1CR1A

Crystal structure of the helicase domain of the gene 4 protein of bacteriophage t7: complex with dttp
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
277
structure length
245
Chain Sequence
MRERIREHLSSEESVGLLFSGCTGINDKTLGARGGEVIMVTSGSGMGKSTFVRQQALQWGTAMGKKVGLAMLEESVEETAEDLIGLHNRVRLRQSDSLKREIIENGKFDQWFDELFGNDTFHLYDSFAEAETDRLLAKLAYMRSGLGCDVIILDHISIRKMIDNLMTKLKGFAKSTGVVLVVICHLKTDLRGSGALRQLSDTIIALERNQLVLVRILKCRFTGDTGIAGYMEYNKETGWLEPSSY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA PRIMASE/HELICASE
publication title Crystal structure of the helicase domain from the replicative helicase-primase of bacteriophage T7.
pubmed doi rcsb
source organism Enterobacteria phage t7
molecule tags Transferase
total genus 78
structure length 245
sequence length 277
ec nomenclature ec 3.6.4.12: DNA helicase.
pdb deposition date 1999-08-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03796 DnaB_C DnaB-like helicase C terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1cr1A00
4N3NA 1Q20A 1Z06A 3PVSA 3UATA 5D3MA 4BASA 5KO2A 2ZJBA 2ZE7A 2VSXA 2F55A 1OFTA 3A37A 1E9RA 2QGZA 1SVLA 4AKGA 4OBEA 3U7FB 4DVGA 1E9AA 2YWHA 1ONBA 4QJ5A 3HR7A 1GOTA 1N0VC 1EFRA 4RZ3A 2XTNA 4KCGA 5IK2D 2GZHA 4BE7B 4F93B 2R65A 3QXJA 2MSDB 2OM2A 1N0UA 3ZVMA 2HV8A 1GNPA 3PUXA 4X8LA 3TR5A 3B8HA 1T5IA 1UDXA 3KL4A 3RS7A 3UIEA 4QNMA 5JEEA 4B6FA 1TQ4A 4FINA 5HE8A 4D82A 1KSFX 2Q3HA 1RZ3A 3BB4A 3BWDD 3EPLA 2J0SA 1UBCA 2NZ8A 2QAGA 4RZ2A 2IHBA 4NCJA 4LYFA 1KIMA 2A5DA 3KJHA 4AKHA 2R2AA 4Z54A 4BFSA 4JVSB 4RJLA 4ESVA 4I1OA 3HPQA 2B8WA 4IXNA 2QE7A 4Q1EA 1UKZA 1P73A 4TN1A 1R4AA 5DISB 4URVR 5CB8A 4EIWA 2GWHA 1G8FA 3EZ2A 4A0GA 1CJKC 2VHUA 4KHZA 1L8QA 1SXJA 1KO1A 1UBGA 2WWGA 3QEOA 2GDJA 4RKEA 1SVOA 5C1BA 3R8CA 1Z2CA 3SYNA 2HJVA 3I3SR 4I81A 4URUR 3I5YA 3WXMA 1NG9A 1W44A 1IY2A 3T1VA 1P2VA 1QVRA 1KO5A 2YC4C 1TQDA 3V4FA 3IIMA 2H1LA 1Q12A 1Z0JA 2R6DA 1NIJA 3AEZA 3AGQA 5CYOA 2QBYA 2CNWD 2YNMA 2D2EA 1SULA 5H70A 2ZR7A 2JIZA 3GFPA 3KXKA 5EP1A 3KDSE 5E95A 1D5CA 2AK2A 2QTHA 3J81k 3U7HB 2KSQA 4HI0E 1W0KA 4BPBA 2J7PD 4MH0R 2QRNA 3NBXX 1OH7A 2UZIR 4R71A 1KK2A 4FW9A 4NYJQ 1R8SA 1G19A 1TUIA 4DCTA 4QBIA 1ZC4A 4XTCS 4P31A 4A6XA 5P21A 3W6PA 2CCGA 3KJIA 1YZNA 1V5WA 1LV7A 1XEWY 1YKSA 3SHFA 5BYKA 3GJ6A 2OZEA 2RGEA 5KHOC 3U5ZB 5LDDC 3FHCB 1UEJA 1E2IA 1KI8A 4TLCA 4FCVA 4BLSA 2C9YA 2BMJA 3RSOA 4BFYA 4PSAA 1DO0A 2VSFA 5JI3E 1KSJA 1DARA 4DLYA 1W36C 3NDPA 4JIMA 1S3GA 3CO5A 4LDJA 1FL9A 2D4HA 4QJ3A 1HE8B 3A1WA 1F60A 4DDUA 2ZJYA 1TU3A 4QBGB 1OSNA 1DPFA 3KQLA 1GSIA 2FA9A 2JLYA 2YKGA 2B92A 2QA5A 2WOJA 1XMJA 4R2HA 2JIZD 2XNDA 2ZITA 721PA 1EWRA 3A1UA 1II8A 3U3RA 4LSGA 4M1YA 4D0LB 4TTRA 4MQBA 1E2LA 4MA4A 2ZANA 4MYHA 1IAQA 1QG4A 1W4RA 3OEEA 1IJFA 3WYFA 4YMVA 4A92A 2HT1A 2ZJAA 1N5JA 1PLLA 3CRVA 2Z5FA 3BH6A 4P4SB 1TX4B 2VP9A 1EFUA 2JGNA 1M2OB 1OT3A 2OXCA 2ZRBA 4QBFA 3SBDA 1JECA 3NBFA 4MRVA 1M7BA 5HZKA 4LJ5A 2IC5A 4B75A 1TAGA 1T9HA 3ASZA 1NN3A 4PR0A 1G1MA 1UF9A 2VPPA 2IUUA 3RRNA 1EFRD 1KDTA 3LW8A 4EDHA 4JL5A 2Y8EA 1P9RA 1W4CA 4WXRA 1YE8A 1VG0B 1ZC3A 4YMSA 3U44B 3VX3A 3MUFA 5LB4A 4B3GA 4Q01A 2AXPA 2VP0A 4LBZA 4W5WA 1ODFA 2WJIA 4HUQA 3KKOA 4O3MA 1C9KA 1J90A 2VHCA 4Q48A 5AWFC 5HCNA 1AZSC 3C4JA 3I4LA 4KSCA 4B3BA 3IO5A 2XNDD 1AQYA 1VCIA 3VX4A 1P7CA 4R9UC 3ADBA 3SR0A 3LBHA 4BLTA 2JLZA 3VKWA 4YMTA 3N70A 4JJKA 1NJFA 2XGJA 4DLWA 4OYHA 2BEJA 2OAQ1 3ZH9B 1QHHA 3MRSA 2A2ZA 3TW8B 1U94A 3FFBA 1PJRA 1D9XA 4BFZA 4IOJA 3GEHA 3X1DA 5F9FA 1FTNA 1QDEA 3AVOA 1L2TA 1G3UA 2NO9A 3CNNA 3CPJB 2PEZA 1GL6A 1OKKD 1W47A 3I92A 4RKFA 4TMVA 1PVOA 2KE5A 3TNFA 1U8ZA 2V1XA 3BE4A 4LWZA 2CE7A 2BVNA 1E1QA 4HZUB 2ZI5A 1T91A 4HLDA 3U4QA 2J46A 2GILA 5JBQA 4IVPA 5J47A 2OFXA 3MCAA 5LPNA 5CLLA 2YOGA 2CL6X 2F1RA 1KAOA 1D8TA 4DDVA 4XSHA 2WJVA 1VCMA 4RD4A 1EX7A 2WBLC 3EIQA 5CK5A 4DDTA 4PAQA 3ZZ0A 2F43B 5EE9A 5K8TA 3KQHA 1DAKA 2WMOB 3H84A 3ZVLA 1M34E 1ZM3A 1FNMA 2DFNA 4AYXA 4UNSA 2Q9AA 3K0SA 4CT4B 2GCPA 1CRPA 5TV2A 2WICA 2FMXA 4DUGA 4OQFA 3FTQA 1P5ZB 1N6RA 4PQRA 2XZPA 1DG3A 3GJ8A 4JLBA 2NQ2C 2FSIA 3K9HA 2X2EA 1BYUA 2ECKA 1XZQA 2R6CA 1DADA 4YMUA 3AB3A 1KI9A 4JLJA 2C9OA 2BHRA 2WTUA 5BN3A 4B3XA 4ZO4A 3L0OA 1GILA 2DFLA 4Q21A 3U3OA 3DHWC 1E1RA 1XPRA 3WYGA 5LB2A 4CW7A 5GJCA 4KLNA 1G6HA 4X8OA 3ADDA 2ANCA 4Q7MB 3V4RA 2ZE6A 3GJ7A 3GPLA 1IN7A 2QI9C 4B74A 2IF2A 3RRYA 3AV0B 3MAAC 2BWJA 2FZ4A 3B6EA 1IJEA 2GCNA 2Q9BA 2Z4SA 4IHQA 1RIFA 3ZIAA 2ZRGA 3PUYA 3RDPA 3TLXA 4PAOA 3BIFA 1NY6A 4RY2A 4EFMA 1US8B 2QTFA 4LX0A 4RD3A 2WJGA 5JWHA 3T06B 1N2CE 2D7DA 5AJVB 3NEJA 2CL7X 2DB3A 2ZRMA 2W83A 3JZAA 1EFHA 1NMZA 3Q7PA 3W34A 4C2TA 5IRCD 2JJ2A 5CM9C 4CEIA 3CRW1 1IQPA 1VTKA 1Z0AA 3CF6R 4BZPA 4Y0AA 1NVVR 3U61B 1NLFA 3KKPA 2B7CA 2OFWA 1KYIA 1X3SA 1E1RD 1YZUA 5FPSA 1QHSA 5JS7A 1OH8A 4M22A 3ZD6A 1QRAA 4IFEA 2GF0A 5EUQB 2EQBA 4V0OA 5FBRB 1WP9A 2QSZA 1E3MA 1G21E 2AWOA 3BOSA 1PUIA 4OQNA 4U7DA 4BGDA 4TZ6A 1OH6A 2AFIE 2YOFA 1OFIA 1XTJA 3KKNA 3M0EA 4JSTA 3BS4A 4LZZA 2ZRAA 