA 2YZMA 3CRW1 2WB2A 2BP7B 3GLGA 4J75A 5G40A 2B9VA 4D46A 1A8HA 1M1YE 4DG8A 4RORA 1EVZA 2CSXA 1KK1A 2O5RA 1BX1A 1G3IA 4PGMA 3YASA 5EHXA 4K6CA 3ESBA 1DHRA 4OHCA 2C29D 4XLLA 1XB2A 5DWQA 1XTQA 3A1EA 4NZPA 2OT3B 1A4IA 2YXDA 1Z5NA 1ZWLA 1U6IA 5CLHA 5JMWA 3KJXA 4HX5A 4MV0A 3MD9A 5IKEA 3BD8A 3EQ6A 4R3WA 1JIKA 1ZD5A 4FMDF 3Q87B 2XLCA 5K99A 2VPWA 2Z5FA 1QHGA 4IH4A 5ICSA 1K5GA 2IGBA 3FCAA 4YCAA 3RAFC 1TLFA 1WXWA 5AHKA 4PFJA 5EG5A 1ID1A 1T4MA 1Y4ZA 5EAIA 5FWDA 4L5AA 1AUVA 4UU1A 3V2GA 3N2YA 3WAGA 5K2OA 2JH9A 1ZLXA 3A4TA 4OB7A 2BC9A 4JP8A 2PH3A 1T2EA 1RBZA 4MO2A 3QG1A 3KYJB 1AXRA 1KNXA 2WAOA 3INGA 1DKMA 3HPQA 3LC0A 1PR5A 3KJIA 1AHHA 4OV6B 1AG9A 1QKJA 1HTTA 3KXDA 1G5PA 2XHZA 3AFMA 2XECA 2I67A 4AJNA 3DBHA 1NUHA 4AZWA 2QB5A 1HY3A 3KTAA 2CKDA 2VDMB 1FRNA 1UJBA 3F5MA 2GM3A 3LKVA 3OUZA 5AOBA 3BXHA 3Q3HA 1EUDB 2CEAA 3HL4A 1AH2A 1H85A 2IYWA 2ZDGA 3IBYA 1CNMA 4LAFA 4MDYA 5L7YA 2M6KA 4E2YA 4PO8A 3VZRA 1OXVA 3B7WA 5HF6A 3LLMA 1RVDA 3S40A 1EM8A 3O31A 5ECGC 1WKCA 2YJ5A 3RU7A 4W5NA 3EOBI 3IDSA 4OF4A 5ARCA 3T1OA 4BBJA 1WUIS 2FPXA 3ABSB 5DNWA 3L0ZA 4RQTA 2CUZA 3NO4A 4I4TF 4KWIA 4YV2A 3U3JA 4E08A 2Y2VA 5KU1A 5KOIA 5EIOA 3IKVA 4XUGB 4W1PA 4QELA 3QVLA 3VPDA 3KPUA 3GAZA 1VTKA 5K03A 4MH0R 2PGOA 4R0VA 5B6IA 1VL2A 1GPDG 2XTJA 1NVTA 2XWPA 4A36A 4WT7A 3GQVA 1BVUA 3A1NA 3AG6A 4FJ2A 1JUDA 4XASA 2JATA 4NYIR 1O7JA 3H5LA 2PUJA 2ZJOA 3MJHA 3NFRA 4EFNA 1NW6A 1GKIA 2BHNA 2NU9A 2AEMA 4YMIA 3EVFA 5JE8A 2IX3A 4K8RB 2X9LA 2FZGA 3REOA 3TQTA 2WWRA 5M2QA 1QH9A 3SQWA 4KI0A 1VP3A 3QV2A 1KJ9A 5ESXA 1OIWA 2REOA 3TTXA 2Q27A 5JS7A 5DI3A 3EXFA 4ICIA 4Q7JB 4E1BA 3GLGE 5BNWA 4DLSA 3LMKA 3R6GA 4UM5A 2HJGA 3VC1A 2EP7A 3Q7SA 2BFBA 4UU8A 4ZOLB 1C7EA 3RJMA 5HX7A 4HX2A 4JXXA 1EFCA 4OFZA 1NPDA 1C9MA 4WCDA 2RGDA 3PVSA 1VE9A 4XOUA 3V8BA 