1CPYA

Site-directed mutagenesis on (serine) carboxypeptidase y from yeast. the significance of thr 60 and met 398 in hydrolysis and aminolysis reactions
Total Genus 123
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
123
sequence length
421
structure length
421
Chain Sequence
KIKDPKILGIDPNVTQYTGYLDVEDEDKHFFFWTFESRNDPAKDPVILWLNGGPGCSSLTGLFFALGPSSIGPDLKPIGNPYSWNSNATVIFLDQPVNVGFSYSGSSGVSNTVAAGKDVYNFLELFFDQFPEYVNKGQDFHIAGASYAGHYIPVFASEILSHKDRNFNLTSVLIGNGLTDPLTQYNYYEPMACGEGGEPSVLPSEECSAMEDSLERCLGLIESCYDSQSVWSCVPATIYCNNAQLAPYQRTGRNVYDIRKDCEGGNLCYPTLQDIDDYLNQDYVKEAVGAEVDHYESCNFDINRNFLFAGDWMKPYHTAVTDLLNQDLPILVYAGDKDFICNWLGNKAWTDVLPWKYDEEFASQKVRNWTASITDEVAGEVKSYKHFTYLRVFNGGHMVPFDVPENALSMVNEWIHGGFSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE CARBOXYPEPTIDASE
publication title Site-Directed Mutagenesis on (Serine) Carboxypeptidase Y from Yeast. The Significance of Thr 60 and met 398 in Hydrolysis and Aminolysis Reactions
pubmed rcsb
molecule tags Hydrolase (carboxypeptidase)
total genus 123
structure length 421
sequence length 421
ec nomenclature ec 3.4.16.5: Carboxypeptidase C.
pdb deposition date 1995-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00450 Peptidase_S10 Serine carboxypeptidase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.410 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 1cpyA02
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1cpyA01
5D6OA 5HQ3B 1H2ZA 3TGLA 3V9AA 4C6HA 2QJWA 1UKCA 2AJCA 4KE9A 3O95A 1XKTA 1WB6A 1IVYA 2WIJA 3A70A 4PSCA 4GXNA 5EIEA 2QKYA 2XMSA 4YK7A 2DFPA 1AMNA 5HK9A 5AKLA 1EHYA 3BDIA 2YH2A 5LLSA 4BYMA 3RM3A 3OPMA 2XUPA 4LHEA 4OU4A 5DNVA 2GYUA 3C6ZA 3V1NA 1XKLA 1CUXA 4FTWA 1ZGBA 1OXMA 3O0DA 2HDWA 1MX5A 1EDBA 3L1HA 2W6CX 4EHBA 4IH4A 3I28A 3FNBA 3KXPA 1QFSA 4ZGBA 5A7HA 1ISPA 4B6GA 2O2HA 4WDQA 3WLAA 3H04A 2QRUA 2ZYIA 2D5LA 1E8MA 3Q8WA 4HXFB 4BVKA 4BP8A 3H1BA 5FKJA 3WI7A 2Y2VA 1E5TA 2Z3ZA 3HABA 2HA3A 5T4BA 2VJDA 4QEKA 2AJDA 4ROTA 2QR5A 1ZD5A 2XQJA 4JUIA 3LCRA 1YCDA 1DU4A 5JALA 3A2LA 4H7KA 4BAUA 3WA7A 1MX9A 5ALEA 5K3DA 4S0XA 4A16A 3C8HA 3BWXA 2C7BA 1A8UA 4HRXA 2WQZA 5KWIA 1SCQA 3I2HA 2CMFA 3FSGD 4QA9A 2QS9A 5LZ5A 1AUOA 1B6GA 1AGYA 4AMZA 2ECFA 1WPRA 3I2IA 5AKEA 1SCIA 2BGRA 5F4ZA 3STWA 1QIHA 3BDVA 4BP9A 1W52X 2WHQA 1TQHA 4KR0A 1BE0A 4QLAA 1QTRA 5HCUA 1EB9A 1K8QA 4H18A 5AOAA 1KU0A 3QMVA 1BCRA 4FNGA 3IURA 1G5FA 4G4GA 3M83A 4CCWA 5ALJA 5FLKA 4P9NA 2GBCA 4ITVA 5CT6A 2EDCA 1DQYA 3QITA 3AZQA 4RE6A 2WG2A 3AUKA 4DM7A 1YSCA 1W4LA 5SYMA 1OILA 1YAHA 1R88A 5FPQA 2PSDA 1R9NA 3R3UA 4B0OA 5AK3A 5LP1A 3BL8A 5AKIA 2XMBA 2HM7A 3HACA 1G42A 1W76A 2XQFA 4W1SA 3O4GA 1FFCA 5HZGA 4Y2RA 2OGSA 4J0IA 2B4KA 2PX6A 1EH5A 5FPPA 4NZZA 2WTNA 3G0DA 1E3QA 5DWDA 2BUCA 3DKKA 1TCCA 5C81A 2ZJFA 1QIJA 1EI9A 2HA0A 4UUQA 1CRLA 3C5WP 1WHSA 5ALHA 1CFJA 2OAEA 2WHPA 3H2JA 4FDMA 4BDSA 4B82A 3FAKA 2XUGA 2HFKA 4O08A 1Q0ZA 4UBLA 3TEJA 1LPNA 1PV1A 3QMWA 1XRRA 1UXOA 1CUBA 2R11A 4Y2UA 1ZI6A 3BIWA 1A7UA 5E4TA 4OYYA 4X97A 4BBZA 3D0KA 1UKBA 4BAGA 2VATA 4DSZA 2GYWA 1BEZA 3F8SA 3PUHA 1CQZA 3LLCA 1UFOA 3BJMA 3NOXA 5AIAA 3DD5A 3DKRA 1XQYA 2XLBA 4EBBA 1XRLA 2C5FA 1WOMA 5AIBA 5JZSA 3FBWA 5DTIA 1HQDA 1TKRA 3R3XA 2RIPA 1RYYA 5ALDA 1NU8A 3ESAA 5BWBA 4L0CA 2WKWA 4K5QA 4AXBA 5AKKA 3VJMA 4J03A 2XUKA 3PDCA 4BATA 1UOOA 4N8SA 1CIJA 4E14A 3FWHA 4INZA 4OB6A 1BN7A 3R3YA 2BJHA 5HF6A 1RP1A 4IO0A 2HADA 4I19A 3EQ8A 4MYSA 1YS1X 5LYYA 3WIOA 2H7CA 2ORYA 4PF1A 5AM3A 5FOQA 3G9XA 3KOOA 4BRZA 2WLSA 3P2MA 4DMKA 4KRYA 1CUIA 4B85A 4Q3KA 2H9YA 1XZDA 1VXOA 5AM4A 3M3DA 3JWEA 4EB0A 1PJAA 1N1MA 1A88A 1VXRA 3F9CA 4G9GA 4GDMA 4AB1A 1GQSA 4X3CA 4W9RA 5CRIA 5DNUA 1CUSA 2R8BA 1KU6A 2QOEA 3CN9A 3H0CA 1ZI9A 1XZAA 2ROQA 3E0XA 1XZMA 3SC2A 1IUOA 2OCLA 3D2CA 1JMYA 3D59A 4H0CA 1R50A 1HBJA 4NVRA 5C8ZA 1QZ3A 4ARAA 2YASA 4AN1A 3HC7A 1THGA 1DT5A 3PFCA 4CG1A 4RNCA 2WUFA 5E4YA 4UPDA 1GPKA 5KBYA 4C01A 4UHDA 4Y2VA 3W04A 1ZD4A 4M0MA 5FV4A 2ZYRA 2Z8XA 1YA8A 3Q0TA 4J7AA 2B9VA 3BF8A 1FFEA 2ZYHA 5AM0A 2C0QA 2PM8A 3QPCA 4PW0A 1W6RA 3WZMA 3VXKA 2J4CA 1XZGA 4YASA 4MJ3A 2VT6A 4L9AA 3ESCA 2WTMA 1XFDA 4H7JA 1H2YA 1CEXA 1IZ8A 1LPPA 4GECA 4H77A 4Y2QA 4K6HA 5HFNA 4GI1A 4Y2XA 4I3FA 3WJ2A 3T52A 4LYEA 3G0IA 1UK6A 4JYPA 3FLAA 3VVMA 1K6EA 1TAHA 1JJFA 2NW6A 4PNZA 5FP0A 4X94A 1QIFA 2CKMA 2HU7A 5AK4A 5JANA 3STTA 1AX9A 2WFLB 2DQYA 4XWGA 4DYHA 5EIAA 2XI4A 1QLWA 3G0GA 1VLQA 4F0JA 3D5EA 5ALQA 4EUSA 1JI3A 1ZGCA 1XLVA 3BF7A 4N5IX 1QONA 2I78A 5D3KA 3O9MA 2PVSA 4DNFA 1U4NA 4ZWNA 4KE8A 1PFQA 1TIBA 4BC0A 2XQGA 2VJCA 3D2BA 1ZICA 4N5HX 2HA4A 2WU4A 1MU0A 4CFSA 1TCAA 5CXUA 5D3ZA 3SK0A 5EHNA 3STUA 4K6GA 1JU3A 3K2IA 1XROA 1L7AA 5LZ8A 3E1GA 3ILSA 3EBLA 5AH0A 1H2WA 2XQIA 4FLEA 4B84A 4KYVA 3QMMA 3G9TA 2G63A 5T4EA 4J0HA 3IULA 3WWDA 3VVLA 1J2EA 1XQWA 2PPLA 3ANSA 1YASA 1XRMA 3H19A 1MX1A 1CPYA 2WJ4A 2WUGA 1G66A 5E4JA 3I1IA 4BDTA 1K63A 4DNOA 2DHEA 5JD6A 4G8CA 1F0NA 3QH4A 1ORVA 4G9EA 2J3DA 4EY8A 4UHCA 3OM8A 2C5GA 2JIDA 5T4FA 3WL8A 5LKRA 5BOVA 3V48A 2BKLA 1JFRA 4IQ4A 4WJLA 1LBSA 2WILA 1CUEA 2GYVA 3NUZA 4X71A 1BCSA 4LXHA 1O6GA 3IA2A 1ZIYA 4ZREA 3EIOA 2G5TA 4BTVA 2LIPA 2RI6A 1THTA 2ZSIA 4H7FA 3FLEA 4HXGA 1UWCA 2PUHA 1AQLA 1BU8A 1XZKA 2FUKA 