4DLVA 2H5EA 3B82A 3K09C 2OBMA 4MITA 4ZCMA 3ZIAD 3KTAA 1NI3A 2J0UA 4B71A 3CH4B 2AN9A 5DN6D 3QQ5A 2PLFA 2OILA 2XJ9A 3OAAA 821PA 3IDQA 3T34A 4PPNA 1MRSA 1E6CA 4PO9A 4ZDKA 5DYIA 4HUTA 1KO4A 2MSCB 2G88A 3DVLA 4I1UA 5AR1A 2HJGA 1RC8A 4C7OA 1K5GA 1F48A 2IS2A 3B78A 4HEJA 5CJ2A 6Q21A 2KBEA 3CX7A 1TTTA 1E9DA 5FUYA 2DBYA 1R7RA 2O0JA 3IUYA 1Q44A 3QVVA 3T1OA 3C5HA 3RRMA 3VKGA 1QHIA 2ERYA 3TIFA 1EK0A 4GP7A 3LXXA 4K81B 1K6MA 1KKLA 2FFQA 4JS0A 1YZQA 2BBWA 2FH5B 3SNHA 4OHWA 3WNBA 4FIDA 4LUCA 2IYQA 1T8UA 3SJAA 2IYVA 4MUAA 2J7PA 3MG9A 3Q8XB 5B30A 2D62A 2F1HA 1II9A 4L4UA 1HY3A 2RB4A 5BQ5A 4LV8B 2V1UA 1XFAA 4OK6A 3U6BA 4WAUA 2LKCA 2QL6A 4D4MA 3VU9A 2REBA 4UNNA 3ZDQA 3ADKA 5AJXA 3O8RA 5JSZA 4ARZB 2REOA 2ZI9A 3O8BA 4D80A 1M1YE 2ZUBA 3EZ7A 1KI2A 4Q03A 1TUEA 2O8EA 2OLKA 1N25A 1HV8A 2ZR0A 4E07A 4WBSA 1X86B 3K9LA 1U99A 3L2OB 1Z8FA 3IIJA 3TUIC 4QM7A 3THXA 3EC2A 4QL3A 5J5CA 2BMFA 1YR6A 2J3EA 3QY0A 4PPQA 1E4VA 5EXSA 3RANA 1SXJC 3JVVA 1YR8A 3EIEA 3OEHA 4EPWA 1FFHA 1UBEA 5DHAA 1G18A 3QKSB 2ODNA 1W0KD 4C9BA 3WY9A 4WIAA 3CX8A 3QJYA 3FVQA 4PQFA 1I2DA 3DOEA 3GLHA 4DLZA 3GLIB 3QXXA 4GRAA 1KSGA 4DHEA 1GAJA 1DAMA 4HLQB 1FMJA 2V55B 4B34A 1GKYA 1NLZA 2ODBA 3I8XA 4DCVA 1B0UA 3KTAB 4MUBA 1DG1G 3TGPA 4BRWA 2IA5A 4BEJA 2QY9A 3ZZUA 4HDQB 5F3WB 1XEXA 4O2RA 3FMFA 1FX0B 4MGZR 5J4HA 3LX5A 3SYLA 2C99A 4NCNA 1LW7A 1UKYA 3FHTA 1MOZA 2E1RA 4M53A 3KQNA 4B35A 2FDCA 3AKEA 1EFTA 4UJ3A 3SOPA 4A0RA 1OH5A 3CX6A 3AVVA 1T0JB 5AJWA 3U7GA 3LDAA 2X1VA 2PLRA 2QT1A 1W5SA 2IK8A 3DM9B 4GI7A 2QU8A 5G40A 4LI0A 1KMHB 2WJYA 3VR1A 2GCOA 2IYUA 2UKDA 3AQ4A 2GRJA 3AVXA 1IM2A 4RZUA 2HUPA 2QPAA 1YU9A 1JAHA 1G5RA 4IEEA 4UNQA 2JCSA 2IYYA 1E9BA 4PC6A 3CRQA 3TSZA 1UADA 5FBLB 3BBPA 1E79A 1XXHE 5HCIA 3CW2A 5TY0A 3R9XA 4AIIA 2D74A 3B9PA 5J4LA 3R8FA 4GBMA 2GJAA 3AKDA 1X8KA 1Q57A 4Z1MA 4CEHB 3D8BA 2GEVA 3HPRA 5E3HA 2JJ1D 1NVUQ 2QAJA 1OFHA 3EZ9A 4XSGA 1NVXQ 1ZM7A 3ETLA 1XD2A 1W36D 3QOFA 3PEUA 1G64A 4HAUA 4Z8YA 3RVBA 2CLSA 2XJ4A 1II8B 3H0KA 1R0XA 1NKTA 3PUWA 4EJSA 2RGNA 1TADA 3MGCA 4D4LA 3WMGA 3WBKA 3GEEA 5E7IA 4KFUA 2ZRFA 3GQBA 5FR1A 3C14C 1ESNA 2VF7A 4HZIA 4RSGA 2H17A 3CONA 2DFTA 2VQSA 3SBEA 5JSZB 3ICEA 2N1BA 5ANRB 1P2TA 1R0ZA 1AS2A 1IHUA 2GJKA 2JLRA 2UVQA 2V6IA 2IF0A 2ZSAA 2IHYA 3DOFA 4M21A 4ESHA 2CBZA 4HDOB 4ASUA 2JAQA 3QKRB 1ZYUA 2HXYA 2AD5A 3WYAA 2DWOA 1G3IA 2GBLC 3FHOA 2RH5A 4K46A 1P3JA 5DI3B 3A1SA 3BH7A 2ONKA 1DEKA 2HT6A 2EWVA 2JLQA 2O8FB 1H8EA 2K5UA 3K9NA 1TQ6A 1RKBA 4D2IA 1OB5A 4TL6A 1OFUX 4V03A 1HT1E 3MSXA 5FOUA 2P5TB 4GDFA 1W2GA 3NHAA 4C3ZA 5FI1B 1E2MA 3E2IA 4FMBB 3E5HA 3P1JA 3TAHA 4BRUA 2ZRHA 2ZE5A 3EAQA 1OE0A 3IKJA 4M1MA 1NIPA 3VQTA 4BFVA 2EFEB 3RLFA 2B21A 4G3XA 5SZIA 1AK2A 1YHNA 1P2UA 3M6AA 1P62B 1RPZA 2W58A 2J9RA 3GJ0A 3W6OA 3GEIA 1GG2A 3ICQB 2NPIA 2QP9X 3SU8A 3QNUA 3OFND 3A6PC 2XXAB 4ZIRA 3W6NA 3OIUA 2VHQA 4C0SA 2PZGA 5CITA 4II7A 1KMQA 1M6NA 2J7KA 2VP5A 3V9PA 5L3SA 2PT5A 3EW9A 1FQKA 2IT1A 2HYDA 1NVVQ 2W6ID 4MRPA 4QG7A 3RNLA 5DNYB 1G7RA 3O47A 4RZXA 5FUVA 3Q72A 4NMMA 1XF9A 1NY5A 1Z5ZA 2QN6A 4B43A 4AURA 2O8FA 2ORVA 1WRBA 5A4JA 2HLDA 1SVMA 1NP6A 3PFIA 2ZETA 2QROA 2O8DB 5C2JB 2J1LA 2C04A 4TWZA 4AYTA 3BD9A 5JMTA 4LHXA 1NVWQ 4TLBA 5B2ZA 1E96A 5GJBA 1EX6A 3TH5A 2ZIAA 3WNDA 4DLXA 2QP3A 1UBFA 1NSTA 2H8KA 5GADl 4TYNA 1XPOA 4C0AC 5FTJA 5M04A 2P67A 3FWYA 2PJZA 4C0HA 2GTPA 4X8HA 2GAOA 5FTMA 1T5LA 4CZ2A 4MGKR 1P4SA 5JFGA 1W46A 5KPDA 2FJUA 4E22A 3SS8A 4YQFA 2ODWA 4B2IA 1LTQA 2B6HA 1DAHA 4LJ4A 4NE2A 2CK3D 2QM8A 1QHHB 3B9QA 2H92A 3I73A 1NG1A 4N1AA 2PMKA 3P27A 4FXPA 3AUXA 2JEOA 3K0CA 1OIVA 2VH5R 2RGNC 5DYGA 1ZJ6A 3CR7A 2OAP1 4IW3B 1JR3D 2NTYC 3E1SA 4P4UA 4QGFA 5F9HA 1EWQA 1JPNA 4QHYA 4HUQB 1AQUA 4MRNA 4EPTA 4YXWD 4JT2A 2FSGA 3FKSD 3CM0A 3TAUA 3S1AA 2WWWA 3BAFA 4C0JA 5DE3A 3C7KA 1CEEA 2WVJA 3TQCA 3HU3A 1MKYA 2O52A 3VKHA 1NBMD 1ZD8A 3T5GA 1N6OA 2B8TA 2PCJA 1AIPA 2W6JA 4FCWA 1AS3A 5FI0B 4URYR 4TYYA 3PEWA 2ZRPA 3FMPB 4UJ5A 1SKQA 2ZYVX 3VR6A 1HTWA 5KDLA 5L3RA 2YVUA 1UFQA 3QXSA 4CEHA 1W49A 1BO6A 1SXJD 2P65A 2RGAA 3UWOA 2BBTA 3W5JA 2EYUA 2ORWA 4DLUA 5IK2A 1T6NA 2QENA 3ZVNA 4OHZA 3W8RA 4AC9A 2RCNA 3FB4A 3T35A 2QMEA 4BUJA 3EPKA 3DM5A 1FX0A 5DO9A 3KB2A 1Q1EA 5E4FA 1XBTA 1SKYE 4YMWA 1Q0UA 2ATVA 3AP1A 4URWR 4MYTA 3L8ZA 1QF9A 1GWNA 2YOHA 4ZV4A 3UWKA 1U81A 221PA 1GIAA 4C30A 4OKSA 2NO7A 3VHLB 2FFAA 3PUVA 1RJ9B 2JA1A 2NMVA 2O0KA 2A5YB 4JSYA 1M7GA 1X8JA 2XTMA 2WM9B 3DMNA 3PCRB 3ND8A 4M9SA 3I5XA 2JDIA 1KGDA 3GFOA 1OXUA 2PL3A 1G3MA 2QQEA 2MSEB 3RS5A 5HKKA 5FR2A 5H8WA 2ZJ8A 4NBSA 3THOA 2F9LA 4DB4A 3IPXA 1K5DA 2R6AA 1Z3IX 2NO1A 3SJZA 4H1UA 1N6LA 1HQCA 1IN4A 1KDOA 2WZQA 1XTKA 1XB2A 3O8CA 3A8TA 2REXB 1JXOA 2EYQA 4LJYA 2DHRA 3IGFA 1XTIA 4KXFB 2ZRKA 1PZNA 1L4UA 3SJCA 1Z0KA 4KODA 1E0JA 1Q1BA 2DPXA 5FUXA 3SN6A 2VRWA 2ZI6A 3TBKA 4PFSA 2VBCA 4LCBA 5TARA 3AGPA 2AXNA 2VTKA 1Y63A 2GETA 4QNRA 3ASYA 3THWB 3I62A 4AWXA 2ZSFA 4DB2A 3TR0A 4IFBA 3BFKA 3CZQA 5FL7D 4Q4AB 1DOAA 2V3CC 2ZRCA 3CLVA 4EJSC 2Q21A 2MMGA 3HYRA 5LD2B 4PPFA 