2E37A 3KP1A 4DV1B 2VK4A 4E5PA 2W0SA 4DV2B 2E0IA 2RARA 3GH1A 1IHXA 2J59A 1GL9B 3LUPA 3TZBA 1N57A 4A92A 3BMCB 1GQOA 4YK7A 3GUHA 5ALYA 1WP9A 1N75A 2QI9C 4R7GA 1DX4A 1NUTA 3BDVA 3MD0A 2XXAB 2BH2A 3NMUF 1U4SA 1LF0A 1RZRD 3BE4A 4QLAA 1B1CA 1NVVQ 1EWRA 2I7VA 4NONA 4DMUB 1GEEA 3QRWA 1S02A 3EF0A 3A9WA 4D3XA 4DF3A 3GFGA 4BX3A 3HCCA 1U1DA 2FB9A 2RGNC 3LNTA 3WYGA 4B76A 1FFEA 2NM0A 3MOSA 5DE3A 5I5EA 5KS2A 3T7TA 1FW8A 1RHUA 1Q95A 3FETA 1H42A 3VBCA 4MDEA 2Z4TA 4D6PA 5JAZA 1BIFA 4LOHA 1HI9A 4M1EA 4P3PA 3QPWA 3SVTA 3DOJA 1G20B 2XJ4A 3ESYA 3I28A 3JD3A 4HNSA 4K9OA 2QIPA 1ILWA 5KJ1A 2E6KA 5IKOA 4FT4A 1N7JA 2IYSA 2W6QA 3ZNNA 4V1CA 3U81A 1FC0A 2QK4A 1QANA 1ECLA 1QO9A 2E18A 4PCLA 1CUIA 1FXWF 2QUAA 1S89A 1N2GA 3MCWA 5JIBA 4HNTA 3LC2O 5KVVA 2R2AA 5FNVF 3IGFA 2TRSB 4Q1DA 4CJXA 1TUIA 2ATEA 2IIBA 4EI2A 3H2GA 2A88A 2ETXA 4K05A 1Z39A 1YI1A 2DSTA 1H2EA 1XDWA 3L04A 4S2UA 2Z08A 1NX6A 5HA5A 3TW6A 4TXLA 4ZK2A 3LTEA 1W76A 4KH1A 3LAWA 5LVAA 4FN4A 2X1MA 1ESCA 4UARA 3VHQA 4GM0A 4EA8A 4YRIA 3E4DA 2F62A 1KVQA 2A0WA 4I5EA 1Y5MA 4M8IA 3B8HA 4OPMA 4D98A 5CFPA 3ZJTA 1OYVA 3C1OA 2H57A 2JLRA 4K40A 1JT2A 2BM1A 2VZ9A 2H1HA 6ADHA 4WV3A 2OECA 4HDKB 1KOGA 2O0HA 4IZ6A 3PT5A 4ZGGA 4JBWA 2GBCA 4KEAA 1K5PA 2VUHB 3TZEA 1B6GA 4BZZA 3ANSA 1OU4A 5TY0A 1X1AA 2AOVA 2W6NA 3FVQA 4LOKA 4OXXA 3UAZA 5KUTA 3F3KA 3UPUA 5L4NA 4HGZA 1V1RB 4CGZA 3LQRA 3QLUC 5GMOA 4BEWA 1LDGA 3EPLA 2X77A 2YYSA 2GJ9A 1OWLA 2C07A 1Y63A 2Y1GA 2F4NA 3L9WA 4O2BA 2VEDA 3WLNA 4MMXB 1DX6A 4E7OA 1PJZA 5TMEA 2OVBA 1USIA 3AI7A 3C45A 2HLPA 3T9AA 2VO1A 3O8QA 4QUDA 4YPOA 5TEWA 3UN1A 1A97A 4M0EA 4EW1A 1CEQA 3KOMA 2VJCA 3K9BA 4HUTA 2J30A 1PX2A 3IIMA 4M7OA 1T5LA 2NOAA 2PD6A 3FSGA 2HRCA 3NAGA 2WV9A 4A0GA 5IULC 2I2CA 1YRBA 1D2MA 3V2IA 2QENA 2YY5A 3G5AA 3VDRA 3HCWA 