4TPKA 3JW8A 1VA5A 1A8QA 3VKFA 1WB4A 5JATA 4HRYA 2AJBA 2CUTA 1VOTA 3LS2A 4BCBA 3DEAA 4Q3LA 1USWA 4C87A 2X5XA 1MNQA 1E8DA 2V96A 1BROA 1O6FA 5EHQA 3TJMA 2RGUA 1LBTA 1QOZA 3FYUA 4WY8A 4FLFA 4OPMA 4LIPD 2O2IA 3R0VA 3AIMA 5ALKA 5JZBA 1E66A 5CT5A 4ETWA 5AOBA 2IIVA 2IX9A 1QO9A 3IUNA 3WYDA 5KWJA 3WZLA 3QYJA 5A71A 3WK5A 3ZV7A 4FFWA 5EGNA 1LPOA 1UK8A 5AP9A 3GELA 5JAPA 4E46A 3YASA 3WKEA 3V1KA 3F97A 3FLBA 3AJAA 1HL7A 3WL6A 5CT4A 2WM2A 4B81A 2PSJA 3K9BA 4Y2PA 3F67A 3U1TA 2QUAA 2Z3WA 2E3JA 3KD2A 4U2EA 3GA7A 5J3JA 2VA9A 2XUFA 3I2KA 3ZPXA 4P92A 1N8SA 4QNNA 3RKSA 3EQ7A 4FNMA 4LKOA 3B3QA 5YASA 3QVMA 1DQZA 3IUMA 1LPMA 4C4ZA 2XMRA 3AZPA 4EA6A 5SYNA 4AZ3A 4F5ZA 5DLPA 3VJLA 1H23A 3I1YA 3SWWA 3ESDA 4Y9SA 4B83A 4IHAA 1QIMA 4UHHA 2VTVA 2CEKA 3AIKA 3VDXA 5ALXA 1DWOA 1CLEA 1JT2A 2JF0A 4BTLA 5KREA 2XUAA 3LIIA 5FXMA 5CBKA 1VE7A 3WWPA 5ESRA 1LZLA 2OGTA 2OXEA 4WY5A 2HA5A 5CH3A 3WKBA 1K4YA 1VE6A 2EEPA 2VAVA 4X93A 1AC5A 2WIDA 3UUEA 2G5PA 2HA2A 4DMCA 2OLEA 4XJVA 1AKNA 4UHFA 1FFBA 2XMDA 5HK8A 2IITA 1XZIA 3OG9A 5AK6A 1EVQA 4Q34A 1P0MA 4P93A 1S8OA 4F60A 2XUHA 3W2TA 2QVBA 4X6UA 2HU8A 3AFIA 1CVLA 3I2JA 4H7IA 4QWWA 1U8EA 4J0DA 5LIPA 3C6XA 5JAHA 3H2IA 5EIHA 3A6ZA 2HL6A 4RGYA 4UBMA 1MT3A 2CJPA 3AINA 3IBTA 4BC1A 4N8EA 1Q0RA 5ALNA 5I7UA 2OQIA 1ZD3A 3LIPA 4QDTA 4W1RA 2XMGA 4QWMA 4JYMA 1UOPA 3L1IA 1ACJA 1XZJA 4C88A 3TRDA 3F98A 3MGAA 2FJ0A 3H1AA 1C7IA 1ODSA 1D07A 1SCKA 1XZLA 1XZEA 4C4XA 2HA6A 3WL5A 4FFVA 3WK4A 3DNMA 1FJ2A 4AX4A 1ZIXA 1JMKC 2PL5A 5E2IA 3C87A 5ALSA 1GZ7A 1IUPA 1DWQA 2JGIA 4MQLA 5FUMA 4OSEA 1R1DA 2O7RA 2WIFA 4QDZA 2HRRA 1YB6A 4HZGA 4G1FA 5IVKA 2Y1KA 3QZUA 3DL4A 1CUWA 1MTZA 3UMJA 2Y2UA 5LZ2A 3WL7A 2PSHA 3WK9A 4J0JA 4Y2JA 2I03A 3R41A 3WKAA 1BRTA 1F6WA 3G0BA 2UZ0A 2C0PA 5CH8A 1X70A 4FHZA 3GROA 4Z49A 1MPXA 5A7GA 5ALTA 2WU3A 3N2ZB 1VKHA 5DNWA 4D9JA 1OCEA 4PQEA 5AM2A 4A23A 3IUQA 3PUIA 4X6XA 2RHTA 1TRHA 4U2DA 5JIBA 5EI5A 1ACLA 4BRSA 1IUNA 2QTBA 3MUNA 5ALMA 4HS9A 4C4YA 5ALOA 1ODTC 3GFFA 4NS4A 3MVEA 4HAIA 3WK8A 4W1PA 5CT9A 1UK9A 2W22A 2HIHA 5EHZA 4QDXA 1LNSA 3ZI7A 1T2NA 3HYSA 3WKCA 2OG1A 2WUDA 3FSGA 5ALLA 5AK5A 2VAXA 3IDAA 5FDFA 2DQZA 4UHEA 3W05A 1SOMA 3RK4A 5AICA 3I6YA 1VZ2A 5AI5A 3DL7A 4PSUA 4LXGA 4MXDA 4X91A 5AKHA 2WFLA 5AI4A 1Q83A 4YX9A 1CQWA 4J3JA 1TCBA 2BUBA 5T4HA 4MEBA 2H7XA 4U2BA 1FFDA 3CN7A 5K3FB 4RE5A 3W9UA 2J3QA 1MN6A 2BCEA 1FFAA 1AURA 3DQZA 5IVHA 2C4HA 1L7QA 3NGMA 3EQ9A 1TK3A 3FVRA 3BJRA 1WM1A 1YR2A 7YASA 3PF8A 4OCZA 2VF2A 2ACEA 1LZKA 3OC0A 2JGKA 2CB9A 3A2MA 4PSDA 3R3WA 1CUUA 4KACA 1F8UA 1CUJA 3WWOA 4HTAA 2ONCA 4Q05A 1QJ4A 4WFJA 3HZOA 1U65A 4JEIA 5JARA 4MYDA 1EXWA 2H1IA 5AOCA 3MUOA 1QIIA 2XUOA 3PE6A 2DSNA 1CUCA 5ALVA 2OGZA 2WG1A 5EFZA 4JNCA 3SX4A 2EDAA 3DLTA 1P0QA 4G5XA 4DNQA 2HU5A 1XZCA 1DINA 3G0CA 4J0CA 4BAZA 1CUFA 1SFRA 2CBGA 2WHRA 3DJYA 3K6KA 2YXPX 2OCIA 3OTQA 1Y7IA 1UKAA 1YB7A 2YYSA 1W1IA 2BAGA 4DMHA 1J1IA 3AILA 1ZI8A 4GHWA 1LGYA 4CIAA 5ALRA 1LPSA 2PSEA 4U2CA 5H3HA 4X95A 1JKMA 3IIIA 3QPAA 4H7DA 3DYIA 1EB8A 3H2KA 5AI0A 1GKLA 1XZBA 2XUDA 5I8PA 1QIEA 1EDEA 3RARA 5ALFA 5JD4A 3I6ZA 4ZI5A 2VEOA 4QZVA 1R9MA 4KRXA 2XMZA 2V98A 3FYUB 1RWQA 4OU5A 2PBLA 1FSSA 4U2GA 3WWEA 2CZQA 2HHAA 3WIBA 1XLWA 3A2NA 4GBGA 4RPCA 3FOBA 2ZYSA 5C8XA 3KSRA 4KEAA 2OPHA 1CUZA 4ZV9A 2VT7A 4KE7A 1CV2A 1K5PA 1XQXA 4N8DA 1WHTA 4G8BA 1CUYA 3ICWA 4BVJA 3WQHA 3RLIA 4B0PA 2B20A 5AM1A 2JGEA 4AO8A 1J06A 1GXSA 2ZVDA 3M82A 1A8SA 1EA5A 2X8BA 3H2GA 1W75A 1YAJA 2XUIA 1QFMA 5AKZA 3C6YA 1CUAA 2XT0A 3G02A 2JBWA 5IH7A 4NMWA 4EZIA 2WIKA 4FKBA 3ZLVA 3LP5A 1YA4A 2DCMA 3C45A 2OCGA 3DDUA 1MJ5A 3AZOA 4Y7DA 3OOSA 2P8SA 3FVTA 3L1JA 4MEAA 1LPBB 3AIOA 1Y37A 3ANTA 4QE3A 3T4UA 1Q84A 2J4FA 3S2ZA 3G9UA 4DNPA 4X90A 3H17A 4UBNA 1GPNA 1AZWA 5ALPA 4U2FA 3E3AA 4WFKA 3R3ZA 2Z8ZA 4B80A 2V97A 4LXIA 4DLNA 1F0PA 4E15A 2AXEA 3C43A 4FBMA 4AO7A 5CT8A 2VJBA 1XRNA 2Y6UA 5A7FA 2XUJA 2JGLA 1P0IA 3BIXA 4GWLA 4BZZA 5ALZA 5DYYA 5HKBA 3FCYA 5JYCA 2QZPA 1YS2X 2WJ3A 4CCYA 3ZLTA 1EVEA 2JGFA 1DT3A 1MAHA 3NWOA 1GKKA 1BS9A 4IH1A 3DCNA 3V1MA 4BCCA 2QXUA 1DX6A 2JEZA 4FBLA 4AN0A 1QTIA 5K3BA 4QDOA 4C89A 5K3FA 3QBJA 4UBIA 1NX9A 1XZFA 4X00A 4UFOA 4DSAA 4EY7A 3D4LA 4DIUA 5CW2A 2JGJA 3EF3A 5JD5A 3C8DA 4V2IA 1WB5A 2JEYA 3O4HA 4J0GA 2ZSHA 4XIIA 3D3NA 3HJUA 5AKXA 1U2EA 1GQRA 4G4JA 4UFPA 4H7HA 2WSLA 5CURA 2OQVA 2GZSA 3WYNA 4QLOA 4Y2TA 4W1QA 1P0PA 1BEEA 4FOLA 3KWFA 3G7NA 1ZD2P 1VZ3A 1UOQA 5IVIA 3CCCA 3HXKA 3I2GA 3BXPA 4Q1VA 3G9ZA 4AO6A 1X2EA 1I6WA 1EINA 1GGVA 4KAJA 4X92A 5ALIA 5AO9A 3WA6A 4KAAA 4EY6A 5K5EA 1DWPA 5AKGA 5DYTA 2QT9A 4FLMA 4JH0A 3C5VA 4CIBA 2O7VA 1VA4A 4M0FA 3C70A 1BN6A 4L72A 3F96A 2XMQA 2OAGA 2K2QB 4WDRA 1UT6A 1XZHA 3ESBA 5JAUA 1DX4A 4HXEB 4P08A 5K3CA 4J0KA 1N5RA 1J07A 3N0TA 1JJIA 5BV7A 4QDUA 1WPXA 1DTEA 3HSSA 1EK1A 5ALUA 5A6VA 4GW3A 2BFNA 5AJHA 1SC9A 2XLCA 5FRDA 1Z68A 1ODCA 2DHDA 4OD0A 5ISMA 2HFJA 1JJBA 3PI6A 4G4IA 2FX5A 5AKJA 3WWCA 5D7BA 2WFMA 3M81A 2XUQA 2PSFA 2C58A 2PUJA 5ALWA 2QJRA 2H7YA 2HA7A 1H22A 4EY5A 3G8YA 3O4JA 5A62A 3CCBA 1R4ZA 4UHBA 4X85A 3S8YA 4OYLA 1UZAA 4UBKA 2WG0A 1LPAB 1UK7A 2QM0A 3KDAA 4B7ZA 4BB0A 3ED1A 4DTCA 4GLBA 3E4DA 5AI6A 4KAFA 3OURA 1CUHA 5HF9A 4CI9A 4MQMA 4E11A 4BCDA 4BVLA 3STXA 1M33A 3IVMA 5K3EA 5BWCA 5IVDA 5CMLA 4BZWA 4HVTA 