2IUSA 4G5OA 2G83A 4M1OA 1UPTA 2QM7A 4G5GA 4NKRA 3K70B 1KK3A 1MT0A 2RMKA 2VL7A 2MMCA 1CP2A 1VG9B 3AF3A 2OT3B 5FBQB 5G53C 1WA5A 4TL9A 4C4PA 3HDTA 3TUJC 1S2MA 3JZMA 1MRNA 4B3DA 5JEDA 4QGGA 5HTKA 1I2MA 3QKSA 3BORA 2BEKA 3QF7A 4QJ4A 4D4JA 1OIWA 1A4RA 1BS1A 1DAIA 1F3OA 3LBIA 3K0FB 1Z0FA 1J70A 2P6NA 3LX8A 5L3VA 4Q02A 3TJZA 2KJQA 1TF7A 4F4JA 2CVHA 2NO0A 1Z28A 3P4XA 4LHVA 3HWSA 1KI4A 3IILA 4URZR 4EPVA 1R5OA 1T3SA 1AKYA 1P9NA 1G8PA 1E2PA 2ZROA 5AUPB 2H7VA 3KJEA 1T0HB 4OJQA 1CS4C 1DS6A 1FMLA 1KOFA 4TSFA 1QZXA 5KSZA 2RGGA 3V00A 4OJKA 1G8GA 3H86A 1XMIA 3DMDA 2GESA 5BWMA 2RHMA 4W5JA 3CRRA 2YV5A 4TT3D 5SZJA 2W2VA 4KVGA 5DLQC 1HEIA 1J8MF 2FWRA 1W7AA 1W2HA 2QORA 3QKRA 1X6VA 1N3BA 2FGJA 1KI6A 4MGYR 3T5DA 4M9ZA 3RC8A 3SE0A 1E79D 2A5GA 4XJXA 1SXJE 2H16A 4ITRC 3SDZA 3N2IA 4H1VA 2RAPA 4NCIA 4Q1DA 1U0JA 3IQXA 3UG6A 2ZM5A 2OEPA 2VYFA 2HDNB 4Q66C 2KI5A 4KAXA 3CR8A 4B3CA 1GNRA 2GK7A 2WKRA 3PENA 5E7JA 1XCMA 1XD2B 1RVDA 3NG1A 2JLXA 4A2PA 1W1WA 1QBKC 3SFVA 2ZSEA 4LOAA 3GLGE 3A58B 3KUDA 5EXTA 3T1QA 1JNYA 2PEYA 1OHHD 3UANA 2VP6A 4KFTA 5DHFA 1YR9A 3UKDA 2JDID 4TLAA 2J0UB 3CF2A 5CIWA 1VKJA 1VPLA 2AK3A 1ZUHA 2V54A 2QAGC 4B6EA 3M4YA 4TQUS 3F0TA 5LBIA 2FOLA 4B2PA 2J0QA 2EWWA 1GFIA 3I8SA 4LBWA 4PAMA 3H4MA 1GUAA 1XEXB 2PMDA 2P0EA 1VMAA 2JJ8A 3DO6A 2BV3A 4JMPA 2AWNA 2BJVA 2CL0X 2ONJA 1RYHA 1JB1A 3Q5EA 2WPDD 4G0NA 2I3BA 2Q3MA 3LAWA 4JKYA 5KNBA 4B3FX 1A7JA 1CULC 3KKMA 3NC1C 1ZRHA 1S1MA 2WHXA 1U8AA 5BXQC 2H18A 4KFRA 4JBYA 3NKVA 4LBVA 3MJRA 4LC0A 4B44A 5BN4A 4NYMR 4D25A 3K0CC 1A2KC 4WW0A 3QSYA 3D3QA 3QPVA 2PZEA 4A0HA 4JVMA 1S3SA 2JATA 5FPHA 2R6FA 4JKIA 1N6PA 3K0FA 3KKQA 3NTUA 4UXIA 1UKEA 4ZDWA 5FH9A 1US8A 3I61A 3GJ5A 1X8LA 1E0KA 4HAVA 4A8JB 1NMXA 5SZKB 4CVNA 2FF7A 2HYIC 1SHZA 1E9CA 3QBTA 2XZOA 3ZYCA 4G5QA 1CIPA 4NTZA 1VG1A 5JHHB 4KYUA 1MO3A 3HR8A 3FPAA 4URXR 1G4UR 2XOKA 1RJ9A 3L0SA 1WB9A 1CBUA 3JVUA 3U44A 1N6NA 3RS2A 4TMWA 3QVUA 3B2EA 2O8CA 1GVNB 4A9AA 1UJ2A 3THYA 1S1CA 3SHWA 2Z6VA 2ZJ2A 3HU2A 2CCKA 1LB1B 2Z4RA 2G0NA 4KV9A 1AGRA 1TU4A 2OUKA 1II0A 1GKIA 3ZVRA 4HLUC 2ZRDA 1N6IA 4AG6A 4ACAA 4A15A 5GJWC 4PSVA 3WHLA 2VEDA 4TSFD 1FUKA 2JLUA 1ZCBA 2G77B 1G7TA 1KHTA 5J4YA 4CRWB 1KO8A 4GOKA 1TF2A 3AF2A 2R6GA 5EUMA 1VIYA 2DYKA 3K70D 3CUEF 3GLHB 3THXB 2JLWA 3LV8A 5EE0A 4XIGS 3NBZC 4MKFA 4V0MA 1Q21A 2HEIA 1KSHA 5DGXA 2CVFA 1ZNYA 4G1UC 4PANA 4N0EA 1JQJC 3U3KA 2IS6A 2QMUA 4M8NE 4MRSA 521PA 4XWOA 4YLGA 2VSOA 3IBYA 1BMFD 4RFSA 4GZLA 1OXXK 4PHGA 1E9FA 4N0DA 4ABYA 1E0AA 1CJMA 5CYPA 1OIXA 2XOKD 1GKUB 5JJIA 4OK3A 2C98A 3KFVA 4XD7D 1NF3A 1EESA 4C0LA 4ILEA 1E1QD 3UG7A 2XSZA 3N5CA 3QE0A 2PX0A 5JCZA 1XJ0A 2PBRA 3Q3JB 4S35A 3C41J 4B48A 3EWAA 2F1IA 4FMCB 1XU4A 2E87A 3QIAA 2FGKA 1CU1A 4R98A 4OQMA 3D7MA 1DE0A 4EPRA 3X1YA 2CE2X 5JWOA 4AY2A 1G6OA 4WOPA 1OV4A 4FD2A 2XNSA 3OIWA 4PTLA 5G3YA 1GP2A 1MABB 4Q7KA 4TQAA 4YC7A 2WSMA 3W9YA 4LYHA 5L3QA 1NMYA 3AVYA 5JJLA 2OV2A 5BW8A 4PC7A 4L9WA 1JEEA 1ZIOA 4NHOA 1E9EA 4PC1A 4TLDA 1TNDA 4KJZA 2G3YA 2IXGA 4LHWA 4PO8A 5D3QA 2FNAA 4KO8A 4OI0A 4RD2A 1OYWA 4YDSA 1Z6YA 4PPGA 1P75A 1KDRA 2XITA 4C7OB 4Q4LA 1FP7A 3UMFA 1ZUNB 1FPMA 1M8PA 2ZTSA 3I72A 4K8OA 2EFGA 4HSEA 4NU0A 2FEMA 4GSYA 4CDGA 4XD7A 1FNNA 1VHLA 3MJHA 3I32A 2BMDA 3LWNA 1UDWA 3RS3A 4D26A 5KPJA 1KI3A 2X2FA 4CEJA 2G1JA 4WVFA 2HF9A 2QMOA 3AVUA 2XAUA 1KJYA 1IOZA 1FTSA 4GL2A 4AYWA 2YINC 2XB2A 1D2NA 2V7QD 1YZTA 4DBLC 4OI4A 2IXFA 2RGDA 4Q7LA 4BLPA 1IY1A 2OLJA 4JVNA 4FI3C 2ZR9A 3MWKA 4B73A 4CYMA 4WZAE 1XRJA 2FZLA 1XP8A 4BLRA 2WJHA 1FZQA 2QMHA 2XXAA 3AKCA 2QPOA 4EFNA 3BB3A 3DL0A 2ZXUA 1LFDB 1E0SA 1NRJB 1R5NA 2YHSA 1EFCA 4G5RA 3MD0A 4KBFA 3H2YA 4NP6A 5K8UA 4DEXA 2A3RA 2FPLA 2AKAB 4HLUA 2WPDA 2OE2A 5GJVC 3K70C 4DCNA 2I1VB 4WZ6A 4BECA 2VHJA 2FN4A 4PHTA 2OSBA 3GJ4A 3R9IA 2NO6A 4Q00A 2ZJZA 1XWIA 4XTRA 1LS6A 4UNPA 4TMZA 4Z1MD 3DEFA 5EZ6B 5JI2E 2FE4A 3B60A 4PHHA 4CGZA 2FEOA 3F3YA 2WWXA 1RW4A 3O8DA 3U6KA 3GLFB 4LK2A 2W2TA 3QENA 4XWAA 2A9KA 1G17A 5FUWA 2IYSA 2J0VA 2X8AA 1Z6XA 2IYTA 3W3AA 1OXVA 4GFDA 4Q4HB 4RD1A 3ECCA 4TYPA 4HAYA 5IT5A 3W3ZB 4DIDA 3G0HA 1AJEA 4ACBA 3GJ3A 4FWIB 1MO4A 1U0HC 3MLEA 3P4YA 4TTQA 4US0R 4HZUA 4RCZA 3P20A 1Z6AA 3WRXC 4KITB 2ZPTX 3OF5A 3GLIE 1XEFA 1YJ5A 1GRRA 4DRZA 1LY1A 1OKKA 2ORIA 4ZPXA 2R62A 4US2R 4YONB 1JEDA 1OXSC 1Q22A 2EW1A 4LYAA 4DXAA 3PEYA 3GLFE 2FSFA 1WQ1R 2OO7A 5C18A 1Z63A 1IXSB 1M74A 4F7WA 5FTNA 2O8DA 1XTQA 4GOXA 5B58C 5J4KA 1NJGA 2A7QA 2IYLD 2CNWA 3X1WA 1JXMA 2C5LA 1CKEA 3EASA 1R5BA 1W0JD 4MDFA 4B2LA 2GKSA 4ERNA 1HUQA 3GLFA 2QUZA 4A1FA 5JECA 3EZ6A 2I1QA 3LA6A 4ZKEA 3TE6A 4J0QA 3LXRA 2O0HA 2HCJB 3A36A 4XOIA 5AJYA 4L8GA 2J41A 4EUNA 1RRGA 4V02A 4EKDA 3W8NA 2KWIA 4IXMA 1BYIA 2C77A 2Z0MA 3RSLA 4JLAA 2ZAMA 1SVIA 3OAAD 5H1YA 1QHNA 2Q3FA 5EE3A 3T12A 4KYIB 1E99A 2C95A 2GVDC 4DLSA 1H8HD 3IHLA 3EIHA 5DIFA 3L82B 2R44A 2W6IA 3VR2A 1IN8A 3CZPA 4IDQA 3BGWA 3NC0C 1RRFA 1OXTA 1TPZA 2KBFA 4BFUA 2CJWB 2D7CA 4D81A 2GXUA 1FUUA 3B5JA 4D4KA 1JR3A 2BBOA 3QKUA 2JLSA 4M9XA 4L16A 2WWHA 3CNOA 