4FCTA 1XA3A 3F6PA 4DSZA 4CM6A 4S35A 1SVOA 4PICA 4JVMA 1WXIA 4BDSA 4RX1A 5BV8A 1OXSC 3HN7A 3DVAB 2QVBA 3E58A 2XZTA 2R8RA 1Y8CA 3C15C 3E8XA 3L84A 4IFBA 4Q12A 4QODA 3GLFA 1G4AE 2Y1FA 4JUCA 1JBEA 2CNKA 3AHDA 1CDEA 1LBSA 1JG6A 1P7WA 2BV3A 4LPKA 3RANA 4X6XA 5IFLA 5CFQA 5ILOA 4Q4JA 3Q6IA 2YWEA 5CDUA 1S1CA 1M6VB 2ATVA 2CLKB 2IITA 3K1AB 4MWEA 1VBKA 4LE2A 1MXFA 2Q3EA 2Q2VA 3FRJA 4PFSA 5EMKA 3U37A 1G5FA 1RP1A 2DUNA 2JDID 3ZUGA 1Z4OA 2DBVO 4Y1RB 2VHTA 1DOHA 2DTXA 2IT1A 5LZ8A 2ZAGA 3QF7A 5DW0A 2W90A 1H2XA 2BEWB 2ZR9A 3OM1A 1O2DA 4DWJA 1WV1A 2R00A 3E3MA 2HPZA 4OBBA 3V4RA 4HLCA 5SYAA 1EFAA 4ECEA 3PD0A 4O5AA 4UVDA 4MCJA 4TWZA 4DLLA 3DXXA 3CZAA 1E0DA 2NSHA 5DPMA 4IGIA 2BFMA 2FX3A 4EPWA 2DQ4A 1D2AA 1U2DC 1XXHB 1V39A 3RC8A 2I7DA 4JXKA 3QNMA 3IMGA 1EZZA 3FJYA 4C4OA 4NJMB 3IO3A 3UT0A 2HIHA 1FSPA 4Q3KA 3GLIE 4F60A 4HFRA 1P9NA 2AD1A 2QYHA 1A9RA 3D7MA 1VE5A 4AC9A 4CRWB 4DXDA 4YAUA 1A7AA 2FY8A 3D6UA 4ILKA 4O4HF 4X84A 2ZSJA 3QVVA 3RK4A 3EEYA 3MWFA 2GCOA 1LJ8A 3NRJA 2Q1UA 5DK6A 1G8MA 4ZVMA 1ZIOA 2XUKA 5B3AA 3S68A 1YCDA 2PD3A 4BV8A 3QUBA 4C2BA 1RPZA 4D4IA 1X2BA 2Q6LA 4DIDA 1M54A 3C1TA 1JU4A 1NYLA 3CHYA 1SXJB 4Q6WA 2Z6UA 2VT7A 2QTMA 2E4ZA 5HBGA 2GFHA 3UJPA 1B7GO 2QDKA 3PHLA 3LUFA 4TTPA 4B2PA 2TMDA 4TL7A 1R0SA 5FWXA 1P7VA 1SC4A 1PN3A 2PSJA 1V1JA 2GHRA 1XZBA 4RXMA 5DYGA 2EEPA 1NVWQ 3DLPX 2L17A 3KLOA 1ITZA 3FROA 3KZKA 2JLXA 4UD2A 1TW3A 3SEZA 3G6KA 5K0EA 1JA1A 1MB0A 1E2PA 1MO5A 3TOVA 3UVEA 1BKSB 1NFQA 3U9LA 5THQA 4QLBA 3G2QA 1M74A 4PV7A 5DRTA 5TF4A 2Q2QA 4CR6A 4AG5A 4Q24A 3D2AA 1PSZA 1TCVA 3LK6A 5BNTA 1YB2A 3U39A 4E1AA 4KODA 3GGDA 3BE5A 2V9ZA 3HDTA 4IVNA 4PYRA 1AURA 1GXSB 2PMKA 1WNFA 2VPPA 3JWPA 3I0ZA 4MLCA 4MP6A 4D57A 1U0EA 1YO6A 3U44A 5EP3A 2GPNA 3H2SA 1GPWB 3HC7A 3ABIA 4TRRA 3ZHOA 4QJ3A 3T34A 