5IKXA 2PU7A 4W63A 4TGLA 1L7RA 3PICA 4TVKA 3H2HA 1VJ5A 5CTAA 1ETHA 1MO2A 2QMQA 3FYTA 5HKAA 2XE4A 3I2FA 1XQVA 4LYDA 3JYHA 3QM1A 3V1LA 1H2XA 5LZ4A 4ZV7A 2XQKA 1MAAA 3VISA 2GBIA 2RAUA 4OUKX 1QE3A 2QXTA 5ALYA 2I3ZA 3WKDA 1C7JA 2BUAA 3H18A 3KWJA 2JGMA 1R3DA 1KEZA 4CG2A 1QGED 3O4IA 3BE8A 2OCKA 1MNAA 2AJLI 1XLUA 1LLFA 3DYVA 5CXXA 2GBFA 4K6KA 3VJKA 1HLGA 4IH9A 2HRQA 4G8DA 4UBJA 1EK2A 4KJXA 4B9AA 4XX1A 3GZJA 2I3DA 4X6YA 2O2GA 4AQDA 3HRHA 4UFNA 1CUGA 1QIKA 1ORWA 2Y6VA 3DOIA 2RONA 2WHPB 3ICVA 5HF8A 1GT6A 3D2AA 5AI9A 1HPLA 1E8NA 4CCYB 3UUFA 4KE6A 4B9EA 1XRPA 4BE4A 4F21A 2XDWA 3WK6A 1NU6A 1Y7HA 2ES4A 2RHWA 5JZ9A 1JU4A 2WJ6A 2B61A 4ZXFA 3FYUC 4A5SA 1HKHA 1B41A 2D0DA 2Q0XA 4L3WA 2QUBA 1QIDA 1G4HA 1ZJ4A 1XRQA 2WFZA 5CH5A 5AM5A 2GBGA 5HFAA 1E89A 2WIGA 4AMYA 1CUDA 3WK7A 4BE9A 1T4MA 5EHXA 3GBSA 3HI4A 4OB7A 4ZRDA 2XMCA 1IZ7A 2BGNA 2PU5A 3STYA 4ARBA 3W9BA 4AZ0A 4M0EA 5DJ5A 4WFIA 1X2BA 4PV7A 5LZ7A 4XVCA 3PFBA 1EDDA 5AI8A 2ZJ6A 2AJ8A 4YPVA 5HF5A 4I4CA 5JADA 2VQ6A 5DTJA 3DOHA 1WCYA 5DYWA 2PKYX 5K3AA 3DS8A 5AKYA 6YASA 1ZJ5A 4Q3OA 4FWBA 1EX9A 2DHCA 4WCVA 2V9ZA 3R3VA 4UBOA 3X3HA 2GZRA 2XB6A 3HEAA 4MWSA 2G4LA 1QIGA 2ZJ7A 3C6BA 4H35A 3STVA 1HDEA 2FJPA 3IB3A 3WJ1A 4FMPA 1N5MA 5C8VA 1C4XA 3ZLUA 1CR6A 3W06A 4CG3A 3B12A 3D7RA 3B5EA 3I6MA 3CXUA 3HLKA 2WUEA 4Q82A 2ACKA 4Y2YA 4DGQA 5JAOA 3PF9A 2DR0A 1IMJA 3GUUA 4GEGA 1CUVA 5I9IA 5LZ9A 4MWTA 4X7BA 4PO3X 4EY4A 5ALGA 4H7EA 3QPDA 3U0VA 2VSQA 3FCXA 3ZWQA 5AHXA 5LKAA 3IUJA 3WMRA 4Y2SA 2X76A 5JASA 4DMFA 5C7YA 1QO7A 1ZOIA 4OB8A 3O9VA 2VJAA 2Z5GA 5A2GA 5HQ3A 3R40A 4K2AA 1GPLA
chains in the Genus database with same CATH superfamily
3BL5A 3G5LA 2QUIA 1HC7A 3UJBA 5HQ3B 2YWHA 4B3HA 4MVJG 2RAVA 3GLFA 4FW8A 2A9HA 3T9AA 3W6ZA 3JQ7A 3PGKA 4PZLA 4ZVKA 4L2IB 3V9AA 3N76A 4DQLA 3G0OA 4EF6A 4P4SA 1TJ3A 1UKCA 3L43A 1SU7A 1DSSG 3KYDA 1ENZA 1XD2B 1MXFA 1ZS9A 2XD4A 3H9UA 1H4SA 4XGNA 3RD5A 1R0RE 4M9CA 4OOFA 3Q3EA 4YUWA 2HLDD 1U2QA 5DWVA 1FF9A 1R0BA 1G3UA 2CL6X 4GI2A 4GXNA 4L51A 2HIAA 4EFEA 1T0UA 4NOMA 4PSVA 2E5LO 2QKYA 1KRXA 4UD6A 4YK7A 5G40A 4LYHA 1IOVA 2GHQA 2XB2A 4J3FA 4Q4AA 4MMXB 4X7RA 5JWHA 2DLDA 4UMDA 1TUBB 1AGRA 2D1FA 3A0HZ 3UT5B 4OI4A 2YBDA 2EC5A 5AKLA 3KDSE 3SXUA 4BV8A 3TLYA 5ABPA 5M5BA 4TWIA 1EHYA 2QU8A 3Q7TA 4B5LA 1J2RA 2RN9A 3PDWA 4BYMA 4RM3A 3VHQA 1DIGA 4A92A 1ZMBA 4JELA 3PFIA 5EJAA 3JQ8A 4HR7A 4LBYA 5K01A 1JJAA 3LBIA 1UXHA 2GCPA 5K20A 1XKLA 1GSOA 3MTIA 4Y0AA 1E6MA 2YUIA 4V0ME 1WBDA 1N34O 1CUXA 4BNHA 1SPBS 1UXIA 4INAA 3EX7C 5DK4A 5IJ9A 4RPLA 3BE5A 3C3WA 4DIBA 2HDWA 2IXTA 2VBCA 1FQWA 1VDMA 2A9PA 4F45A 1EDBA 2VHCA 2BISA 3FHJA 4WZAB 5DLQC 5I51A 2W2VA 1ZQ9A 2ZXFA 1YO6A 2ADFA 4J94A 4WVFA 4AG6A 4KUMA 3FNBA 1YVRA 5T41A 1VDZA 1IXRC 3K5PA 1RRPA 3WLMA 3KXPA 1TECE 1P19A 4AKIA 4HDCA 5C93A 5CYGA 4I8DA 4QVKA 4ZGBA 5KTRA 3Q4HB 3KZMA 3KS9A 2IBMA 5TQ2B 3W7XA 1ISPA 4FN4A 5JVDB 3T54A 1ICIA 3CMCO 2IV3A 4C9BA 4CRWB 5K0ZA 3C3SA 1QTQA 1DIOB 1LF5A 4WDQA 5HEKA 3BMQB 3NEAA 2FKNA 2ZATA 2E9SA 2QRUA 2ZYIA 3P1JA 4LP8A 3PYMA 4YRCA 1E8MA 1M2VA 2N47A 1D3AA 3K5IA 4YXWA 4GOKA 1LVUA 4D57A 1CU1A 1HFEL 1LWOA 3ZMVA 2E5FA 2WM9B 1SQXH 3EZ9A 3NVAA 3Q8WA 5DWQA 4D97A 4F72A 4ZYXA 1G4AE 1HSOA 2HB6A 3RVQA 4CM9D 1SXJC 5AXAA 2OQRA 1CXZB 2I6GA 4BGDA 1VMGA 1NWCA 3A9UA 1C9DB 3GC6A 4HX2A 5FKJA 3G8CA 4B47A 4BX3A 1V11B 2Q3JA 3KUKA 2MINB 2Y2VA 4BVGA 4D96A 3W90A 2Z3ZA 4IV5A 3HABA 2HA3A 4EO9A 1CR1A 3WGUA 4H1WA 4KITB 3BABA 3GEEA 3PQ8A 3O9ZA 3BMOB 4P0TA 4BWYA 4RD3A 1ZD5A 3E9EA 4X8HA 3K8QA 3IFSA 3BILA 2YCBA 3AR2A 5ICEA 1YCDA 1HE2A 2O1WA 1DU4A 1L1EA 1TMYA 3C3EA 3MLBA 3QBTA 3EWNA 3KZNA 1HK7A 3RUDA 4BKRA 5IKPA 1AHIA 3A2LA 4KBGA 2ZWPA 4TXJA 3Q85A 2JS5A 1TYZA 1WF3A 2PRSA 2J9XB 3UQZA 1WCXA 3A32A 3AG3B 3HUFA 5ALEA 4B48A 3O74A 5K3DA 4C7KA 4PN3A 1MC1A 2D4AA 4QJ3A 5C1DA 3C8ZA 1WSDA 3C8HA 2CTRA 3AEXA 4QQRA 4DS3A 5IMSA 4MW3A 2I7TA 1BD3A 2GWHA 3GWZA 4XCVA 4XQGA 4Y6OA 2AW9A 4QYIB 5F51A 2O3SA 4WWHA 2VS0A 2DAPA 3AESA 4G4SP 5AJYA 4HI0E 2F59A 1CY0A 3GMIA 2ACWA 2DY0A 2JBAB 4GP6A 3UWKA 5C52B 1I10A 1FLDA 1V0JA 2CNKA 3ZN1A 4R9NA 5I7WA 3ONDA 3JU3A 3C39A 3QOYA 1HW7A 3HYRA 4Z9FA 5F77A 1Q22A 3CJTA 3RBXA 4AKEA 1GLNA 1DJOA 3A10A 5EP3A 5CBGA 4FYVA 3CNQS 1LNZA 4R0NA 5FD8A 2BGRA 1V1MA 1UFKA 2NGRA 2X41A 4J9ZB 3KOMA 3RUHA 3DLHA 2GB4A 2YV2A 4WI1A 3WSVA 3RVSA 821PA 2Q46A 5IU6A 3N7UA 2ILTA 3AUSA 5JQGA 5IM4A 1LFAA 1NJFA 3MJTA 3O8OB 1OKKD 3BDVA 4XLTA 4LDZA 3TZBA 4JI6B 1WXDA 2G28A 1GV0A 4CNBA 3DEYX 4LG1A 5TPZD 5KOHA 4U8GA 3I5UA 1KQ3A 1QUFA 2WHQA 4ND1A 5CX1B 1SUDA 1BE0A 3OWXA 3TTUA 2O1EA 3E4CA 4IRXA 4GPTA 1XZ8A 2ZRMA 2EULA 4BUZA 2BMWA 2DQ3A 3GPDG 3KHUA 2I6FA 5H1YA 1I9CA 1NVVR 1PUJA 2UUBB 3Q7RA 4YCBA 3CXCU 2WAOA 4Q47A 9MHTA 3JS5A 1H0SA 1AUPA 3BB1A 1DEHA 1E6UA 1MB2A 1IZYA 4FNGA 3IURA 3D7NA 2JLRA 4JCOA 3AWIA 2AYZA 3BZUA 1KJQA 3MINA 2EKQA 4CT0A 2D4HA 3TRKA 3WYCA 1U2DC 3HNPA 3K5OA 3W5UA 4MDFA 3UAYA 2ZBVA 4MS1A 2LDXA 2FLWA 3CJRA 3R0ZA 4NTXA 3GG9A 5IJ9B 1KL7A 3GLHE 3FNQA 4R1NA 3Q8XB 4MQEB 4V03A 5CT6A 2E4XA 2D59A 2BONA 3AI1A 1H8HA 3EIUA 1IAVA 3ZOKA 3KQYA 5JSYA 5KOYA 3FOWA 5MN5A 4L07A 3OLXA 2REQA 1J0EA 5BVGA 5K1XA 4I55B 3GGSA 3PDIA 4YXFA 2AOWA 2AGVA 1HMPA 4UUJC 3INGA 3KCQA 3O83A 5DXJA 2A5GA 2QE7G 4G3XA 5A9TA 1JTVA 1TM1E 1U0SY 1FW6A 1Z0UA 