4KFSA 5TB5A 1W0JA 2V7QA 3Q85A 3GJXC 2V8OA 3G82C 4BQSA 2FFBA 4Q1CA 1Z07A 3GLGA 2FX3A 5HE9A 5CM8B 2QE7D 2IXEA 4UXHA 3UPUA 1OHHA 1TMKA 2J87A 4HATA 4I1VA 4DWJA 3BRWD 1XXHA 2ZS7A 4M0LA 4PO1A 3QI2A 1JJVA 2UZ3A 4U5XA 4IRUB 5KSOA 1GM5A 3QPWA 2YJTD 3EZFA 5EP3A 2CK3A 3A1VA 3EG5A 4ZDIA 4DC9A 4HB2A 2ZAOA 1KO7A 3LW7A 4JLOA 4D6PA 3LVRE 2J45A 1H8HA 2XZLA 2WKQA 2C96A 2ZJOA 3QUSA 4GNKA 1VYTA 4EQ6A 3X1ZA 3AVPA 1QG2A 3SEAA 5G41A 3KZ1E 5J4VA 5ELXA 1G5PA 5GVSA 2YZ2A 4BLQA 2QQ0A 4TQ9A 4QKQA 3CBQA 4AG5A 1COWA 1NBME 4TTPA 4F91B 2O8BA 2BKEA 1Y3AA 2ZRJA 4TL7A 5FBWB 2R9VA 2OXRA 4QFMA 5SZHB 3RC3A 1AM4D 2ZVPX 4Y0VA 1K8RA 4GOJA 3U4QB 4PX9A 2W6JD 3BK7A 3KUCA 5JJKA 1ZINA 2DY1A 3OFNA 1OLOA 1IN6A 2P3SA 3NXSA 1G9XA 2FV8A 1J99A 1ZU4A 1NN0A 1YQTA 4Q9IA 2AR7A 2CHGA 3DKVA 1Z29A 2YWEA 2F9MA 1KJZA 2IS4A 3LH5A 4QGAA 2OBNA 4HDCA 4PZZA 2P6UA 2G6BA 1U9IA 3C15C 4XVRA 3GD7A 2Z43A 4U00A 1BH2A 5KDOA 2BCJQ 1XXHB 2C2HA 1CR1A 4LPSA 1F2TA 1TEVA 1U9IC 4A4DA 2BBSA 2WWIA 3FYHA 3BXZA 4P4SA 1BIFA 2VP4A 3E70C 2GA8A 1ZD1A 3B7GA 3U7EB 2QTVB 2EFCB 3CB4A 2VIIA 1AA9A 1R0WA 2IEYA 1E2NA 3KFXA 1C4OA 1KI1A 3AF1A 3UXMA 1R8QA 2V9PA 4M1SA 2GJ8A 4P32A 4A0FA 1GRQA 3NH9A 1JQLB 3OIYA 5KSPA 4QHTA 3U3MA 3FOZA 2CJWA 4Z51A 5EP4A 3B1XA 2ZS8A 4JLMA 2PJRA 2O8CB 4NYIR 4M9QA 5EP2A 4HAZA 4QXAA 2IYRA 4V0ME 4MDEA 1SGWA 2F3TA 1CJUC 4P33A 2FFHA 5HKKD 1YZKA 2BOVA 4E09A 2ZJ5A 2ZYWX 3ZS8A 2GHIA 4C0QC 2WOOA 1GITA 1NSFA 3NHBA 3R7WA 8OHMA 2WJJA 2D06A 3WRYC 1FP6A 1Z6TA 2QRZA 1Z0DA 3ADCA 2OCAA 1JBKA 1VCOA 5D3MB 4D0GA 2RGBA 3NIBA 4KSBA 1CJTC 2RGXA 2FPKA 2OESA 5KTYA 3H1TA 2DR3A 3NVAA 2WSSD 2ZU6A 4MRRA 1XJQA 4BZQA 1HURA 5B64A 2R8RA 1VYVA 2EFHB 2JASA 2WAYA 2O8EB 3RWMB 3UK6A 3TQFA 4EPYA 1L7VC 4LC1A 4OI2A 4DUGD 4F92B 4CT5A 4KVAA 4ZCIA 2QBYB 3A4MA 1QHGA 3PITA 3VU9B 4ZCLA 2ZI7A 2GEDA 3THYB 1XD9A 4JBXA 2O5VA 1VHTA 2W2XA 5DI9A 3DPUA 3GP8A 5HR5A 1D9ZA 3K1JA 2CLDX 4NYJR 1PLKA 2YYZA 2GNOA 4M2LA 2GEUA 1YVDA 1U90A 2GZDA 3BH0A 3CIOA 2JJ1A 4LYJA 5IDVA 3RHFA 2A78A 1N5LA 2XSZD 5EXPA 2ZYTX 3ZQ6A 4A8JA 1G291 4WA7A 2GBLA 1G3QA 1RRCA 1KK1A 4Q9HA 1CRQA 1XNJA 2ATXA 3EC1A 2ZSBA 4IDNA 5KDDA 1WBDA 4DT1B 3SQXA 2BJWA 1E2QA 621PA 4RCYA 1LVGA 2VHTA 3UMSA 1JI0A 1JR6A 1R2QA 1FQJA 3PEVA 2GXSA 1GDDA 1D6JA 4FMCF 3OEED 3HU1A 3LY5A 1CXZA 2YWFA 5EZ5A 1ZNWA 3NEYA 3QF4B 3L0IB 3P32A 5BN5A 1NN5A 3FE2A 1EG7A 2Q0HA 2P6RA 2VA8A 4LV6A 3OESA 3VAAA 1Z08A 2ZREA 3U3JA 5A5GA 3F5FA 1P61B 3SZRA 5FFMA 3EWSA 4JZKA 3A4LA 1HA3A 1DO2A 2YWGA 1UEIA 3KJGA 4LJ6A 1AS0A 1YZLA 2C9CA 4PC2A 4QC2A 5FOWA 1LS1A 2EFDB 2GAAA 4YDHB 5C4MA 3W90A 4CEJB 3T61A 1DAFA 4QM6A 3OEHD 5L3SB 3NWJA 1E2JA 4M1KA 3B1YA 2NIPA 4JYBA 1CJVC 1DTSA 1OW3B 4Q5IA 5BYJA 4P3YA 4PSKA 1E32A 3R7WB 4E5UA 3TKLA 3ZQJA 4GPTA 4Q4AA 1NKSA 1DAEA 3TRFA 4Q19A 3WMEA 1X1SA 4EFLA 1W36B 1GTVA 4NL4H 1Z83A 3CRMA 3BFXA 5KYKA 1XCGB 4LRWA 5JRZA 2VP2A 2QEQA 2YC2C 5CK4A 2QNRA 5C46F 4DCUA 4OL0A 4HB4A 3GLIA 1JR3E 4RFSB 1E98A 2WMNB 4WZBE 3FKQA 1ZD9A 4B33A 4DT1A 1E2HA 4F38A 2C03A 4EPXA 2IWHA 1LF5A 4KI0A 2E9SA 5UKDA 1A5TA 1MABA 2HLDD 2HCBA 1ZM2A 4FN5A 4JL6A 1DVRA 4PZYA 1E69A 5AK0A 2WSSA 3QBVA 1HH4A 4GZMA 1E2EA 3K53A 3AP3A 3FKSA 1EGAA 5DSZA 3WMFA 4AK9A 1KNQA 3AF4A 2LKDA 4DIEA 4IEIA 1WCV1 1Q1QA 1F2UA 3HP1A 4ZI3A 3AVWA 2Z83A 4IKEA 4TMTA 4TMKA 1GNQA 4LGMA 4CEIB 4L5BA 2A5FA 4DZZA 4QOSA 1P60A 1G8HA 4Q4JA 4UKDA 2CMKA 3TSOA 4Q9KA 4DLTA 3KQUA 4TYWA 5EQTA 1RRPA 3VR4A 2GCOB 4MKGA 3C8UA 2WKPA 1ANKA 3GLHE 3G5UA 3IHWA 4AI6A 2A5JA 1IN5A 2BC9A 4EJSB 3AVQA 2ZRLA 2WV9A 3X2SA 3SC3A 1ZW6A 3T15A 3WHKA 5TVKA 4L9SA 3PQCA 1HYQA 1XJCA 1TQ2A 2EVWX 3Q7QA 1YRAA 2G9NA 2F1JA 4A8JC 4WXPA 1B23P 4O25A 1T8TA 3RAPR 3EXAA 4TMXA 3EPHA 2V4ZA 3VTKA 4BFXA 1VDZA 2AL7A 2ERXA 2FSHA 3NDBB 4YXWA 1VYUA 3NH6A 4LPKA 1E4YA 3MWYW 4R2IA 2EU8A 1U98A 3NBYC 1W5TA 5AUOB 1COWD 1O3YA 1UAAA 3U2QA 2IS1A 3PR1A 2BDTA 4GMXA 4PC3A 2BM1A 3VHXA 3LBNA 3TW4A 5CDFE 4PXAA 4IDPA 1LNZA 4DSOA 4OI1A 4CF7A 4Q9LA 1G4AE 4DKXA 1SHKA 1CR4A 3ZD7A 1KI7A 1AN0A 4GP6A 4MYUA 1S4QA 4A82A 1FOEB 3FMIA 3AF0A 3SQWA 1IXRC 4HB3A 2CXXA 2ZUDA 3UMRA 3F8TA 1SVWA 1KNXA 2OHFA 4QRHA 4DCSA 4MKIA 5CDFA 2CCJA 3IEVA 3CNLA 1R10A 2X19A 3OZXA 2QGNA 4Q1BA 4L15A 3N2EA 3AP2A 1XDBA 1E2GA 1Q3TA 1UM8A 3EX7C 1AZTA 2ASEA 1XMSA 2F7SA 5JS8A 1RFLA 2OBLA 5CJPA 1AKEA 2ZYUX 5L8VA 3FDIA 3KQKA 4JVLA 1KJWA 5TXGA 1D2EA 3IIKA 1L4YA 4ZKDA 4JJZA 2AD1A 1NBMA 1ZAKA 2GVZC 3OHMA 3VR5A 2BM0A 3TK1A 4NYMQ 3AH8A 3SJBA 4JLVA 1WDTA 2BKUA 1BOFA 4OHYA 5JLJA 3RRZA 1S0UA 3CPHA 2QZ4A 2FU5C 1ZNZA 2IBMA 2WIAA 4KBGA 2HF8A 4ZDJA 2QG6A 1G3RA 4I1SA 2XX3A 2GK6A 2ODEA 2CLCX 4OQLA 2PCLA 3EARA 1IY0A 1PLJA 3WNCA 4JL8A 4ASUD 1P72A 1ELOA 1MH1A 1SVSA 2IEZA 4A6PA 3B1VA 2OCBA 4PZLA 4O0MA 2JJ2D 2ZI3A 421PA 2H57A 1N6KA 2F6RA 3BB1A 1G7SA 1VECA 1E2DA 3MMPA 3ND9A 4I4LA 4OK5A 3LFUA 1V43A 1J2JA 3B1ZA 4DSTA 1A82A 5HPYB 1VIAA 1N0WA 4LJ8A 2OCPA 3LD9A 1WBBA 4P4TA 2D3WA 2DWPA 4Q1FA 4RD6A 1CTQA 1ZMXA 3PG5A 5FTKA 1KY3A 4F4CA 5KU1A 1UKVY 2HXSA 4X8MA 2Q9CA 2AKYA 4IDHA 2WIBA 1PUJA 4FMDF 4G5SA 