1T5OA 1Z4NA 2WKRA 3D3QA 4BKOA 1OH6A 4FTWA 4WKNA 3AJDA 2PJDA 4RTJA 2DSNA 1W5SA 4OMCA 3GH3A 1FU8A 1J2JA 2P3QA 2RI6A 3NHRA 4M0FA 1LPOA 1XRSB 1CE8B 1Z22A 4Y6LA 4JSRA 4Y2JA 5FOSA 3L7NA 1KYQA 1Z28A 3HV2A 3PD1A 3LQ4A 3RTEA 2A9JA 4CV2A 4R1TA 2OHFA 5DYNA 4L27A 4YP0A 3LPLA 5DMXA 5CYGA 3DTYA 1YXMA 4MO9A 3WGGA 1XEWX 2BCGY 4PHGA 4B31A 2DUUA 2O3QA 1ISRA 1OBOA 3LHDA 3NRCA 3V9AA 3W4IA 1SK9A 4EUNA 3S1LA 4P38A 1E1RA 1ESDA 5JS2A 1KMNA 4OB8A 2Z83A 2NZUG 4ETMA 3ID6C 2YWFA 4IH1A 5LZ5A 2YS7A 4WKBA 1H2FA 3LS2A 1JHUA 3NH6A 4XLTA 3AETB 1T4DA 5ALWA 3IP6A 2IW3A 4KXQA 3OA2A 4IRUB 4XWOA 2ZVQX 5K8TA 1JSCA 3HXOA 2VPIA 3TW8A 2A3NA 2FW0A 3T9BA 4WBNB 1EK1A 3OY7A 2VSNA 1UZUA 2NAFA 4Z7QB 3F6CA 4KDRA 3T54A 5GJBA 2WNIA 5CA1B 1TT5A 2EKLA 3UAYA 4JT9A 4RD4A 1KO1A 3H3JA 2P4QA 3Q0TA 4YJ2A 1JMYA 2YWRA 3Q9NA 5BQ5A 2CDRA 4PS0A 2Q5JA 3EGIA 4BVAA 3DHNA 1JFFB 3FHLA 4INOA 5FWYA 1P2VA 2FP4A 3PYLA 4QBTA 4XOIA 3G8CA 4HGNA 5BQPA 3B9QA 3GRKA 4QQFA 3V1LA 4E4YA 1AKQA 3LPMA 3O8DA 4YV0A 3BGVA 4HGYA 4ECAA 3WNCA 4NPCA 2C77A 2V9PA 5CNIA 4R8VA 1USGA 4I1VA 4TV9F 1Y1PA 5HIJA 3UG7A 3WMEA 2VAXA 1YBAA 2GBGA 1SXJE 4R68A 2VBCA 4PZLA 3E81A 3PITA 3TEMA 3QJGA 2PAAA 4YI3A 1C8LA 1P1HA 3HU3A 4ZEOA 2JG3A 2G9UA 1KDTA 3N8HA 1PDWA 2DCUA 3IIKA 3FMPB 4J6EA 1KJIA 1AS3A 1GPAA 3FCUB 2JIOA 3NW9A 3AVTA 3FVWA 2Q5CA 1E9CA 4H0NA 2W2LD 1IZYA 4XFDA 4DT1B 2YWCA 5ALUA 1YI0A 4EB6A 2X42A 1NSYA 1K92A 4W6QA 1ZA2A 4N3CA 2NT4A 3Q7PA 3KU4A 1ODCA 1WA5A 2G83A 3O1IC 3A6JA 3EXFB 3HXMA 3ONWA 2VKQA 4K6MA 1HK7A 3TZLA 3AUAA 4MRNA 3WLTA 4JWKA 4QXAA 4L0MA 3FNIA 3U4QA 1ORRA 3M34A 2RAUA 3NP7A 4DIFA 1QYCA 1XN1A 1GAJA 3D0KA 4EA9A 4D0GA 4F2GA 2BEWA 4FBMA 1D2EA 2WSBA 2HT6A 1T5SA 2YOHA 2IGTA 3K8ZA 1GOTA 1EX6A 1Y48E 3EMKA 5H59A 4G2TA 3TLEA 4D4LA 3KKMA 2JHCA 4UM9B 4PYNA 4CFYA 2Y4NA 