3R3UA 1AV7A 4FHGA 3IIKA 3QBEA 1SMKA 3EVDA 3C8MA 4PY2A 1LVHA 1Z4QA 5LP1A 3K09A 4II2A 2VPPA 4LCEA 1P7PA 5BV1A 1C81A 2HLPA 1YZNA 3JASA 1A9SA 1XNGA 3K6RA 1V6AA 3GEDA 5SZJA 4CQNA 4OKIA 3V4ZA 3DDWA 2JVDA 1I5OA 1ZUWA 3FPKA 4ZOLF 2GXUA 4YAJA 2XQFA 1OAOC 3KEQA 2AH5A 1QP4A 1OC2A 1QVGU 1PJCA 1BWPA 1FFCA 4I0XB 4QXQA 2PGXA 1HYQA 1D2RA 2G36A 3K0HA 2OGSA 3QKRB 4ZQEA 1PG0A 1VJ1A 4C88A 4EB8A 1QVZA 2A1IA 2ECPA 3EGDB 4Z7OB 1Y5LA 5HUJA 3SYLA 1J9ZA 2O0HA 3B52X 3G1WA 3DM9B 5EHIA 5FPPA 3ZQJA 4NZZA 2P2GA 5P8WA 3GNTA 2HTEA 4FOTA 5IULC 2PAFA 3OCCA 1OU4A 2WSMA 4CMEC 3DVLA 3QPWA 4BZXA 1GP2A 3P0HA 2RHJA 3K73O 1Q1ZA 4RPIA 2V59A 5DSZA 4O2AB 1SKQA 2DYKA 4OX9O 1TCCA 3DKKA 4ESEA 1FFHA 4JC4A 3L07A 5K0CA 4IEIA 3W79A 4I3HA 1M72A 1T5LA 2HA0A 3CZQA 4PAQA 4CLOB 3FGNA 1J8VA 1Z73A 1XX6A 4UUQA 5EG5A 4N40A 4MV9A 4RZ2A 3AMVA 3LLVA 4JKIA 4G84A 3KWLA 2BTOA 2FWIA 1UH5A 4MKHA 3C5WP 2JAQA 3ETDA 3PXEA 3QUCA 3GFSA 2HF7A 1SQPH 5BQXA 3N2YA 3C24A 4JI2O 6Q21A 2OV2A 2VF8A 5FAKA 4FDMA 2A4MA 1M5IA 4WN3A 4GKJB 1DCKA 2QAGA 5IYBO 2WWIA 2AZ4A 2NU8A 1BHSA 3FAKA 1R6XA 3CW2A 1OWLA 1BS3A 4LE0A 1JLMA 4JEHA 1QGOA 5D84A 2PGAA 4K03A 4MQUA 4ZJZA 6GPBA 1BQ4A 1Q0ZA 2LFSA 1ZU5A 4UBLA 4AWBA 4AS3A 3SYNA 4BWAA 2P9JA 3LSYA 3AEYA 5DECA 2VXYA 4GWGA 3SM9A 2XY4A 1P1FA 2Z58A 3PEVA 1T2VA 3Q3IA 2AYXA 4I5DA 4NBNA 1Z6QA 2Q5IA 2QRLA 4XGIA 4Y2UA 3RC9A 2VP6A 3DAGA 1LBEA 2AW5A 3L7YA 3ND6A 5I9NA 3ASNB 2EIMB 4B3TO 4B6SA 4ZU6X 5JZMA 1T4DA 2UDPA 3NKVA 4OYYA 4X97A 1H2EA 4ZO8A 1E2DA 1VQ1A 4M99A 4BBZA 2R751 1C9EA 4F9TA 2QPTA 4J16C 1J33A 5JFOA 3D0KA 4I4TB 1G3MA 4Z1MD 1UKBA 2I5PO 3C48A 4DYDA 4DSZA 1BEZA 4RDXA 2FXIA 3A4TA 4LPSA 2IS4A 2VTEA 1G3RA 1RIFA 3OQ1A 3LLCA 1UFOA 4L0QA 2G9QA 4MX8A 4Q9KA 1YEWA 5GINE 3OTGA 2ZCJA 1VG8A 2QLLA 5K2MA 4F38A 3LM8A 4PI0A 3ZTTA 4B2IA 2VSXA 1Z4JA 3P2EA 2QRVA 3I55V 2OLJA 1A96A 4UFZA 4GR9A 4HC4A 4EBBA 1CXZA 2C5FA 1J21A 2ARHA 2F9MA 2JH8A 3DOOA 2VWQA 3LBAA 4G0YA 1NZDA 4IUBS 4KK4A 4R51A 5JZSA 3C3CA 1U8FO 2QIOA 1W2GA 2QM8A 4BQIA 1EVJA 3EDQA 1SXJB 2AOVA 1QBGA 3K2EA 3MTDA 4PYKA 4JUDX 2ZNJA 3JYPA 4UCFA 4OXYA 1UFVA 4ZKDA 3UOGA 4YRLA 3AF2A 4URHA 4G2NA 1RNLA 1ISIA 5ALDA 5FP0A 4WLUA 2FWNA 3ESAA 4A27A 1ONBA 3GRFA 4P31A 1URFA 1B6RA 1CR4A 1U63A 2G0TA 2WKWA 3WRYC 2B5VA 4BE7B 1D4OA 4PG4A 4MTXA 5GGYA 3RREA 3ABOB 1F5SA 1N1EA 1AKMA 5ER6A 1IQPA 4GOOD 4JQCA 3BT7A 3OJLA 3B8EA 1FNNA 3A1EA 4KIGA 4PWYA 1UOOA 5MF6A 3TI9A 4R1UA 1CIJA 1C3EA 1SIOA 2I71A 2J6CA 3EMBA 3VZCA 4F5DA 5G4KB 3B38A 5JRJA 2B1GA 4IJQA 4LN1A 4OB6A 3FTPA 1BN7A 3OTOB 2A0UA 2XYHA 2E0IA 2OYQA 4Q00A 2OG2A 3SGLA 2CCJA 3QFHA 1D0SA 5H6QA 3CIFA 4NFYA 3EUAA 4XTRA 1DGQA 3FNFA 4KBFA 5ITSA 1ECFA 2OCYC 3KCNA 2BDEA 4LJ4A 1AKWA 1KRHA 4PPFA 5BR8O 1HLDA 2I76A 2KM1A 3LXRA 4M54A 3WIOA 4KQFA 1LSUA 2H9AA 5JO0A 3EEFA 2H7CA 4EYOA 2YXLA 3CXHF 1RZ3A 3RHZA 4D80A 2GAIA 2ORYA 2UZ4A 1L7BA 2FR0A 4DCOA 2G8NA 8ATCA 3KOOA 5SYAA 1KH2A 4HP8A 2HN9A 2QYOA 1L5VA 2WUWE 4IXWA 1YS7A 3DKVA 4TL8A 3C3AA 3PR2B 4QXPA 1EG7A 4GPZA 1AGPA 3S5JA 1QDLB 4MVSA 3WVNA 4B85A 5BRJA 4B3SO 1AB3A 1YRHA 2DOKA 2IEAA 2QIPA 1QQ7A 5BNIA 2UXCB 1X19A 2PX3A 2ZK7A 3CUEF 3MCUA 2JLSA 1BH6A 3Q5GA 5I7OA 4C14A 1PJAA 3BTVA 1PR6A 1WD5A 3DEKA 4A6DA 1Y63A 4BEBA 3JVIA 4RLSA 1W4BA 3LAWA 5AVOA 5GONF 4FYKA 2IV2X 3U3DA 1A88A 4EA9A 1H65A 1H3NA 2LQTA 2WE8A 3NUGA 3FDXA 1AB5A 3V4PB 4ALKA 3AVYA 3Q0IA 4ZU3A 2Z4RA 2J4DA 1S2OA 2FU5C 1Y0BA 3W2IA 4FM9A 4ZT7A 2OXFA 5FL3A 4EGAA 2QTFA 2Y0PA 2IPNA 2PJDA 2R79A 4ICIA 4OXRA 3GLIB 5LC1A 2P5OA 2WLNA 1CNFA 2FR1A 4BJ1A 3KQMA 1U3FA 2R8BA 2PX8A 3H0CA 3C6QA 2F66C 3MILA 4FDTA 4JUAA 2FYTA 1GFWA 2JLBA 5CMUA 5DTMA 3I92A 3Q7PA 5KQMA 1GGKA 4YI5A 1WPQA 3AEIA 2OM2A 1G59A 2EP7A 4NU8X 3R5XA 2H16A 3H5TA 4R3WA 4JZKA 3U4QB 4HD8A 4NKRA 1F60A 1YJNV 3W5HA 3OFKA 5KOHB 2NTVA 2W4QA 5DK6A 5DZSA 3SYOA 2YCLA 2OEPA 4XJXA 3SZUA 3SYTA 4C22A 5KHJA 3O8OA 6CHYA 2II6A 2Z8YA 1Q7BA 1N2HA 4RS4A 4UVHA 4M0PA 4L8FA 4R8KA 5A4MS 2YN0A 3ZRWA 2KSDA 3S3WA 4P81A 4BFWA 4PHTA 3K0BA 5LR6A 2ORWA 5A9SB 1B00A 1SIUA 4P8RA 1I51A 1MT0A 3ZGLA 4NXMB 3GGJA 3BBLA 3VO9A 4D3YA 2BGGA 4N03A 3VOAA 5BSFA 1KI8A 2V0GA 2WUFA 4I50A 3CNHA 3GWKC 4Y1RB 3SQXA 1P1JA 2HWXA 4UPDA 1U7UA 5AQEA 1YK1A 5E9QA 3RFUA 3AJEA 4CMBA 2R7KA 2V6BA 3P20A 3SPXA 4IHJA 1GZ4A 4XVQA 4C01A 5ITVA 4DRXB 2XJ4A 5DBHX 4K9SA 1K0UA 3NQ41 4G0UA 3WYBA 2A9RA 2Q4EA 4QOSA 4NXNO 3LY8A 2BM8A 1Z0ZA 3HWWA 1HDIA 4MS1B 2RK4A 3HVUA 1BKDR 4M0MA 4REMA 5EZ5A 1J90A 5DE3A 1KEPA 4MB2A 4DWVA 1XJ5A 1MLDA 5FV4A 1SOUA 3DGEA 4QNRA 3PNVA 1CEZA 2ZYRA 4Q5IA 2D8MA 3IEXA 4B43A 3Q0TA 5KDLA 1Y8QA 3R9KA 1ZUIA 1JRLA 7REQB 2Y77A 5THXA 5BN4A 4OJTA 1P3Y1 4V0SA 3H1GA 3UWSA 4E1BA 2YS8A 3OJXA 1UQUA 2GHRA 3F5MA 1P7GA 3MSXA 1ESCA 4WNIA 2OO5A 3WL3A 1QHSA 3L75H 2C0QA 2BGMA 5BYJA 2Q69A 4NHEA 2H52A 1RM4A 4PW0A 5BW4A 1UAAA 3OHPA 1R5OA 3U4DA 4AP6A 4D99A 2XBMA 2B7CA 1BMDA 1XZGA 2J4CA 4K9KA 2IQIA 3DHEA 1YKFA 1LV7A 2KE5A 3K94A 3MK31 1K33A 2P0YA 1O95A 4KTTE 1DBRA 1UJBA 4BGEA 3NTRA 1OLUB 1NBMG 3ESCA 5KPDA 3LH5A 2WTMA 2Y1GA 3QKWA 1N2ZA 1YT5A 4FFNA 2JIPA 4YGXB 1OYWA 4TQ9A 4ZGWA 1H2YA 3B1FA 1IZ8A 5IM5A 2PD6A 2Z57A 1IPFA 1CJBA 3H9GA 1CDOA 2R8ZA 1UBSB 1OJLA 4OAOA 4W6QA 4K6HA 1JR3A 1T3HA 1TD9A 3K8ZA 2R6AA 4GI1A 3WV5A 3FBTA 2CZCA 1OW3B 2QE7A 1WZNA 3B1VA 1WUYA 3WJ2A 4QXOA 5E6UB 