5JCPA 1ZIPA 1I4LD 2ZUCA 4IJMA 1OJLA 4POAA 1MO5A 2ZSDA 2IW3A 3BJIC 3REGA 3VFDA 4Q47A 2IUTA 3KXLA 2QP4A 5DH9A 3MFYA 5DN6A 2TMKA 4DSNA 2ZS9A 3K09A 5FOSA 4DJTA 2B7BA 3PV0A 1E2KA 1S9HA 2RKOA 1XX6A 3Q9LA 4OQXA 3D6TB 2VLIA 3ZLJA 2IWRA 4D0NA 1KI6B 1J8YF 1BMFA 1YRBA 4IOKA 4MYCA 2QT0A 5AUQA 1F5NA 5FPTA 5J40A 3REFA 2F43A 1SQ5A 1Q3HA 1N5IA 1DBSA 1N5KA 3LLUA 2DFKB 3K9GA 4RFVA 4Q4HA 2AX4A 5KNDA 1OB2A 4Q18A 3ZJYA 1XTSA 2Q6TA 1G8YA 2XEXA 2GXAA 4CIDA 1KTVA 4ZI2A 4PQYA 5CLQA 2XTZA 3HJNA 4UNRA 3BC1A 2GZAA 5H68A 3K0AA 1FW6A 4GMDA 3L0PA 4JT4A 1DAGA 5TMPA 5HZHA 1CF4A 4EAQA 1Z2AA 3X1XA 2BCGY 1QHXA 5FOXA 1I4TD 1D2MA 5G3ZA 4G01B 5FPKA 2ZQ5A 3C5CA 4HAXA 1E2FA 4M1TA 5K8IA 2W0SA 1BKDR 1ZM9A 1F2UB 5FTLA 3LNCA 4XVQA 121PA 3L43A 3QKTA 4W9MC 5KSYA 3LLMA 1QVAA 4M1WA 3GMTA 1IXZA 4LHYA 5L3QB 1XPUA 3B1WA 2LWIA 3GCGA 2PT7A 1E94E 4JLNA 1Q1ZA 1IONA 1WMSA 3KX2A 3CF0A 1P6XA 1Z0IA 2C78A 4C0BA 4TLEA 2C8VA 2V6JA 3B13B 3VNUA 1NN1A 1SVKA 1LF0A 3CPEA 2DCUA 4S2EA 3SFZA 3HYTA 4XWKA 4ZIRB 5KUTA 4DEYA 1GL9B 1G5TA 3IQWA 3LVQE 2BIFA 5CIQA 1Z6GA 3A1TA 1G16A 1KAGA 3K0EA 4RVCA 3P26A 4UQOA 4E03A 4IOMA 4MGIR 4A2WA 3PUZA 1O87A 3A4NA 4QHSA 1A1VA 3PXGA 1F6BA 3ZZTA 3FFAA 5JZVA 1G7CA 1SZPA 3QPUA 4FMDB 4FWTA 3IPYA 1OPXA 4AKIA 4TT3A 3CKLA 1CR2A 4B76A 1U8YA 5FBVB 2KB0A 2FG5A 4H9GA 2ZEJA 4Q7JB 4KLZA 1GRNA 4NYIQ 4JYCA 4V0KA 1PV4A 1SXJB 3GFTA 4A2QA 3RS0A 4GT1A 5GVRA 4M4SA 3LRPA 4NCKA 3B85A 4V0LA 1Z22A 5DI3A 2D2FA 3PIRA 1JAIA 4IVQA 1NLYA 3WBJA 2WWYA 4BZXA 1P2SA 5FL3A 4QGHA 3AM1A 1XCPA 4Q9JA 4ON9A 1S9DA 1TEXA 1OF1A 1QHYA 4HLCA 3L8YA 3VR3A 3AKYA 2XB4A 5KNCA 4AD8A 5TDHA 2QAGB 4TYQA 3QF4A 5FOTA 3RS4A 5EXXA 2N42A 2ZRIA 4P0TA 2CHVA 2A30A 4FCTA 4NONA 4RD0A 1GL7A 3W5IA 1T4GA 2CDNA 2IYZA 4BEBA 1KZ7B 2P5SA 1MV5A 1MO6A 2P2LA 3KXIA 1IBRA 2W0MA 4US1R 4MKHA 5FL7A 3FGNA 1W4AA 4B47A 1ZU5A 1ZP6A 1KMHA 3KB1A 1VCNA 1T3LA 4F4IA 4OHVA 3DKPA 4HB0A 1ZVQA 2BMEA 2F3RA 2VO1A 3U60B 1KY2A 1W4BA 2WWFA 5B57C 2RGCA 2JLVA 2GJ9A 4XH9B 3K8YA 5AUNB 1KDPA 1W48A 1ZCAA 2J5XA 3LO5A 4W7SA 3Q5DA 5IF9A 3LQQA 1TL7C 1WXQA 1WE2A 1AGPA 2SHKA 4TZ0A 3C16C 2NZJA 3ZGXA 3T1TA 5LD2C 2OG2A 3QEJA 3QG5A 4TL8A 2FPMA 3M1IA 4I99A 4DDWA 2NOAA 3DZDA 3AUYA 1OYYA 2GF9A 1H8ED 2GXQA 2NG1A 3QXHA 1J7KA 5FOVA 5JWRA 3AVTA 1CLUA 3IBGA 1MR3F 4W5HA 1VG8A 3R9WA 1RYFA 2QSYA 2J59A 1JJ7A 1XMVA 4LY6A 4BWYA 5CB6A 3THWA 1KKMA 1P9WA 3OE7D 4O2LA 3EPJA 3CWZA 5A0FA 3BFVA 2ZU0C 2RHDA 3TVTA 1ZNXA 3WP0A 3D31A 3TMKA 2NGRA 2ZE8A 1CR0A 1S96A 1R6BX 3QG1A 1XZPA 1G41A 1JPJA 2LCFA 2L0XA 4NCHA 3QXCA 1S8FA 4QBHA 4B32A 1XEWX 1ESMA 1TF5A 2O8BB 2X77A 3MWLA 4BFWA 2PH1A 1E9SA 4LJ7A 2ZI4A 4JBWA 1A2BA 1XTRA 5IHPA 4DLRA 4XVUA 1C1YA 1DELA 1SKYB 1U2RA 4BFTA 2ZRNA 4JLKA 4EQ6B 4C0KA 4A36A 2PX3A 1U0LA 1R0YA 1ZM4A 2OFOA 4UXJA 1WF3A 4NH0A 2CEAA 4Q4JB 1ETUA 4R7ZA 4BLOA 3SYKA 1HQYE 1ZUIA 3BERA 2ANBA 3DZ8A 5C4GB 5EE5B 1HE1C 3I1FA 3R20A 2W00A 2G0TA 1RE0A 1XD8A 4LV5B 1NNEA 2QPTA 4IOLA 5F2EA 2AFHE 4V0NA 4PHFA 5JRJA 2CHQA 3IEUA 1JALA 4NPHA 4NZYA 3TUZC 2IL1A 3CH5A 3OE7A 2ZVQX 4JLPA 5K8LA 4HYYA 3MWJA 4JLDA 3GLGB 4IVRA 4LJ9A 3VMFA 3DDCA 2IYXA 3ZS9A 1KK0A 4LBYA 4IDOA 2OCYC 3RABA 5AJZA 5E7MA 1EXMA 1HT2E 5EJEA 4Q1AA 5EE1A 5KOYA 4U02A 2GJSA 5FPYA 1G20E 1NL3A 2NPFA 3VNVA 1YR7A 5JHGB 1F2TB 3WP1B 1T3HA 3OIVA 4AKEA 3FMOB 2DWQA 4NDZA 3EA0A 2AHOA 3IO3A 4Z8XA 4ARZA 4HAWA 1ZBDA 2PZFA 3RYTC 3CWQA 3TVDA 4KU4A 3K0AB 3ONWA 4LJAA 3PJRA 4DSUA 4LHZA 4OHXA 3SI7A 2VF8A 5F98A 1N6HA 1M7HA 3LQRA 2IX3A 2IYWA 2WAXA 3S1AB 3RWOA 1X1RA 1I4DD 2G1KA 1KZGB 3EA5A 1GZSA 1H65A 2N46A 3TSWA 1Z47A 4C2UA 1YZGA 2I4IA
chains in the Genus database with same CATH superfamily
4FGJA 1Z06A 4KLRA 5JMWA 3TQIA 5FUBA 2ID7A 2YS7A 3O2QB 2ZJBA 4HEHA 2ZE7A 5CTAA 1BD3A 2F55A 2XYVA 2QVZX 1NQOA 3A37A 2UU9B 4EO4A 2QGZA 3REOA 3IV7A 3FDZA 2GASA 4D8XA 1SVLA 2FOXA 4PLTA 2DQZA 4DVGA 1W5BA 2YWHA 5DRYA 1KA9H 2PX8A 5GP1A 5KI6A 4KCGA 2XYRA 3ITEA 4BE7B 1C1HA 2O1XA 4D8YA 2R65A 3RPEA 5TQ0B 1N0UA 3D7SA 4AULA 1YB4A 1YMVA 4QU9A 3GBSA 4ZOLA 4QLAA 1TCBA 4FK8A 4MO9A 4ZOLB 2PUFA 1T5IA 4QOIA 3AXSA 3D9QX 1XQWA 4QNMA 4LF5B 3AW8A 4FINA 5IXYA 2HV9A 4DA4A 3QV2A 4ARIA 3WGKA 2ZYDA 3KYCB 2EAUA 2HJRA 3GXBA 1Q2UA 4RZ2A 4DVJA 4NFSA 1GTMA 5G4KB 5ILOA 1FW8A 1VA5A 2J6BA 4LYFA 3COWA 1YS2X 4M49A 3VZBA 3GD5A 3CHYA 4GKJB 3BIWA 4NZOA 4RVHA 1TGVA 2QRQA 4BRSA 4C08A 3UJ3X 1RMQA 2Z8XA 2QTMA 1WHSA 4HX9A 3GVCA 5FF9A 1PQYA 2QE7A 3B6IA 3G0GA 3HKCA 4URVR 5LQRA 1UBNA 1IYZA 2GWHA 2PLNA 4A0GA 3ZKWA 1CJKC 1QK4A 2VHUA 1E4EA 2OXTA 4JJGA 2C2GA 3WLSA 1KO1A 1TO6A 3QEOA 5AW2A 4RKEA 1SVOA 2JIMA 5AM1A 3FNGA 3SYNA 3LM8A 1DIAA 3K5WA 4I81A 3D4NA 4IDEA 5PGMA 3QOXA 3I5YA 1NG9A 1IY2A 4Y6RA 3RVQA 4U8HA 4TKZA 3RS8A 2DFPA 1C7IA 3NANA 3V4FA 1OWOA 3EZYA 2I0FA 1EI9A 2Q0QA 5LQJA 1Z0JA 4KVFA 5AIAA 3AEZA 1GN9A 5BW4A 3PF9A 2NUTA 3MINB 3MGGA 1XYVA 3H87A 3NORA 4YWJA 2JARA 1GD1O 1Y6FA 1PGJA 1K8QA 1D5CA 1GCUA 2QTHA 5DM1A 1TCVA 4HI0E 4ND5A 3NBXX 1PDWA 2WIKA 4U2EA 4PZCA 3L3BA 4R71A 4AW9A 3GDHA 4ZTBA 4B7UA 5GINE 1SBQA 2C4VA 