1KE1A 4ARCA 3N2ZB 3GA0A 2WDPA 2QVLA 1PUXA 4MQMA 2XXAA 4WFQA 2O8EB 3EA5A 4NS4A 1JNYA 3KOUA 3HVIA 3QELA 3K1ZA 4IGEA 4MKRA 2CKMA 1N0IA 2HQOA 3PKJA 4PIMA 2JLBA 3DL2A 3N53A 1NBIA 1OPRA 2FSSA 2H1LA 1RACA 2PT5A 3FVTA 5HQTA 2KSQA 1HT2E 2JPDA 4QDOA 2DZDA 4UHHA 3UCEA 1Y1TA 2B4RO 4PC2A 1VHWA 2GNOA 1T26A 2LKDA 3DBVO 8ADHA 2OAQ1 2AQHA 4GBMA 3CBGA 3PQ4A 4ML3A 4ZRNA 2OXTA 3R75A 3AONB 4YCLA 3OKFA 3JAKA 4OKIA 1CJUC 5TQ0B 3W0LB 3QFCA 1ZD1A 2BFOA 1QGUB 3KWFA 3KKZA 4KMSA 3FJOA 4MUHA 4N8EA 4RESA 5IKPA 1OCEA 1SIWA 3JARB 2ZPAA 1U8FO 1HLPA 2WM3A 1SG6A 2CMFA 3FR7A 4WOKA 2R68A 4EUEA 1MDFA 2J0QA 1PP4A 1EP3B 1ZRSA 1XTUA 4HGOA 4QVKA 3QF4A 2GAAA 1Z2EA 4MW5A 3BXXA 5BY2A 2E89A 4IIJA 1KP9A 4AVYA 1Z4KA 2L0XA 1JR3A 2O05A 4JLAA 3W8NA 2ZZNA 4OXKA 2ZSEA 2G76A 2VBFA 5EPEA 3NM4A 2ZS8A 3STVA 1FS5A 5JAUA 1J0CA 2WD8A 3BMXA 3FF4A 3QX7A 3IAM6 1VKOA 1PTKA 4RKWA 4EY3A 1MKYA 2IRWA 1DQNA 2FX5A 1E2LA 5TS2A 2GETA 4CLRB 1IONA 1ZJYA 8LDHA 1LD3A 1AT1A 1N2CA 4UM7A 3V7FA 2A5GA 1WOYA 1RWKA 1FMTA 4QYSA 1X19A 5IJ0A 4ZAZA 4BO9A 1DDOA 5K0BA 3E48A 2W42A 1D1TA 4OI0A 3B3QA 1T9CA 2R7AA 3NIGB 2W2KA 3Q2KA 1SZPA 2QR2A 1ZIXA 4KO2S 2RB5A 3U3OA 3JVEA 4EW2A 4YRSA 4V0SA 5DM0A 5A4FS 3DLAA 3LDGA 3GI1A 1TX4B 3JYHA 2JLSA 1OAOC 3B5JA 1RAHA 4ND8B 1NN5A 4TV8B 4EGQA 3HA5A 5T6MA 1Q7TA 3HDHA 1BNCA 4IGAA 4IKPA 1NMYA 5F76A 3RHZA 4F06A 4Z3KA 4WGGA 3LBFA 2G1AA 2MTBA 4TXNA 1MVOA 1C2YA 3AHCA 3COSA 1FLNA 3PIRA 4W99A 1U9CA 5D00A 3T5BA 4BO7A 1ZW6A 3VKGA 4LOAA 4EX7A 1H8EA 1TZJA 2IYVA 1YL5A 2IKQA 5E3JA 1G6KA 3KG2A 4FSHA 4G81A 4DYVA 3BT7A 2WKQA 1NVMB 2GI4A 2GBPA 2QPTA 3RODA 2PPLA 3R4CA 4EJSC 3ZE0B 3AIMA 3IDQA 4A26A 4QPDA 4ZYLA 5JPIA 3DVQX 1XTJA 4Q37A 1VCOA 1WXXA 2PX0A 4L22A 3NC1C 4A0QA 3C7TA 2C7VA 4B7CA 3DEIA 1HPLA 2O3SA 3CJTA 4G26A 4ZP1A 4QUKA 4WEQA 5C2JB 