1CNEA 2PS9A 3SSMA 2PYLA 4FFMA 4CYMA 3ROZA 2QTRA 3EZ2A 3E8SA 1NLUA 1GG9A 1W93A 1T25A 1Y1TA 2VOEA 3KJIA 5TV2A 3TBHA 3GT7A 3UT6A 3WLLA 3S4YA 2ZVJA 3O0TA 4JGGA 3FLAA 4IDFA 2IYFA 2R5NA 4TSRA 3OOWA 3AETA 1QQTA 3M6LA 1N33B 5I9MA 2I1QA 3SC2B 3PHGA 2CKMA 3MELA 2HU7A 4HAVA 2Z09A 1AVMA 2WAMA 3IH5A 3VMFA 3ZKAA 3APQA 2VPQA 1AX9A 4BO1A 2IHBA 3IAHA 2PUDA 5CA1A 3W4IA 2HQRA 1P7ZA 2Q2QA 3KCYA 4DYHA 4O0MA 3FCEA 4L5AA 3IO5A 3PNSA 4X1KA 3SIXA 2ZTMA 3FOZA 1VLQA 5HBRA 5E6SA 3FCUB 4E5SA 1GTG1 5J2TA 3CYFA 5ALQA 2YJGA 3KVVA 3BDAA 4R81A 2ASVA 2Q6TA 1ZGCA 4N6NA 4UNPA 2IS6A 3BF7A 2I78A 3ND9A 4G26A 3OM1A 1Q6YA 2QTVA 4FFKA 4TS1A 1O95C 1JFTA 2PVSA 4BVEA 1SVOA 1RTTA 4KZKA 1K5DA 1NVFA 1E2UA 1O8CA 2P9EA 5C5EA 1LFDB 2CVHA 4FR2A 3B8MA 4QTUB 1PFQA 5E1MA 4BNYA 1VQ5V 1RR6A 1ZJJA 2H4ZA 1YDEA 4G1UC 4IDEA 4O4HB 4BC0A 1FFXB 1GPDG 3KQUA 3VH1A 1VQLV 4DCCA 5TPZA 1DAKA 2ITDC 1FP6A 1EFTA 3EA5A 4WD3A 4BVAA 2QD5A 1ZICA 2X8JB 3QNMA 4L4UA 4B8ZA 1CJTC 4AULA 3WAJA 4NEGA 2Y1CA 2WU4A 1ZHOA 4ZEOA 1GK9A 1FPOA 1I94O 1VL2A 1C3OB 1X80B 3CLVA 4EEKA 1JBKA 1B42A 2BHRA 1NPTO 4LWZA 5EHNA 3TJRA 4EELA 5HRUA 2ZYUX 2QXYA 3APOA 1OJ7A 1RAFA 4MQEA 3UK7A 2A9QA 1ACMA 2F1MA 1W49A 3KFXA 1U9JA 2GLUA 4MR7B 1Y1RA 2DR3A 3WLHA 4D9KA 1OB5A 1A0OA 1YRBA 2RG7A 3EBLA 2EBUA 3Q5EA 4BFXA 1EDOA 1S3SA 2FNAA 4BLOA 1DBVO 1GKUB 2EIKC 2CD7A 2X7JA 3L6BA 2JA2A 1YHQV 1W47A 3OX4A 2Z2ZA 2QX6A 4HLDA 4MULA 4B84A 5BN5A 2O8EB 2HH9A 1MW9X 1YL6A 2C8VA 4N39A 1ZCZA 3QMMA 2QENA 3P32A 1SGWA 2EKZA 4WGFA 2K5UA 2FP3A 4J0HA 3LU1A 4KAJA 3QELB 4LQ4A 5K0TA 1J2EA 1I7PA 1TAGA 1V7QA 1XQWA 3IAFA 4YNBA 2FPIA 2PA0A 3N28A 1EDZA 1A1SA 1PUIA 3ANSA 4NMMA 4OKNA 2FEMA 1ETUA 2YIBD 4GUDA 4HT3B 3OSZA 1WB7A 2SHKA 2K9PA 1G17A 1QVAA 3CISA 2WLLA 4HS4A 5TJHA 1YB1A 4F3TA 2WJ4A 2QMYA 2H94A 3ILHA 5TF4A 2C7QA 3WB1A 2GSDA 1E62A 1FXWA 2ZUTA 1GN3A 1GH6A 1WDTA 1K3UB 3LRTA 3MWGA 4JI7O 2XRMA 3W4JA 3UGJA 2BEVA 2X8AA 4BDTA 4PVCA 2CLLB 3F6PA 2BFMA 3FDJA 4JDPA 1WQ3A 4RD4A 4RIHA 4NCAA 4B6FA 1I80A 2KSQA 4IIVA 2DHEA 1JZQA 1XNJA 2A30A 4MUFA 4G8CA 4EI2A 1V55C 3ABLB 3D36C 3BXXA 3CX4A 4JBYA 4V0NA 4DWJA 2DT8A 4DWWA 4EATA 2WYOA 4GPD1 3MRXA 3OUUA 1E79G 4G36A 2QTVB 1T4CA 2EERA 1QAMA 3ZGVA 5JSKA 3VHRA 1BAPA 1QVRA 4R8VA 2O8BB 2H5JA 1B73A 1I7SB 2P2YA 4M4SA 3IAXA 3QVWA 1BD4A 4HFMA 1NBME 2HKIA 4RWZA 3WL8A 3G2KA 3ZI0A 2EGUA 3CVUA 2X0LA 5BOVA 3TLZA 5E2AA 4ZVNA 4O5OA 5LYJA 3RS4A 1GKIA 3ACDA 1Z6AA 3T1QA 2HNKA 4WTOA 4NH4A 1MPTA 1V3UA 3F7VC 4RIIA 4MWBA 1IL0A 1QRAA 3UOWA 4KSBA 3CCVV 2HK8A 3WGLA 3DVSX 4WJLA 1R4MB 4HWPA 3DFIA 1K73W 4IG4A 1L5LA 1CUEA 3NUZA 1TF2A 4E2WA 3UO3A 5IN4A 1QX3A 1TDJA 3WGGA 5J2UF 2I99A 1UAYA 2P3LA 4JS0A 4LXHA 4GKAA 1GM7A 3H87A 4ZREA 2EX4A 1UEXC 3EIOA 2G5TA 3UYLA 1D2GA 2IVFA 4DQVA 5FJJA 1XMQO 1L1QA 4C0WA 4ZHSA 5KKAA 1R6KA 4ENRA 1F12A 1THTA 5EN4A 4LF9B 1ZXXA 4LZJA 2PZKA 4DKJA 5CB4A 4H7FA 1WZ2A 1ML3A 1QGAA 1U04A 1V1MB 4LF8B 1YULA 1VIMA 2C1EA 3LPNA 3PITA 5FI3A 4B7AA 1GM8A 1AHNA 5DM4A 2ZIGA 4D3FA 2CLFB 2GXQA 1FFYA 3A2FA 4F04A 1I2ZA 4I5SA 1V3TA 3KB1A 3NNNA 1EP2B 3UTDA 4IUYA 3V97A 3UPTA 3MOGA 5IFLA 4LFAB 2KG7A 1XEAA 3BIJA 3W04A 4A2CA 1HEYA 1GPUA 5HWSA 3ZX4A 4CQMB 3DZIA 5CW1A 3BH0A 4YRBA 3KTDA 3HXOA 1XFAA 4HRYA 1A9XA 4L4ZA 2AJBA 4E5DA 3QKUA 2N75A 1FEZA 2QM7A 2Q5QA 1BZYA 2G0AA 3OFSA 3LQ2A 4AZTA 3W34A 4POOA 2VPIA 3AUJB 3EIEA 1RQ7A 3K1AB 2AEMA 1FFWA 1M5UA 1Z08A 3DEAA 2ZYGA 3OFVA 1DTWA 1W25A 4YUYA 1IOZA 4FFRA 4LMBA 2P9CA 2XT6A 1FSPA 2VZ0A 2X42A 1KK0A 5KHGA 4WX2B 5EKUA 3O1HB 5HQJA 4I9UA 4C87A 5DM60 2B8WA 3I32A 3IHTA 3ITNA 3CRZA 1O5TA 5FFMA 4FZ5A 1P31A 4NBUA 5HDQA 2V7UA 1BROA 2V96A 3JQAA 5TPWA 5HOEA 3N8HA 1T4CB 4H4EA 3TJMA 3LYAA 3ZY6A 1XHXA 3MS2A 4W5OA 4W7IA 5IEJA 4LF6O 1I4TD 3QMPA 1RZVA 1H2AS 1JPNA 2EATA 2Q07A 3B89A 4OAPA 1AK1A 4OPMA 4LGYA 1S2MA 2I8LA 3JPYA 4PHGA 5ALKA 3ZVKA 4UCQA 4LNHA 5CT5A 4X7PA 5BMVF 3FTFA 4PGMA 4HNUA 2I8AA 3RAJA 3GEIA 3GQBA 3IALA 4YECA 3IEKA 4ZZ1A 3ZS9A 2JLVA 2B3DA 5A71A 3MRTA 3H65A 3WK5A 5I7FA 1YUNA 1SA0B 1I3NA 2H6EA 5TSDA 2VG8A 1T8UA 2WA2A 3QLVA 4UMEA 4V0OA 3FNRA 4HCJA 5EGNA 5HVNA 1LPOA 1MQ8B 3RN4A 2RCYA 1TZCA 1UK8A 3OFNA 1EWKA 4MI1A 3WDSA 3ZG6A 1P75A 2VNSA 3CZPA 5KWSA 4O1MA 5MFPA 1F6BA 5AP9A 4HFJA 5IH3A 1DLJA 4EG0A 2QAJA 4IJMA 3TOZA 1NKDA 3CX6A 1QOPB 3JYOA 3Q1LA 4QHYA 3YASA 1FVXA 1WAZA 1NTRA 4BGVA 1ZA1A 3MB8A 1U3TA 4PGFA 4WCFA 3FLBA 2ARKA 2ZCUA 2I9PA 3AJAA 2IVZA 4RLHA 2WM2A 3WL6A 4B81A 1Z0DA 2QLNA 3AXSA 3L6RA 4LVOA 3CZCA 5B1SA 4L2IA 2IV7A 3U4QA 3MWYW 4HYYA 4QDJA 1AXRA 3F67A 4BFUA 3BAFA 2QUAA 1E3JA 2E2WA 2Z3WA 2NU9B 1EN4A 4HZ3A 3NVMB 1GITA 3PWZA 2EBOA 4LZZA 1HEIA 4G28B 3W2FA 1K89A 1KI6A 1Z2AA 3ME5A 2BLNA 3WGQA 1VBKA 2OY0A 5CDSA 5J3JA 5K8UA 3E2IA 2WAXA 2AZXA 3I2KA 4P92A 4R3UC 4LNUB 3IIMA 3RKSA 3EQ7A 3Q3HA 1QVWA 5TMPA 2PZJA 3F6BX 1YK0A 2TMGA 3HXLA 1G2IA 1Z62A 3KQQA 3IT0A 3LD9A 3BFKA 4UCXA 5E8JA 1LLDA 1VYUA 4A8JB 4BEWA 4AVYA 2GYYA 3QK7A 2D3TA 2XBLA 1F38A 5T64A 1PYGA 3K1YA 2HG5C 3LWDA 4ZOBA 3G1TA 3DO8A 2IU3A 5JS7A 3GAFA 4ZYYA 2YV5A 2V5VA 1DRVA 4OYRA 4X6LA 4FDLA 4PNZA 2MSEB 3SWWA 2EZ9A 1HI9A 2XZPA 3FLMA 4NC9A 5BQOA 3ZDYB 4CQJA 2PJRA 5F3WB 3JVUA 5GY7A 2F8SA 4YIPA 3D7MA 4UOEA 5D5HA 4D7AA 1C1XB 2CEKA 3L18A 4GBJA 4JSRA 2AT1A 4JCCA 4LBVA 3GDGA 1PS9A 3PXDA 1SQBH 1I7NA 4UJ5A 1JT2A 5EJEA 