2ROQA 4MIYA 1QS0B 1PJ8A 1T3ZA 2HH9A 1ZC4A 3JATA 1YJ8A 4YCDA 4A8HA 5ALRA 5SY9A 2IPLA 4GM1A 2C57A 3K5PA 2HHAA 1FYFA 3HL4A 5DKFA 3SHFA 5BYKA 1IJBA 4HN4B 3HJUA 5ESRA 2DLNA 3FUUA 3KCNA 5FLYA 3T0IA 4CKBB 1KMCA 1HXHA 3IA2A 2J5KA 2J09A 1GCOA 2X3FA 3BE6A 3FETA 5THXA 3ESAA 4WEQA 4QJIA 3GV0A 1EDBA 2CWDA 3B5EA 3N0VA 4YROA 1W36C 1MIOB 4QJ3A 3ZC3A 3ZNQA 1VI2A 3DF7A 3IMEA 1DDIA 2V4UA 3V8NA 3G0BA 1AK9A 1N3LA 4QBGB 1U4OA 3M83A 1DPFA 4AMGA 4OMUA 2AZXA 4H1TA 3OHSX 3U80A 1DT5A 1Q11A 5FI3A 1GSIA 2PFGA 2ZATA 2FG7C 4B1FA 2XB6A 1YI0A 2B92A 3GH3A 1U3UA 1XMJA 4MQ4A 2XNDA 1EWRA 5I5EA 5CVCA 5DTJA 3IQFA 4ROTA 3ZTTA 4LSGA 3R77A 4MQBA 1QYRA 2ZANA 3FHLA 2QTGA 5J3JA 4YALA 4O63O 1K68A 4LYEA 1RZUA 3OEEA 2VBIA 3GEDA 4XEHA 1ZIDA 4MQFB 2AOVA 4CCSA 3BH6A 2VP9A 1EFUA 4Y8VA 4NG4A 3UQYS 4QBFA 3GA7A 1SBCA 5B55A 1H4SA 1Y5RA 4G1VA 1M7BA 3G1TA 2FFRA 3O8QB 1ZO8A 2IC5A 3EIOA 4J9UE 5CAEB 3U81A 2JAXA 3ASZA 3EBOA 5TGZA 4RK6A 1NN3A 1UF9A 2YJ4A 1EDZA 4PVDA 1LVUA 3I4FA 4YB8A 1A4IA 1KDTA 1K2WA 1LK7A 4G1MB 4JL5A 3LT2A 3NM5A 5C5CA 2YFQA 3TOVA 1P9RA 1W4CA 3WKAA 1N7HA 2P9HA 3BCRA 2QV7A 5AMXA 4O59O 3U9TA 3U44B 4ODIA 3WK8A 4CLRB 3HDVA 2ECOA 3DCJA 1E3LA 4YIHA 4W5WA 4BPRA 1F4PA 4J76A 4RIIA 4WLUA 1IBLB 3KKOA 3FR7A 1JE1A 1NDHA 2KMLA 1WVIA 3E9MA 3OQ1A 4LZOA 5ICEA 4CLOA 1S4MA 3O2JA 4B3BA 1J2RA 1AQNA 3KEGA 2G08A 2EP7A 3LMKA 5BSVA 5LOVA 2XNDD 1AQYA 3HGTA 4Z1OA 1YT5A 3HFSA 1Q92A 2AV6A 3VKWA 2XIQA 5JS2A 1C9MA 5E6SB 1BX3A 3QUQA 3S2IA 5TE9A 1OU4A 5CURA 4F4HA 4OYHA 4BBPA 2GF2A 5A3JA 2OAQ1 3DAHA 3ZH9B 3N0XA 4C3VA 1AUQA 3NM4A 4ES6A 1UXIA 4EGFA 5ALTA 3ZXXA 5F33A 4BFZA 1PJRA 3C7CB 3AI1A 2HA2A 3GEHA 4ZVSA 1HM5A 3FSJX 3HY6A 3UM9A 2R86A 5LKAA 3AVOA 3LKBA 4IP0A 5I7WA 1NVFA 1U2DA 3CPJB 3I92A 4TMVA 1GL6A 3V7NA 3OQMA 2R68A 2X4DA 2XWQA 1YRQA 3TL2A 1E6KA 1NI5A 4JBHA 4JT9A 4CQMB 1BXKA 1JHRA 3AUUA 3ENQA 1K66A 1DINA 1MIOA 5LQSA 4HZUB 4HS4A 2ZI5A 1T9CA 3LXUX 4TXJA 2HBYA 2NU9B 3U4QA 3DE7X 1RPTA 2JFHA 2GILA 2H63A 4WBNB 5KVCA 2C0QA 1JN0A 1GU7A 2W6CX 2EG9A 3CVJA 4X1KA 4OX9Y 1G8SA 1TVKA 4MPDA 2JIPA 2B0JA 2F1RA 1BOOA 4EGJA 1KAOA 4DDVA 1WBJB 5T8KC 3AEUA 2CN1A 2XUKA 1WPRA 4DDTA 4RNDB 3ZZ0A 4BGEA 2WMOB 1RXWA 3VZSA 1REQB 3OD1A 5FUQA 1BCRA 1QIEA 2PJUA 3OCXA 4H1HA 3LPCA 4H6XA 5FBKA 4ZVTA 5CT4A 4CKXA 3ELYA 4C2UA 4TMFA 1FP4A 1UQTA 2FN7A 3FTQA 1R27A 1P5ZB 4PRZA 4ZC1A 3JD0A 2DPMA 1U8UA 3FKJA 4LGYA 2P27A 1MW8X 2J3KA 1UMDB 2Q5HA 3TLCA 2X4GA 2FSIA 3K9HA 4FFWA 1T43A 1UJCA 1XZQA 1UC8A 2N9UA 4JA2A 2UZ1A 4HGOA 4YMUA 2Y0PA 1KI9A 2WM3A 4JLJA 3CJTA 2BHRA 3NYIA 3DFFA 3HBAA 3R4CA 1NT4A 5KYTA 3K35A 2WTUA 3JVEA 1A50B 5JSQA 3D3KA 1MF7A 3L0OA 4K8RB 1TTPB 2VF4X 2Z04A 2CXRA 3C3MA 5EMJA 2V0CA 2GS9A 1A95A 3NR2A 1VIMA 1XRLA 2G36A 5EPOA 1A2QA 7ADHA 3C70A 3FPEA 3GIDA 3K1AA 3G2JA 4ZZ1A 1PK8A 4B4VA 3ADDA 5BSRA 1RWMA 1ODLA 3IJPA 3VKVA 4Q7MB 3P4UA 3QLVA 3PYMA 4RQBA 2IPOA 2ZE6A 4PGFA 4LNUA 1F4VA 5THQA 1CUGA 1LSUA 1NQ5A 3R75A 4WNAA 1EVEA 3DXZA 3TOZA 3BGOS 3KUXA 2B5OA 2JAPA 3LUAA 1QXSA 1BMQA 2HA7A 3CNEA 1IJEA 1CVRA 4QOEA 2HB6A 3ZUGA 4B84A 4WJLA 4IHQA 5LYJF 4KYVA 1RIFA 4PYIA 1I30A 3CVUA 1R6AA 2G07A 1SUCA 2ODQA 3FZNA 1YACA 3PUYA 4HVAA 2EHJA 2WU8A 3A9UA 3BG5A 2NTEA 3L6BA 4PAOA 3DUWA 1CY0A 2NP6A 1ENYA 2EJWA 2VAVA 3GARA 4I0WB 5JWHA 1N2CE 2JFYA 3K9WA 4IV8A 3RRXA 2D7DA 4Z99A 4KE8A 4A23A 5EGNA 3PXCX 4C0AC 5JD4A 1A04A 1HO3A 4RMIA 3R3UA 1VBFA 1A8SA 1X42A 4FYXA 5CXSA 4N76A 2R60A 1TT5B 3BGVA 2RK6A 4MQEA 1DQSA 1ES9A 2W98A 1T2EA 2XCSB 4C2TA 1W52X 1RRKA 3OCZA 4BCCA 2X14A 2EX1A 2JK0A 4RENA 2VJAA 3ETEA 4Y0AA 5IP5A 3MFQA 3VV3A 3WIOA 1EGHA 1QHSA 2BM8A 4BE9A 1C3JA 3JRWA 4XQEA 3UICA 5KMGB 4FGZA 2XECA 3E61A 2EZ8A 4NJMA 5IJZA 2BI7A 2EQBA 4I9GA 4UBIA 1P0IA 1M6EX 5FBRB 3T1HB 1E3WA 3IURA 4MARA 2AWOA 3GUUA 1F1BA 3OOSA 4H4CA 4WTOA 2EEPA 2XVYA 5KB3A 5A0TA 2AOUA 4BGDA 4TZ6A 1I36A 1OGYA 5I9BA 4EY8A 5JZOA 2CYCA 1OFIA 1U0RA 2XQVA 1ABEA 3M0EA 3BS4A 4JSTA 2PKCA 2ZRAA 3AZOA 3JD3A 2VBGA 3B82A 4DLVA 1UXJA 1I4OA 1SK9A 3WWDA 1PL7A 1ZS9A 4YV7A 3QQ5A 1WLSA 2ESRA 821PA 1AHIA 3IDQA 2J6CA 3MUEA 4U6SA 1X14A 4PO9A 3LK7A 3WGLA 4HUTA 3MJVA 4DBVO 3QP9A 1QRDA 4GOMD 3CB2A 2P68A 2GEBA 2R5NA 5AR1A 4YP9A 3WX0A 7REQA 1MPTA 4Y9RA 3LQ4A 3O8OB 4FZ3A 4HEJA 2FSUA 3RB8A 1X87A 2HWKA 1WV0A 4RLHA 2KBEA 1AQLA 3CX7A 5CA0A 1EXVA 1K8ZB 3C3KA 1U1FA 3IP8A 5EKUA 3ZWQA 2O57A 3IUYA 4UUQA 4C6TB 1V9CA 5B5SA 3C3AA 4Y2HA 5EIEA 2Y1CA 3IB6A 3C5HA 3RRMA 1WCXA 2ERYA 1Q15A 4IQFA 5JARA 2CV1A 4FGUA 4XQ0A 1KKLA 2VDWB 1BVHA 3UN1A 1KZ1A 4Q7EA 1LJLA 2P6PA 4B31A 4MV0A 1I51A 1V7CA 4TOIA 2J7PA 2ZYGA 4EO9A 3SYTA 1LDEA 5LQNA 1J2EA 2HSJA 4WV3A 4MI3A 5DK4A 4BNZA 4EUSA 2F1HA 3L1HA 3PBKA 4HFMA 4ISCA 4LV8B 5ITWA 2V1UA 1KWKA 1XFAA 4INPA 4OK6A 4YX9A 4ZEMA 1KXJA 3T9CA 4ZJZA 4ZYXA 1YFZA 3NI2A 5K0GA 4JHLA 1EFKA 1BWRA 5EWMB 3VU9A 3ZDQA 3TVYA 3ADKA 10MHA 4LDPA 3OZCA 4CQLB 3PWZA 3SQDA 4RVGA 2R6JA 4C3OB 3AYXB 1EZ4A 3AZQA 3EZ7A 4I46A 4YUWA 4Q03A 1WU8A 3GI1A 1TJPB 2GKGA 2OLKA 1HV8A 4RH3A 5H3CA 3IIJA 3CUUA 1L8XA 4BAZA 1E8MA 1I3CA 1ZD3A 1HDGO 