3SZUA 3VZSA 1ZOOA 4BNKA 3G79A 4PE5B 4Q6BA 4G6ZA 3K0BA 4PRKA 1XZHA 3LYLA 3D64A 2IH5A 1URPA 1YB1A 3BIFA 4PONA 2D00A 1OVGA 2BMAA 4ZALA 2Q1SA 3CX7A 4BGVA 3B85A 1NOKA 2BJHA 2VNSA 1RJ9B 4BFSA 2UVDA 4O2BB 1SU4A 4NLLA 2W98A 3VR3D 1DJOA 2OYRA 3C5EA 4ETIA 2M2IA 2ZRMA 1TF5A 1BXRB 4L3VA 4F9FA 5T4HA 2LTAA 3QOWA 4C6TA 4E5KA 1KH1A 3LF2A 2NXEA 5CU7A 2H4FA 4HRAA 5C4MA 1VGVA 4EZBA 4C76A 4F5ZA 2E4YA 3VBEA 3I2HA 4IDQA 1M2KA 2EFCB 5DGIA 3L8CA 1IATA 3QMMA 5HF5A 3WE7A 2ZULA 3KNZA 2JIQA 3NOOA 1OE0A 4HRVA 5ALQA 3ZE2B 4EZEA 5JDIC 5A4JA 1H4QA 1R0CA 1OJ7A 2GMWA 1C3XA 4GQAA 4RPHA 4X20B 1A2BA 2DUJA 2ZYGA 3BFPA 1EK2A 4TKLA 1M66A 3T99A 4LSZA 1IM2A 4DLRA 5C1DA 1DUIA 4ENVA 4G1CA 4HY3A 3TJZA 4ZZIA 5FWNA 1WY5A 2FPUA 2DOKA 5EXXA 3U4DA 2WSMA 1FRQA 4LXQA 4KRGA 4A8JB 3WADA 3I62A 3JD2A 2O7QA 3STWA 1GPYA 1FSFA 4DDUA 4EB6B 3ZDXB 1V3TA 1Z6QA 4RO0A 5IYZB 1PO7A 2EWMA 2C3YA 2P6MA 3BZWA 4X9XA 2JEZA 2WTNA 3QVGA 4JSTA 4JY7A 2BI4A 2R6HA 4MA4A 1XPUA 3NPAA 4UBOA 1NJGA 4GDMA 3FUVA 4OYYA 5THXA 1DIRA 3H2YA 2WYIA 3V6MA 4OMDA 1EX7A 1INLA 3DE0X 3NEAA 4JJ4A 2C8KA 5K5EA 4CEJB 1M0EA 4YRMA 3BGWA 4YP1A 4HFJA 1PHRA 5TDHA 3UAOA 4B84A 1U0NA 1SKUA 1UDWA 2CYAA 2JAQA 2X22A 4BKRA 3Q85A 1XDGA 2BPOA 2OSVA 3NBUA 4G5YA 4XPIA 3WGVA 1YQ9A 1DU4A 2LUOA 3BMOA 4N6NA 4B73A 3SR0A 2VOEA 3FFTA 2WILA 3E5RA 1Y3IA 3M4JA 3R3SA 1G8AA 3LLUA 1ZI9A 2J48A 3CPSA 3QOXA 4DQXA 5CBPA 3O2JA 4E51A 4DJ5X 4DM7A 2P9HA 3OQJA 3CSSA 5AQEA 3TECE 4J1TC 5FA8A 2FWJA 3S2ZA 1V7QA 1Z2DA 2BMJA 3DBIA 3E3NA 4ZMBA 1IUPA 2GN9A 1XJ5A 2B4KA 3A37A 4Y6QA 2Z3WA 4PR3A 4F85A 4YAJA 2GXUA 1ZR4A 1J8VA 1UT8A 4J2HA 4G0YA 1P1BA 4NARA 2CJFA 3CNHA 1W44A 3A1WA 4R6XA 4RLQA 3ZHUA 5JNTA 1W19A 3K9LA 3K9HA 2Z4SA 3THWA 1PZNA 1EQ2A 3IUNA 5BSEA 5BSFA 1WDWB 4CT5A 4KR2A 2IKSA 4FKZA 1GNSA 2IC5A 2XMCA 2QD4A