2IBZH 4KL1A 2JH9A 1JDTA 3LIIA 4CLXA 2I66A 3T7IA 4FS3A 1G7CA 3T7RA 4ESHA 1VE7A 2PCLA 2AFHE 3WWPA 3DHVA 1FDVA 2CB0A 4FDVA 2V7VA 3VSEA 1E9FA 2IPOA 2ET6A 1D5NA 2FWPA 4R5MA 3TQQA 3ZDBA 4ZMRA 2HPHA 2V7PA 3T3GA 1F2UB 2I7XA 3NAMA 3CEIA 3GLSA 1B0UA 1RSOA 3EXG2 3JZIA 2DPHA 2W0MA 4DLUA 1E9EA 2EJ7A 1K4YA 2WJJA 3FMVA 4OMFG 3V6MA 3V7FA 1T0IA 1L8XA 2DFLA 3IUEA 1NSYA 2DFNA 3FB5C 5DXAA 1AROP 5EIWA 3DE4X 4EM6A 1F9AA 1MEOA 1U3DA 2IZZA 2XIJA 3REQA 2G5PA 3U9LA 4KYIB 1PAUA 5E6UA 4PA3A 3DBHA 4DMCA 4ZGGA 4JJAA 5M3BA 4XJVA 2XYVA 5CEEA 3QLVC 1EN5A 1FFBA 4MLPA 3MAQA 4NCBA 3LDDA 1AKYA 1O4WA 2R6HA 4MRAA 5B6PA 2ZP1A 4B3GA 4BB9A 1EE9A 1P0MA 1HR0O 1VHQA 4E31A 2YJTD 3L9DA 2XUHA 3Q15C 4KU4A 1Q0QA 4X6UA 3ZS8A 2HU8A 3I2JA 3CRAA 3B1JA 4G1VA 1C7EA 4PRZA 1HRKA 3EOBI 2DWOA 1U8EA 2RHMA 1GTMA 4LWSA 3H75A 4O8CA 4AZSA 3ST7A 1VI6A 2MU1A 3UJPA 4ZZIA 3QWFA 2MSNA 3P0FA 3QEMA 4H6XA 3TNFA 3WHKA 1UDBA 4YCSA 3CX3A 1PZMA 3EGCA 5JAHA 1WWKA 1IYZA 1WUHS 2FK7A 4MV0A 2Q5HA 1HOTA 3K0CC 3O7MA 1UZNA 3A6ZA 3H5VA 3W7TA 1I4OA 4NULA 1W5EA 4M0LA 4FLTA 1XVAA 1ADJA 3NGXA 1VQ7V 3L7AA 5FF9A 2JJYA 2NQ8A 3IBTA 3U56A 3QYFA 5DVZA 5CPBA 2Q3BA 4XDGA 7REQA 5U9CA 1Z25A 2MDTA 1H9CA 2MYNA 2WWFA 1CZNA 3Q4GA 4L5YA 2R0QC 1Z7EA 2EIJC 5IDJA 3I5DA 1MDFA 2Y1EA 4DV1O 1M6NA 2OQIA 2PZGA 1S2GA 2XCUA 3AUUA 4CMCA 1L5KA 1U0JA 1NZFA 4JYMA 2PHZA 5TGTA 1WA5A 4UE6A 3G8AA 3KSMA 4PSKA 4KJZA 3R3JA 2Q7XA 3F98A 1JDBC 3MGAA 5EK0A 1VE1A 4TWAA 3IEIA 3T3PB 2ZINA 1NWHA 1VP3A 4YDSA 1ODSA 3RJTA 3V7YA 2YHUA 3RUFA 3SMVA 1NDHA 4RMGA 4YMVA 1UWVA 1XZLA 4GMDA 5AW8A 4QBHA 1ISMA 4BNLA 2E55A 3ZIAG 4WLFA 5B1IA 2DWUA 4BNZA 3WK4A 1W581 2P6JA 3J81N 3GLIE 1FFSA 4AX4A 5LWHA 2WWHA 2Q0HA 2HO5A 1AH2A 2XXBA 3U3ZA 2ITCC 5DI3A 1R66A 3PSAA 5MGBA 3L0YA 3HSYA 4RANA 4FYHA 2C94A 4B7XA 1A9ZA 2PE5A 4P0QB 2RG1A 3E53A 2CDRA 2IXGA 1SN7A 4DA7A 3QVXA 2FK8A 1U80A 2OZEA 4EVSA 1Q1NA 4MQLA 5ER9A 4AD8A 5JBQA 3FKSG 2B37A 4UM9D 2ZYAA 1L4BA 2C98A 3J7AU 3KB2A 5J1TB 1CP9A 5NLLA 1FP4B 2O7RA 3OPNA 4FEYA 1U5CA 4QDZA 3EPKA 1RPAA 1GNQA 1I2MA 1WY5A 2H0QA 2Z1NA 2Q3EA 4RK0A 2PJUA 4CTKA 4QNMA 3QNWA 2H1LA 3T1CA 4FD3A 4GLJA 1I0IA 1ZEJA 4DILA 3W1WA 2B5WA 2CJWA 4G1FA 1Z0KA 4X63A 5FPSA 3O75A 4NPHA 3IBSA 3A31A 5IVKA 1QE5A 4UVGA 2O2DA 1NGSA 1GARA 1YR3A 1I7LA 1RFGE 2AR9A 2R8PA 1CUWA 4WFEA 2QVGA 1YS4A 4KQJA 1QKJA 4KBYA 3GA5A 3GHHA 3EULA 3OCXA 1FX0B 3HYNA 5JS6A 4NECA 5LZ2A 2C8KA 3H11B 1FUEA 2RAFA 2FN3A 2Y69C 3THYA 2B4TO 4YQZA 3WJ7A 2R9AA 1RHJA 3HY4A 1ND5A 3ASZA 3IP6A 3BFXA 1OH8A 5ED0A 3V7WA 3QUQA 3TSAA 5GTIZ 3X1JA 1HNXB 1F6WA 1GGHA 4LDAA 5I6DA 2C88A 1K88A 5ELLA 1E94E 4IF4A 4IEFB 4D0GA 3S7TA 5KMGB 3M1IA 4I1RA 4YMGA 1P91A 1U3VA 2C0PA 2R7AA 2D6FA 1G7SA 1GNSA 4PC6A 2P3QA 2UZIR 3P9IA 4IAOA 3VO8A 4YBRA 2OCCC 2XRYA 5JMPA 5KYUA 4AK9A 1X70A 4WOBA 2P4KA 2DU8A 3DC7A 4Q20A 2G71A 2PN1A 3VOBA 1TEVA 2ZIOA 3KT6A 3V4FA 1IFXA 2X4DA 3V33A 1Z9BA 2W48A 4IIJB 3NJRA 4A3SA 4X65B 1JYSA 4BTEA 2EXXA 3E2PA 3N2ZB 4Q1DA 1M1YB 5FWXB 1Z5PA 1OCEA 3WIEA 4X1YA 4ZICA 4NVPA 3GDOA 4PQEA 1M1ZA 5AM2A 4BLSA 3G71V 2D0OB 4K6FA 4X6XA 2XCRB 2YHIA 3PEWA 3BEDA 4Q1FA 4B6RA 4HFNA 2RHTA 5IZCC 1QWOA 4GM4A 4UDNA 3FUTA 3LGXA 3L7OA 2JFQA 5B4UA 1GGNA 4OHVA 5FTWA 3K71B 2PKXA 2Z0AA 3KOYA 5K09A 2KW5A 2WF6A 4MCAA 1X7YB 2XJ9A 4TKUA 3ZGYA 3N2GB 3STZC 1XHEA 4HAYA 4OJKA 3H8VA 3GFFA 5E1OA 4IUDS 3OTHA 1Y89A 3KU4A 3MVEA 4HAIA 1VSTA 5CP8A 4W1PA 5DT2A 3SHOA 1UJ4A 5DM70 3RT9A 1I6MA 2YC4C 3GD7A 4X8LA 5TQJA 2PXHA 2X23A 3T1HB 5K4GA 2PWPA 1Z35A 3O8LA 5CT9A 4LJRA 4HN2A 2G08A 5G41A 1NDQA 1XTKA 2ON6A 4XVRA 3HO8A 4MGEA 3ZI7A 2A78A 2KG7B 1T2NA 2IWHA 4IDQA 1QH8B 2NO4A 1OB2A 4IFTA 4PLWA 3HJBA 2Q3MA 5L7YA 3PC2A 4EGSA 4AY6A 5BQPA 3IDAA 3OZXA 4DMMA 3GL9A 3I45A 2DQZA 4PC2A 1IBKB 1EUCB 4UHEA 1B74A 1Y6FA 1OFGA 1SOMA 3CR7A 4UTVA 2FXVA 3B5IA 4BN5A 2ZPTX 4R0MA 5GVSA 2ADOA 5JDCC 1HG0A 1Q19A 3EVTA 3EQ6A 4FQ8A 3B6EA 4MYTA 3T5TA 2DKFA 4TS9A 1VZ2A 3V42A 1OH6A 4UQPA 1GAQA 5HKOA 5DSTA 3JQAB 5TPWB 3DZKA 3HKCA 3TAXA 5C8YF 3LNMB 3CLKA 4S2EA 5SY4A 3RGGA 1TZMA 4N3GA 3USCS 2JD2A 1DC5A 1JHDA 2A4KA 2WFLA 4HQ0A 2BT4A 3MJVA 5LOVF 1IXKA 1PJZA 5JCOA 2J6BA 2VDNB 2AA3A 1QFYA 1XF1A 3DO5A 4DR4O 4GPEA 4TS4A 3WLEA 3CWCA 1HEUA 2EX0A 2CYBA 4QUKA 4RELA 5FI5A 1JXQA 2NUTB 1DAIA 1OI2A 5B7PA 3LNNA 5K3FB 1V41E 3IJEB 3B9BA 3ZK9A 2BOBC 3BWDD 2RIRA 4BFTA 4ER5A 4M3NA 2VP9A 4G5QA 1L4KA 3ZK7A 4J07A 2WF8A 5C3MA 4JIMA 1YQUA 2IH2A 2P2LA 3BE6A 3FCSB 3DTVB 4OL9A 5T3YA 3MJDA 3AVUA 2CVOA 1QH0A 3QVVA 4AW9A 1S77D 5I4IA 4BASA 4Q02A 3U48A 1PJBA 4M86A 4PG5A 4RV4A 1N1GA 2J3MA 3C3JA 3N0WA 4H1HA 1KDZA 2ZSUA 3I37X 3M9LA 4L95C 5KKCA 1U96A 3QPUA 2HHHO 2D0IA 4QGBA 5HK9A 2QRPA 3OEWA 1V7CA 3L7IA 4D0SA 3L7JA 2VDJA 4FXPA 1REQB 1SURA 1VGRA 1KZ6A 3TOVA 2F7SA 3ZQ6A 1N4DA 2HGSA 2FSGA 2ZBQA 3BJRA 4Q4CA 4HB2A 4U8HA 1J23A 3F74A 3PF8A 2W2KB 1UBCA 2X7XA 2A0KA 5CA0B 3OC6A 4RV5A 5ESWA 3D4PA 4WN9B 4AZWA 4ERXA 1KPHA 2GAAA 2Q21A 2OSVA 3ZY2A 4TVSA 5CM9C 4M7RA 1YZBA 2J48A 1PGNA 4KB5A 1WA8A 4Z1MG 4KLNA 1XNRB 3ABRB 4LTMA 3VYUB 4M1OA 1M93A 3QU7A 1M83A 4DJDC 3TZEA 3RU9A 3WICA 3DUWA 4K0RA 2VUTA 5JXHA 1I7QB 3PGXA 1JHUA 2PIAA 4EVQA 1YR7A 3NBZC 2O5CA 2R4QA 2PWYA 5IWCA 3WWOA 4B3SB 1V16A 1NXSA 1T29A 4GF5A 2O8EA 1H5UA 2IOFK 2XHBA 1PSWA 4LGMA 2AXPA 4TTTS 1QJ4A 3RS7A 1X1TA 3WLIA 