5J5CA 1YR6A 3QY0A 4MHOA 4QQRA 3DWGA 4BV9A 4M0UA 4PPQA 4R2XA 4X1YA 5G0WA 1CQJA 3K16A 4AQ7A 1QP4A 3JVVA 1NWHA 4CM6A 1N7GA 2P4SA 1YR8A 2FZCA 3FRJA 5EZQA 1BFKA 1KY5A 2XCQA 4NNOA 3QKIA 6NULA 2LTAA 5DT2A 1LPAB 3QKSB 3MXTA 2HFJA 3NNDA 3QW4B 4KQJA 5HFAA 4C9BA 2IOHA 3CX8A 3QJYA 4LYGA 2E37A 4OX9B 1FJ2A 4DJEC 4JI7B 4QYSA 5E1DA 5AVTA 4IJKA 1M2VB 4MPRA 2Q41A 2O7VA 3BDVA 5TT0A 1ZCJA 1POXA 4I5DA 4CTMA 1FMJA 5LA6A 3PHGA 5BSEA 4BO8A 1IUNA 1KTIA 2YZMA 3EUFA 3W06A 5IULC 1R8YA 4ZO8A 2QM0A 3H2SA 4UUNA 4BRWA 3KJNA 5JYDA 2IA5A 4RMJA 2PRSA 4BEJA 2ZTVA 3IELA 3ZE8A 4CNQA 1LEHA 4JBLA 2UAGA 3HB5X 4PX2A 4KREA 4O2RA 5EIHA 1J5PA 1E4OA 4D56A 2HMYB 4I4CA 2YIMA 4I4TF 3O0DA 1OX5A 2OO5C 4EKGA 4WT7A 3K0KA 1B2LA 4NCNA 4LY3A 1GYQA 2P3QA 2XCIA 4HNUA 4FEAA 3LLSA 4AMVA 5LWHA 4PVCA 4ZVUA 3ZHZA 1UKYA 3FHTA 4QT4A 4X1KB 3KQNA 2SKDA 4B35A 3CLHA 3SOPA 4HQKA 3SIPA 4OJNA 5NULA 3UOWA 1NXQA 4D9NA 1T0JB 1CVIA 1YHZA 2R4QA 1Y8ZA 1MT3A 5ED4A 3D2CA 5BT8A 4HMPA 1W5SA 2X0JA 2IK8A 1BJTA 2P9YA 1UXGA 2VLBA 1PS8A 2QMZA 4KH1A 1V71A 2ZVJA 3IP7A 4LOIA 2Z57A 2UKDA 1V3QE 2IYUA 2I54A 1S2OA 2GRJA 3KR9A 4FEYA 2HUPA 4G0YA 3FYUC 4MVJG 4DNOA 3DZHA 2B7LA 3QITA 4UNQA 1PSWA 3I0ZA 4PNHA 4ZAXA 1BX1A 1JLLB 4B46A 1UWLA 1Z5OA 5COBA 1O95D 2QTLA 3ASUA 4WSOA 4EF6A 1VKNA 2ZWAA 4AIIA 4YS6A 3PIIA 2IE8A 3R8FA 3I5XA 5MGNA 3M4ZA 3AKDA 1CZUA 4B40A 2QX6A 4EEXA 2OCKA 1H3FA 4KGDA 3RT9A 4XEUA 1MQ8B 1S8AA 1OFHA 4D3YA 2ZIXA 1IVYA 3O94A 4FYWA 1C29B 1NVXQ 2I2BA 2WVGA 1QDLB 3TZKA 3V8MA 1QQAA 1W36D 4L74A 4HAUA 2DECA 4MRMA 4U9IS 5FA6A 2CLSA 2H2HA 2VJLA 3PUWA 1HZZC 1NKTA 2Z30A 3JWIA 3M89A 4IHKA 2KYRA 4BNWA 4EJSA 3A9RA 4FDMA 4D9HA 5B3LA 2DULA 4E5SA 3WMGA 1NU6A 4EUKA 5E7IA 1T24A 2XRYA 4BMCA 5EPUA 4CM5A 5A5DA 1U7HA 3C14C 2VHXA 3T0FA 3PGJA 3MWFA 4OCZA 3RAFC 3PHJA 2P0AA 2VQSA 3WC4A 4AG3A 3LL7A 4RMGA 2LIVA 1NPDA 3ZCTA 1LZLA 2JFBA 1IIRA 1QQ7A 1PFYA 2IF0A 3AR7A 4M21A 4PWYA 3RJMA 2CBZA 4JP1A 4M1ZA 3RYFA 1PGNA 3VH3A 2JAQA 3QKRB 4ASUA 4URHA 5CFZA 2DWOA 2R7AA 3AHJA 1BGVA 2RH5A 4HR7A 1UZAA 4K46A 2B1QA 2JZOA 2F4VB 1V3UA 4B83A 3L7BA 4YI5A 4FHDA 1DEKA 2ALJA 5TVGA 1EWTA 1J20A 2CY0A 4Q4DA 1TQ6A 1RKBA 1TMOA 3RUHA 3RUDA 5FV4A 4TL6A 5DM2A 3WLOA 2R84A 4UEWA 5FQOA 3NHAA 2IELA 4ENVA 1TUGA 2D00A 2J48A 3E2IA 3IULA 5BQ3A 3E5HA 2G7MC 4ZAVA 1R9GA 4CL2A 5JMOA 3L1VA 2YWDA 1I1OA 3H9CA 1MC8A 3IOCA 3PGA1 3ROXA 1N9GA 1NYTA 1Z75A 3EAQA 4JJFA 3CR3C 5ES4B 4O08A 3QVJA 4CCWA 2AUTA 2OO5A 3UWDA 3PNQA 4BP3A 2M98A 3GDOA 2YXPX 4BUCA 1J0AA 3V5NA 4HDSA 5BVHB 4KFCA 1P81A 1JEQB 2O8NA 4ESOA 1BEEA 2BTEA 4IF4A 5J2UA 3ICQB 2QOEA 2F64A 1T36B 3RYIA 4DLAA 3OFND 3A6PC 2XXAB 4ZIRA 1IULA 3W6NA 3O4VA 4IHJB 4IV5A 4C0SA 3GP5A 2PH3A 5AVVA 3UKOA 1KMQA 1M6NA 4XLTA 1XC7A 4BP8A 4P6VF 5L3SA 3EW9A 2IT1A 3D1LA 3RNLA 4MRPA 1IG0A 3CVWA 3FY4A 4LA4A 5BW5A 3I9NA 4QXOA 4RZXA 5AHXA 4C0XA 2YICA 1H0KA 1MNQA 3EMDA 2V7TA 4NMMA 3ZGOA 2W2OA 3QEBZ 4HKTA 3FJYA 1Z5ZA 2PFKA 1ORVA 4PX5A 4Q15A 1WNTA 3N75A 4YMLA 1XVVA 1CUUA 5A4JA 1I6KA 4ZREA 3COPA 2O6LA 2RHJA 3EYWA 4N9WA 5C1OA 3KEMA 4NICA 2C97A 5EJ8A 2O8DB 2J1LA 2C04A 3W1VA 1MBZA 3LQKA 2WF7A 1RJDA 2ZJ1A 4TLBA 2P9GA 2ZTLA 4NI5A 5B2ZA 3U17A 1EYZA 4V1CA 4DYDA 3WNDA 4CKWA 3HADA 4MHTA 1UBFA 1NSTA 2H8KA 2C2YA 2Y66A 3VU3A 4JYZA 1BFUA 4JX9A 4OKNA 1NJ6A 4QU8A 5H0IA 2P67A 1B74A 1YFKA 3BK2A 3F8WA 4H27A 4PZDA 2A57A 3U4IA 3T5MA 3AHFA 2FJUA 1ZOOA 4FZ5A 4E22A 5JFGA 5KPDA 4FHEA 3EUWA 5JAZA 3HBMA 2B6HA 2QTTA 2Q29A 4JAVC 1T26A 4S3MA 5ED0A 2IVFA 4JJIA 3HZRA 1RCUA 2CK3D 1QHHB 3KALA 4R1OA 4E30A 6CHYA 5K20A 5JSKA 1VJRA 1IZ0A 4LY0A 1G59A 3H2HA 1J42A 2PMKA 3P27A 4ZXPA 4BQRA 1YL7A 4FXPA 4D0SA 1USGA 3ORSA 4NK5A 2C5EA 3JR3A 4JWTA 1D4FA 3BFPA 4ZKDA 2VH5R 3A2NA 4OSPA 3PJEA 3KWMA 3W8EA 1P2BA 1VA4A 3D8SA 4IW3B 2A59A 2WJ3A 1GCIA 1JR3D 1YQQA 2NTYC 2H2IA 1YXMA 4LY9A 3GLQA 4P4UA 4R3WA 4UMVA 3HTXA 2YUIA 4BXOA 1NI4B 3HFJA 4ZO6A 4NU5A 3BA6A 1UK9A 4NK4A 3E5RA 4RIFA 4Z3KA 4MRNA 1WMFA 1ZW1A 4MVXA 3VOBA 4EPTA 1UZNA 1R4MA 3CM0A 1MC5A 2ZSUA 1U3FA 3BAFA 3JQQA 4N3GA 2VT7A 3G8YA 3GCWA 4OMDA 3ZLVA 3FYTA 2FX5A 1XRSB 2O52A 3P7MA 4WCFA 4FILA 1PJ4A 5TQ0A 3UB2A 4QZVA 4YLYA 4EW6A 2B8TA 3L0BA 3PSHA 1Z45A 4KQ2A 3AJ9A 3CO0S 4GC5A 5FI0B 1GPLA 1XZGA 3TLGB 4URYR 3BTVA 3PEWA 2Q3LA 2NM0A 2YYYA 3FMPB 4UJ5A 1QB7A 2HFKA 2P1ZA 2EJTA 2WAOA 2Z1DA 4O1HA 2ZAYA 4MQ5A 1QR6A 1W49A 2HHJA 2YJ3A 2B94A 4B8ZA 1OAOA 2ORWA 3KHSA 5CA1F 3T1YB 3BSFA 1T6NA 3Q8MA 4X94A 5HBRA 1UJ4A 1DCTA 4P3OA 3CUSA 1VI5A 3KSUA 4DABA 2OTCA 1HDCA 2B2NA 1T4CA 3O2SB 2RCNA 1EA7A 1Z6ZA 2QMEA 1TU0A 2LV8A 3FB4A 3KTFA 5CTJA 3FMVA 1JJAA 1FX0A 1E5LA 4GXNA 5DO9A 2PT9A 2OGSA 3FUCA 4TWRA 3DKIA 4IRXA 4YMWA 2GFIA 3ZV3A 3OZTA 3AP1A 4BDSA 5KAMA 4TTIA 2NACA 1GWNA 2WHEA 2NVWA 221PA 3OQPA 3EDCA 1GIAA 1UP7A 2YJ6A 4OKSA 3I6YA 2IEGA 1HBJA 2V58A 2PSDA 3VHLB 5EINA 2FFAA 4W63A 2X1HA 4IZOA 4M7RA 2D8MA 4FGKA 5I7SA 1W19A 3F5QA 1B2RA 2NMVA 4PAWA 2F17A 4JSYA 4BL5A 4PGHA 2B2XA 1ZA2A 4LVUA 2X0FA 1X8JA 5DCWA 5CP8A 4P5EA 2FUNB 5F77A 3PCRB 4A2CA 2HTEA 3VR4D 2GGSA 3EGXA 1X0VA 