1ZN8A 4A0SA 4C4OA 5DGHA 3RW9A 1LBHA 4YT4A 3N75A 4JLSA 3WYFA 2PH7A 1K1EA 4AG3A 3SYPA 1K3EA 1V7ZA 3K04A 3G17A 4L27A 3L72H 4R2HA 2P68A 3H3XA 2KWIA 2WSYB 2H1IA 4JHLA 2ZT6A 5G1PA 3E8FA 5K8TA 2C4UA 1RRCA 4RD0A 5I4KA 1BDJA 2WMOB 5KHIA 2VYQA 4X1YB 1L7DA 3PE4A 3QLEA 2A3QA 4PZYA 4QC2A 3TI7A 4YRSA 5K7SA 5KDOA 1T9DA 2PWAA 4PHCA 1IJKA 2ZSDA 4BVBA 3AX6A 1B8UA 4AT1A 1DDIA 5K0FA 1I7FA 2IDZA 2QRHA 2D1YA 1AF4A 1ZM3A 4JNCA 5EFZA 1YZTA 4QJIA 1QAQA 1XZCA 4I55A 2CFOA 3IVGA 4EUHA 4NBSA 1QV9A 4MAMA 2HQBA 3DSQA 1PFGA 2GT1A 1JIKA 2ORVA 3IAM6 2PPVA 4IUCS 1IN5A 4DXWA 3L2OB 5FTJA 2EFJA 5JW6A 3LVBA 1ZKMA 5JNLA 4TVOA 3W9SA 4UTPA 1TM2A 1ZAUA 4ZDWA 4LUCA 1IB6A 3SQDA 2OFOA 5EQFA 3K6JA 3GRKA 1SFRA 1ZCJA 5CUQA 4F06A 2GJ4A 1N3LA 3DJYA 5IY5B 2EF1A 3CSSA 2YXPX 3B1KA 2IL1A 4GAEA 3TTYA 3VC1A 4OA8A 1Y3FE 1ZH0A 3ETGA 4IIFA 5L3BA 2Z6VA 1OGYA 2QJFA 2WDZA 1ZOOA 4L8LA 2YYSA 3A1FA 5GPBA 6REQA 3QW2A 4CBCA 1W2BU 2R65A 4DMHA 1BCRB 4Q1CA 2JD1A 3TKAA 3A2KA 1SB8A 1RTKA 3H9EO 4Z54A 3R0XA 4GHWA 4PX5A 2JCSA 4BQQA 5JJEB 4M38A 3WNZA 4CEJA 2BI8A 1R3IC 1GQOA 1LPSA 2G1UA 3TD6A 2GCEA 1KI4A 1ONSA 1MRSA 1KECA 1A4UA 1PS8A 4DR1O 1QV7A 2QRZA 2J9GA 3H83A 3R5FA 2X86A 4MGHA 2OBYA 5PGMA 3U19A 3ROFA 3VNVA 3PRJA 3SBDA 1SCUA 3AR4A 4ZC8A 1M3SA 4NS1A 3AOGA 3LUHA 1XEXA 5ARCA 3M1YA 4DUGA 1HFWA 3UQ8A 1U5BB 4H7DA 1TU3A 1HXHA 4ZT4A 2J3JA 3K57A 4KN9S 5GGXA 3VX3A 3GCDA 4TYNA 3ERCA 3PGVA 1UQTA 3MMXA 3JQCA 1WUTA 2ZI4A 1A4RA 2AI3A 3CKKA 3KKOA 4RGBA 4E5MA 3ML1A 5D8DA 3KQKA 4KQHA 5CVUA 4MCIA 3TLKA 2L42A 3CLUC 2NNWB 2JGDB 1QCYA 1QIEA 2HI0A 3DXRB 5JD4A 4B76A 3I6ZA 5E6SB 4DK1A 1NBMA 3V32A 2VEOA 3AEQA 2NO5A 4E5PA 2IYPA 4NQZA 3QG1A 1O1YA 1BVRA 4LSMA 4XM1A 2B78A 1FXKB 4CKCA 1B2LA 2V74B 1SC1A 1AKRA 4IOJA 4MYUA 4DUZB 3TNJA 1X74A 3FYUB 2CFIA 4XQ9A 4EGJA 4QOIA 5ELXA 1HM5A 3CT4A 1DHRA 3W3ZB 2K2WA 3ZDDA 1BGXT 1AMOA 1E9RA 1QFXA 2HHAA 3KQTA 3G49A 3PFGA 1CJUC 3PX2A 1C41A 1T8SA 3ZJ4A 2VTBA 1PS0A 1O57A 1BWSA 2FP4B 1UWLA 2BOCC 1RYEA 3COVA 3OZDA 4UU7A 3LLMA 4HMOA 2X1HA 3FPLA 5FBHA 1C0PA 4NFHA 1PYOA 2Q0SA 2R6JA 1V45E 3E89A 1GCAA 4IGEA 3QSYA 2A1UA 1SBTA 3E5HA 2D13A 3ID6C 2XSZD 3KSRA 4D9BA 3CA8A 1ORRA 3DDZX 3II6X 3OT5A 2PX5A 4KC0A 2AK3A 2XECA 4JJ4A 4WZAE 1CUZA 1A82A 3OMNB 3K53A 3O8QA 2A9JA 1A9OA 3PGLA 4TZKA 1K34A 3G6BA 1ZK1A 4INOA 4KIFA 4CCSA 4F86A 1K0FA 4G85A 1O96A 2H5EA 2O0JA 1M2WA 2BMJA 4N8DA 2FB5A 3KJNA 4E94A 3QVTA 2D2FA 2X40A 4GVXA 2IHTA 5EVCA 3JQFA 2X6CA 3TLCA 3KJGA 3G5UA 4CTNA 2HNAA 4Y1RA 1QQAA 3BRSA 4YRZA 4BNDA 4ZHQB 2VC2B 3HBFA 2JIBA 4HGRA 3AF6A 3AU8A 4IYHA 1JKXA 4AO8A 1EM8A 1O6ZA 1YI1A 2ZUVA 4ZT6A 4JFRA 1SBIA 2B25A 3HCEA 2IYWA 5SZKB 3AHDA 1JSZA 1DLBA 1J06A 1JIQA 1JSXA 2JRCA 4LK3A 5JS2A 3BGIA 3UHJA 3H05A 1PR4A 1QHFA 4ZTBA 4ZT2A 1P2UA 3IPCA 3WGYA 3U1BA 4TKUB 1T6YA 1XTTA 1A9YA 4QARA 2PS0A 3CX8A 1NQTA 2AN1A 1KMQA 1BS1A 1ZYUA 4HQLA 5JJIA 1QZZA 3TUZC 2HSEA 4M8IA 3WOHA 1SO8A 4WASA 4H59A 5ANRB 1V8ZA 4HEHA 4TT3A 2L0XA 5B6JA 1ZN2A 2KLBA 3RK0A 1E7WA 1W5FA 1WCIB 3KXDA 3MTBA 3VZQA 4DFDA 3H2GA 4YMHA 1KVUA 1P1HA 3SICE 2DJVA 2IYOA 2QEQA 3KR2A 3TIIA 2XW6A 2PIDA 1E1QA 5LLTA 1VF6C 2XV1A 4I4IA 4XVUA 2XT0A 2JBWA 5IH7A 3LDCA 3AWDA 4I5IA 4JLKA 1DRKA 1FJHA 4L3VA 4URWR 1ZZGA 3OUTA 4OK6A 1R5JA 3K70D 4YY3O 2GI4A 2AX3A 4P7GA 5DW3A 2XAUA 3ABKB 3MF4A 3AYXB 3GLKA 1M1YA 3NHUA 4PPYA 2OCGA 2QD3A 3F7MA 4Q3BA 3BMNB 4QG7A 3JYCA 1MJ5A 1M56B 5B1DA 3ZU4A 4JBLA 4Y7DA 4D5GA 1OCCC 1HNNA 4TLEA 4TWBA 5AJZA 1S6YA 4DDVA 1ZDMA 4US2R 1QCDA 1VGVA 3D6HA 3OF5A 4LY6A 4MB6A 2G17A 3VH2A 3ZE7A 5CG1A 4OXQA 5E7JA 3EG9B 1LPBB 1WW8A 4MSUA 4N6GA 2C03A 1YVUA 3L4BA 3ANTA 4IP0A 3T4UA 3ZU3A 3QWIA 4JL8A 5CB4F 2AXTZ 3AGQA 2RC5A 3CJQA 1AI5A 3O65A 4BFLA 4E51A 1GCUA 1KI3A 2PBZA 3KKZA 1CHNA 1JALA 1DAGA 3RU7A 1T9ZA 1T9GS 4RUFA 5E2BA 1JFLA 2PGJA 3DEHA 4X90A 5KYYA 4DRYA 3H17A 2AN5A 2FOXA 2H3HA 3HB1A 3O03A 4HL6A 3U40A 3ABMB 3JTEA 3U81A 4DT1B 1UJMA 2ZNIA 4LOAA 3ISVA 4R2LA 4WFKA 3UM7A 3R3ZA 1XB2A 4MO9A 2IP2A 3L9XA 4FJ0A 4LNAA 4PN7A 1FBNA 5B1YA 4CZ2A 1CKEA 1Z5GA 4LTNA 3PD0A 4XUEA 1Q74A 2Y4TA 2QTWB 5CT8A 4YP7A 2DBZA 2NT4A 2VJBA 3MOIA 1P4RA 5LP6C 3B3GA 4Q3EA 3RIEA 3NT4A 1J2UA 1RWNA 4I5FA 2QQ5A 3IOYA 1YD7A 1P0IA 1V25A 4ER0A 4BZZA 4X84A 1O9BA 4EMBA 1ZBQA 4BNTA 5IJZA 2MJLA 1KKDA 4Q39A 5TE9A 3I09A 3W2GA 4PA4A 3U37A 4R1TA 4E2XA 2CE7A 1Z34A 2CK3A 1XR3A 3GJ0A 5JYCA 4NBTA 3QP9A 5G1OA 4E5NA 1Z36A 5A3JA 4C5BA 1JKIA 1RYBA 2J5QA 1U4OA 5B4TA 3FG9A 3T9FA 3ZLTA 3JAWB 2I4LA 4ICGA 4H3KB 2L6LA 2JGFA 3HWX1 4I9GA 1MAHA 4X64B 1SVIA 4IYRA 1MB0A 4QFMA 2IJGX 4DMRA 1HNZB 2WZQA 1GKKA 1BS9A 1XRJA 3CRW1 4IH1A 5B64A 3ZHTA 3EG9A 3VH4A 2WLIB 5AUNB 1U0HC 3EXEB 4YAEA 3KQVA 3INRA 1RQLA 2IYSA 3E22B 4TTAA 3R74A 3V2HA 1N5DA 4NMLA 4BCCA 1TAUA 1Z2GA 3IOEA 4B3BA 1KJNA 2KQXA 2XXAA 1E99A 4FBLA 5FNVB 5T6MA 1E7SA 1SQ6A 2OO3A 1OMOA 3OTWA 4Y0VA 4C89A 5K3FA 2JEXA 1U2DA 3QBJA 4KWCA 2FZEA 1C1DA 2QRVB 4KK3A 3DEFA 1Y34E 2P5SA 1N8NA 3OKAA 5JE8A 4CU2A 5BQ3A 1U81A 1XZFA 5K8VA 4G07A 4DSAA 1RPNA 1E3EA 1IDOA 4AURA 1EN6A 4CF3A 1G1MA 3HN7A 3T9CA 3PRKE 1EWTA 4AAYA 2HEIA 1HOXA 4G1MB 5CW2A 5HJ2A 1G8YA 1G8MA 2LPMA 4IHKA 3CZAA 1VARA 3EF3A 1V5FA 2V6FA 4O5AA 5IN5A 3Q9NA 5JD5A 4PDMA 3BQMB 1QR8A 2O05A 2PH5A 3EXHB 3CS5A 5KJEA 3DBIA 4V2IA 1WB5A 3VPGA 6AT1A 5E9JA 3LVQE 1LKZA 4CKBA 4ZOQI 2REXB 2XVXA 3BA6A 4ALIA 3O4HA 3NXSA 4J0GA 3BA8A 5JJJB 3JR3A 1Q11A 3DAYA 3GCGA 2BSKB 2OESA 3HJUA 4MQ6A 4CF6A 4NXNB 4YI3A 3CR8A 3VZRA 4RW0A 5LU9A 1S0VA 2A2ZA 3V8RA 2ZBDA 4H7HA 1YCHA 1GZ6A 3SZOA 2WSLA 4YJGB 2E3CA 4FX2A 2QTMA 1V1JA 1F8FA 1MJNA 1XYGA 2FFRA 4GQBA 2HCBA 1M5TA 4GLLA 1ZSPA 1JJVA 3DE0X 3NTXA 2DVMA 4Y2TA 4LFCO 1Q91A 4YMUA 5B36A 1BEEA 1GPBA 1KZGB 2HXGA 3HE3A 1P2GA 4ZT5A 3G7NA 2CCGA 3I8XA 4C4PA 3IUPA 2OVBA 5JXJA 4PQYA 4OHMA 1RXSA 1UOQA 3A0UA 3CCCA 4RQUA 1E2MA 2HEGA 3MJHA 4AQYB 1T9GR 2W2TA 1OQAA 1PD0A 3BXPA 3OCZA 3G9ZA 4LHXA 1X2EA 2C5EA 3MWDA 3V8EA 2OFFA 4B5KA 2CCKA 1Y74A 1I6WA 1NT2A 3CNLA 3LRPA 3JV7A 4X92A 1W88A 5LQSA 5ALIA 3WMWA 4K86A 5AO9A 4YRAA 3P3PA 4W4LA 3U3JA 1CEYA 3EPJA 2J67A 3OUZA 2VT3A 3OZGA 4UCVA 1XTVA 3K1JA 4HSGA 4US1R 4LYJA 2VYND 5COAA 1H38A 2XOKG 3DE5X 4GYCB 2RGAA 4N82A 1NYTA 4UHJA 3H5LA 3OMWA 3PC8C 1RWKA 3OOEA 1T3GA 4E2FA 1VBMA 5LB4A 2YC0A 1GT91 1VLVA 4JB0A 5FUYA 4D3SA 1ST3A 3KYJB 4ADSG 3F8WA 2P67A 2J6HA 2XCIA 2AEJA 1O5OA 1O6CA 1V71A 1Y7PA 2RD2A 4LXYA 2G40A 4DR6B 2C04A 4KHZA 3OOJA 4IXTA 3W5BA 5JDIC 1S5LZ 2PG3A 1Z5NA 4K3AA 4X3PA 3EUWA 1Q7CA 4B3RB 3P52A 5TXGA 3IMEA 4TT3D 3ASUA 1PK9A 1GADO 4LV6A 2BKAA 2OXRA 1XMSA 3OESA 4DCGA 2GRAA 5L7WA 2AOUA 4MUJA 3DFFA 4AIIA 3AR3A 1C4WA 1P9NA 1NC1A 5BSVA 3S1SA 4WDRA 1UT6A 4YRFA 3VAAA 5L3CA 1X59A 1Q6HA 1ZY2A 1RWPA 1CY1A 2M7WA 3BMQA 3ZW7A 1XD2A 2IE8A 3DMTA 4KO8A 1U9IC 4CCAA 2DKOA 4IIBA 4TKLA 4AJPA 3SQLA 2GJSA 1SH7A 4GCZA 1YGPA 3IMGA 3IQGX 1JJIA 2AN9A 3EBPA 3N0TA 3N6VA 4ENWA 3ONFA 4IDCA 3FYIB 4U7PB 3EFFK 4M1YA 5B1OA 1SAYA 3VYVA 2UXDO 3H99A 4KQCA 5GZ3A 1ZRMA 4DEXA 4LI0A 2RJ3A 1E2LA 2O14A 2RQ6A 2W2QA 3ANMA 2Y4NA 3H1FA 3M4YA 5DN9A 1Y1SA 5EEGA 1UMDA 1P72A 1WAMA 1R6UA 3RUPA 1ZJZA 2VK4A 1JA9A 2QZ4A 5JH7B 4HN9A 3A4NA 2ZXEA 2AWOA 3A06A 4PCAA 3U4AA 4GRIA 5FRDA 3DT8A 5ECDA 4HH0A 2DHDA 4E88A 3IP1A 3SF8B 1HYGA 2Y27A 4OD0A 5EIBD 5C1PA 3EEYA 1L4EA 4FM0A 4G4IA 2FX5A 2YJ6A 3X44A 1Q81W 5AKJA 4WZ6A 2NQTA 4J76A 4PFKA 1QVVA 4QRIA 3ZZ1A 2GVZC 5HZKA 4HUQA 3OR6C 1MZFA 1KJ9A 1YU6A 4HXYA 4ZTUB 2AOTB 1GTSA 1B7GO 3B1XA 4PFSA 1T1SA 4RVSA 1SZPA 5A5FA 4FYPA 2XUQA 5IK2D 5KU7A 4GOND 2LBPA 3JWJA 1G0NA 3RQSA 2ZKOA 1ZUD1 1EFKA 3BY6A 4CUKA 4EAAA 2XVYA 3PDHA 1R73A 1I0ZA 5HGJA 3HB7A 4EGQA 2HA7A 2QBYB 4D3ZA 2RK6A 3DFZA 3IBGA 3OQBA 4YREA 3BWBA 1H22A 1QSGA 4GD3Q 5DNEA 5HUHA 3BAZA 3MQ4A 2BFBB 3RYFB 1OT3A 1HRDA 2QA4V 1YIOA 2V7EA 1BGYH 3AI2A 1B26A 5E3IA 2FAXA 1B1CA 1HQKA 1X9IA 1PVDA 4H0LB 1YH3A 2Z2YA 3PGJA 1EZJA 4IDOA 3NBAA 1JAXA 3H7AA 4WEQA 1EVZA 4LBZA 2BSXA 5TMEA 3ZDFA 3C98A 4UHBA 5FLXA 4CEIB 2H9IA 1ODIA 2ZUDA 3H7IA 3MT7A 4OYLA 1PTJC 1IEWA 1R4NB 5LP6A 2BI7A 1LSSA 4UBKA 1JEYA 3CS3A 2YDEA 1W29A 2WG0A 1LPAB 1PIWA 2FOLA 1P62B 1N92A 4DV7B 4M98A 4PM4A 3Q7IA 3ILXA 4CFYA 4DA8A 4ZCPA 1SHTX 2B1QA 5IDXA 3KDAA 1E5XA 2BHTA 4B7ZA 1Y9ZA 2WSSD 1M6WA 1ILWA 2WEKA 3ER6A 4GLBA 2BVNA 4L8GA 5FBRB 1DPFA 3JAKB 4C30A 3VR2D 5KQLA 4WK6A 4X89A 3BEOA 3E4DA 4D0LB 4MHTA 2QP4A 2CTQA 4NONA 1BX0A 3DR5A 4R3NA 3RFXA 1FJXA 1GJRA 4MROA 3FJYA 3OSUA 3VNAA 4RKEA 4EHLA 4IVRA 4EP1A 3DXYA 5DNCA 5IPFA 3L04A 5MN6A 4GSYA 4S05A 5IS2A 2ADQB 4TXMA 1NI4A 1F14A 5GONA 1ZOPA 1Z29A 4JI2B 4MQMA 1IDSA 4E07A 2EZ4A 3BK2A 1V55B 3ABLC 3ES9A 3U16A 2CBXA 3C3XA 1B06A 1M33A 1NLFA 2OHHA 3P2KA 4R69A 4I9FA 4D4HA 5IVDA 3KKKA 3LPLA 3RLFA 3D3QA 5B53A 4RKYA 1H8EA 4IDDA 1RE1A 4C6TA 1HT1E 2ZGVA 3EXFB 4CU5A 4D56A 4X45A 1JKJB 1IH8A 2IH3C 2R9VA 3ZUGA 1L7RA 3H5AA 4ND8B 2BRUC 1T2EA 3MRSA 4TVKA 3GAZA 1VMKA 1PNVA 4PX2A 5IC5A 1VJ5A 3ZKWA 2EZPA 1E2KA 1ETHA 1MIOA 1XD8A 2IA5A 3O3OB 4CKEA 3ZMSA 1MO2A 2OCPA 3FMFA 4JLUA 3FYTA 3IMFA 3MGBA 1SUWA 3T7AA 2IFTA 2YI8A 4B3TB 5LUAA 4LYDA 1MIHA 4WOJA 3QI7A 3SBEA 4CTMA 3J80N 1GGJA 1JHPA 3UM9A 3V1LA 1U02A 3KSDO 1SEVA 2IH1C 1H2XA 4OSOA 3RS0A 3KU1A 1Q86W 2Q3HA 3P9KA 5LZ4A 1WXHA 2XQKA 4FW9A 4ZAYA 3OAAD 3RPEA 3PTAA 2LZ0A 5DEOA 3MEQA 1SR8A 3RWBA 1RSOB 4TYQA 3M7MX 3ZD6A 2PZ8A 4CS4A 4ZV4A 1KXZA 1LJLA 3PQDA 2IEBA 2ZUCA 3L93A 2R8YA 2AXNA 4RV9A 3IP3A 1AZTA 3CKYA 1ICEA 2QROA 1NKTA 4AWXA 2DFDA 13PKA 3CG0A 1UMCA 3L8GA 4G1CA 2JGMA 3GVIA 1TLLA 4BATA 4CG2A 2N3ZA 2O8NA 5KAIZ 1QGED 5ADVA 1RWVA 3A14A 3IXQA 5DCLA 2OCKA 2WZCA 1MNAA 3R1IA 3WQSB 1AILA 3CUVA 2CDCA 5CXXA 2XNKA 3D6VA 4WGGA 5DHPA 4PICA 2FHSA 1ZL8B 3HCOA 1X1EA 4J2TA 2W0XA 4BLRA 1ZW1A 4DB4A 3BSWA 1W30A 4EAQA 4JEMA 1Y6JA 1KFEB 4P7BA 4PG8A 2HZBA 1NJ8A 1PVVA 5TC4A 1UBUS 5DO9A 5JNTA 4FYMA 4BNXA 3VFDA 1YTFD 4NYIQ 2JLXA 1WXXA 4RKFA 1U2TA 2HW8A 4KDEA 3COSA 3GFBA 1YZYA 2WMDA 1Z0SA 2WK1A 4N7BA 4E30A 1A69A 3HLTA 1CUGA 1NF8A 3BGSA 1NOKA 3KWMA 3R6LA 1VQ4V 1QGZA 1N5IA 5IBRA 1CRZA 2RONA 2WHPB 1GRQA 2HQOA 3OQHA 4UREA 4ZD6A 2H5IA 1X9GA 3R6WA 3ZW8A 1SKUA 5JCJD 2EFDB 1KO7A 1B3QA 5DYGA 2PMWB 2D2XA 5B3AA 4Z9AA 1L1RA 1HPLA 1E8NA 4LRSB 3VKVA 4CCYB 2WQ6A 1NUSA 3K7EA 3B2QA 1XHFA 1PDOA 1E79A 1P2BA 1YB2A 1PYDA 2F67A 2HUNA 1Z2OX 2NN3C 4L1KA 1C0EA 2GAOA 3B53X 2VDKB 4F21A 2Y0IA 3AFNA 2FCRA 3HXTA 4AI6A 2C96A 3OQPA 1KEWA 1JWAB 3P9XA 3K70B 2QZ9A 1T2DA 3W5IA 5F23A 5J9FA 4QOHA 1Z88A 3D2LA 2QT0A 3DMNA 5F2KA 5GW7A 1VMIA 5BY2A 3T1OA 2GPNA 1INLA 1IY2A 1JU4A 2ASEA 1SNYA 2B61A 2VKTA 3CO0S 3LZDA 2VHVA 3QTLA 3D4BA 1ESEA 5GWXA 4NARA 4AKSA 1P1BA 2B2XA 3N8DA 4TYMA 1JDSA 4D3XA