3VPCA 3LUCA 3GFOA 5JJ5A 1PTJC 2JCGA 4JSRA 3KL2A 4JXJA 2MSEB 4DR5B 1MAVA 1LRLA 2GEFA 4YCSA 3IV6A 2CNKA 1Y1RA 3DLTA 1GCGA 4R1TA 3THOA 3IMKA 4DB4A 2JFUA 1XN4A 2DJIA 1BXZA 1Z3IX 2NO1A 1ZX1A 2XGSA 5IH7A 4W7IA 1PCXA 4K2AA 3PNBA 3K8ZA 3OQIB 4HNRA 3OZRA 1LVHA 4PQGA 4NXMB 2CFCA 3WIDA 1SA0B 1QGUB 3JD2A 4LJYA 1FS5A 3IGFA 4KXFB 3P2JA 2ZRKA 4AZTA 3SJCA 1Z0KA 1OA0A 4KODA 4J6EA 1GO2A 3SN6A 2OV6A 3ZVKA 3X3HA 2DBRA 2I67A 5TARA 5TPZA 2P1DA 3Q41A 2G6TA 3FN4A 2VTBB 1QF7A 2GETA 4IRMA 5HWSA 5C52B 1SIOA 5KOHB 3LYHA 3THWB 2XQGA 1U7WA 1Q2XA 4IFBA 3PEFA 1DOAA 2V3CC 1VFNA 3CLVA 1Y9ZA 4YJGA 3C3YA 2I6GA 1B6GA 1NYLA 4ZO9A 1GR1A 5I9NA 5LD2B 1A5SB 4G5OA 4FE3A 4M1OA 1BWQA 2QM7A 2GBGA 2XKAA 3V32A 2DP4E 2YBDA 4YNBA 2RMKA 4DJFC 1CP2A 4FZVA 1B00A 3JYPA 3PLNA 4WJKB 4EGQA 2YMLA 4RAOA 4UBJA 4DV4B 3T3EA 1KR2A 5G53C 4C4PA 1ZESA 3NIFB 3T1NA 1ZVKA 4L0CA 3JZMA 2DPYA 1MRNA 3N2KA 5T4FA 4B3DA 4CQMD 1J8DA 1U4NA 3BORA 4FQ7A 1O96A 3F98A 4D4JA 3UUFA 2QQFA 1OIWA 1PJQA 3ASVA 4KGXA 2VJMB 3RBXA 1O0SA 2G1AA 1DAIA 2DT8A 3NFYA 4WN9B 1F3OA 3LX8A 3K0FB 4OM7A 3E7WA 1ISGA 2WYWA 3SCZA 3B6KA 1QTIA 4U1RA 5CVJA 3TJZA 4KUGA 4WESA 2CVHA 1UJ6A 4E2YA 1Z28A 3ZCPA 4LHVA 3HWSA 1S2GA 4UBOA 1VSQA 1Q14A 2PKEA 1KI4A 1LLQA 1ZSYA 3ZJVA 5G0UA 3PS9A 4DUZB 4Y1FA 2ZROA 2DX7A 1PDOA 3KJEA 4F2WA 1H5QA 4KQEA 3JQFC 4JXZA 3WGQA 1EE9A 1QZXA 3PDUA 3V00A 4OJKA 1G8GA 5DM60 3RCBA 2GESA 1ZGGA 5BWMA 2RHMA 2BCEA 4FDTA 4OAPA 2W6QA 3K2EA 1L7QA 2PPVA 2V3VA 1T6YA 4KVGA 5JMPA 1Z4IA 1Q0HA 2JI4A 2JAUA 2QORA 3BHNA 3QKRA 1KI6A 3UFXB 2EOAA 3A4YA 1Z12A 1E79D 3PWTA 4TXNA 4XJXA 1T2UA 4EM6A 4DYVA 5C81A 5KX5A 4ITRC 4Y2SA 2GD2A 3N2IA 3GHYA 2CW5A 2N0SA 4KDFA 4NBKA 3NATA 4Q1DA 5HRCA 1PV1A 4EA6A 4P36A 3E18A 3IQXA 4YRKA 4TRMA 2OEPA 2VYFA 1JA9A 4V24A 1OUMA 2X40A 3HUTA 2XMDA 2XCOA 2Y4OA 3OY2A 1ADYA 1H2EA 4JWKA 4MV9A 2VT2A 5M29A 2PE5A 4HXEB 3ZXUB 2H4HA 4K26A 4A73A 4B3CA 1M10A 2PUJA 2WKRA 2IIBA 2GAJA 3OO0A 4I9FA 5E7JA 5EIXA 4CQLA 4G63A 2GSDA 2GN8A 1ZMBA 1RVDA 3G2IA 4P98A 1L5FA 2EFJA 2OXIA 3AM4A 1DAPA 5KKAA 1WZCA 1OX6A 1KIFA 2AGVA 3NONA 2W90A 1WCYA 3M3DA 5EWLB 3T1QA 4HXGA 5FYQA 4P35A 1RHJA 4RV5A 1OHHD 2ZR8A 2IVZA 5DHFA 2ZULA 3ITDA 5TGTA 4F45A 5HHTA 1PVVA 3AERB 4ENWA 4NVRA 3G8BA 1XYGA 4H31A 1AXGA 1ZUHA 4KNWA 4D4LA 3CLSD 2QRMA 2OHHA 2C9MA 5G02A 2V7GA 1XAHA 3NT2A 1IWOA 2EWWA 2BELA 4UU8A 3G2OA 3R7AA 1CNFA 2AE2A 4YMGA 2D1YA 3OLCX 1GUAA 1XEXB 2JJ8A 2PMDA 1T5OA 1HSZA 3DO6A 3E35A 2JANA 4IKPA 2GJ4A 1GLNA 4JA0A 5U1PA 3H2ZA 3TFQA 4ZI7A 5F2NA 5LMNB 2WQZA 3HCDA 1CQPA 2H0AA 3AY6A 3QJ5A 5LQMA 4JZYA 3BL5A 4IFTA 2XB9A 3L7LA 4UDOA 5TQ2A 1ZOIA 2I3BA 3WLEA 3I09A 4CIVA 4LF8B 3EIUA 3ILYA 1JQAA 1A7JA 1CULC 1UOPA 3NC1C 2GZ2A 4RPLA 1FLNA 1I32A 1S1MA 2NUAA 5E0OA 3CLUC 1J23A 1NVGA 1VPDA 2OK7A 3O6VA 2BGGA 4P4GA 2QSUA 3MJRA 3BCSA 2VTDA 2GN1A 3GMSA 4H3SA 4NYMR 3KC2A 9LDTA 1X74A 3A7EA 1SPXA 4NNJA 3ZU4A 1ZGCA 4IIJF 1EVQA 1JHMA 1L7NA 2ZIEA 1B1AA 3C43A 4LISA 4LWOA 5FPHA 4WFJA 2R6FA 3ROZA 2GBCA 3A9TA 4JKIA 1WIWA 2DUNA 2PWAA 1BG6A 1UKEA 3L49A 1X8LA 4C29A 1E0KA 2NP7A 2GBPA 2HYIC 3AU8A 4LOJA 1IY8A 1E9CA 1L3IA 3VPXA 2XZOA 4W8HA 1UINA 1CIPA 2BPOA 3I3OA 1VG1A 3NV9A 4OMCA 4PLVA 1J2UA 3ACDA 1NVBA 3LPNA 2QRLA 1QB8A 3DNMA 4L5AA 3L0SA 2XOKA 3SLRA 1NZFA 1CBUA 1VBMA 2GOYA 2VQDA 2YJZA 1VYHA 3JVUA 4JBIA 5MFZA 4TMWA 4MWZA 1ZICA 1UJ2A 1OBVA 1PG5A 3THYA 2BUAA 3HU2A 3I64A 3TL6A 1DQPA 2G0NA 2W6OA 1XDSA 1XTPA 1YASA 4HLUC 1OX4B 1QP8A 4AG6A 3ZR4B 3P94A 1ISIA 2NPOA 4P7GA 3ZGLA 4EUFA 2YCBA 4UZEA 3WHLA 4EYSA 5HX7A 3KT6A 2VEDA 4JP2A 5CM2Z 2YBEA 1IAVA 1ZCBA 2GO7A 2K87A 4QSMA 5DU2A 3LX6A 4HQ6A 3BIJA 4GOKA 5HKAA 2VQFB 5JAIA 2P35A 1KETA 1O0CA 3S2YA 1QP0A 3CUEF 4WBNF 1TD1A 4CCYB 2H2AA 5EE0A 5JALA 5ALWA 4XIGS 4M0CA 3E22A 1J22A 2BZSA 4BWGA 5FOQA 3CF4G 1LTKA 4H0FA 1L5OA 4V0MA 3DKRA 5AI5A 4EA7A 2HEIA 3WGIA 1R8JA 3PPIA 1J49A 2PM8A 1ZNYA 4RJTA 3O26A 2WZCA 3ZK9A 3ZY6A 1R6UA 1FSSA 2IS6A 1HT3A 2XW6A 2LCIA 4RQTA 3A05A 2ZXEA 4L51A 2H4YA 1X1DA 4YLGA 4MCJA 2VSOA 1Z25A 3EJWA 2EDCA 1ECBA 1PFUA 2HAEA 4GZLA 3ECSA 1MCZA 2C2WA 2CLEB 3I12A 6PFKA 3AR6A 5CYPA 2H51A 2B37A 3I6QA 3DEYX 4TVBA 2XOKD 1J7JA 3CX3A 1JWBB 4TN5A 5JJIA 2ADOA 3ZCQA 3COVA 3L0CA 5G0TA 2GZSA 5GQSA 3VR4H 2XXJA 1XCJA 3S55A 4LE0A 5COAA 3AOEC 3UG7A 2ZWPA 2YMMA 4P22A 4S35A 4RBNA 5FAKA 1EINA 3C3JA 4GL4A 3D7MA 3FNFA 3X1YA 1ODCA 2CE2X 4OEHA 5JWOA 3P9KA 4NATA 4G4SP 4FD2A 1ZCFA 2JI9A 3DMYA 5EJIA 1FP1D 3JY6A 4I14A 1UPAA 1LPBB 1RSZA 4M37A 1PR0A 2VOEA 2P91A 4P7KA 1DBIA 3DBHA 4RSRA 2VRCA 4J0HA 3AVYA 4R4JA 3RIGA 4P08A 4D99A 4ICIA 4DA6A 1TB4A 3VBCA 1EK2A 5TT1A 2BF4A 1E9EA 1DC3A 3CNQS 3WV4A 1N2SA 1A3CA 1SBTA 3E0QA 4O3FA 1MB3A 2I4MA 2I5PO 3Q6MA 4ZGBA 1IVNA 1VFPA 2CL5A 4FM9A 3B20A 4BNNA 5AW7A 4LHWA 5TS3A 3VH2A 3ZZNA 2AYZA 1X94A 1GZDA 4KXQA 2G25A 2LCQA 3G17A 3RSSA 4YDSA 1Z6YA 1YDMA 3OVMA 3MT0A 1XZLA 2VZEA 4C7OB 2GEKA 1VJGA 1RXSA 3WL6A 4OB8A 4LF4B 3IAHA 4NEQA 2ZTSA 1ZUWA 4AO7A 2Z2ZA 1L5KA 4UVDA 4K8OA 1EB8A 2EFGA 2ERCA 4JXKA 3BMQB 4M7PA 1GJRA 4NU0A 4GSYA 3FNQA 4V3BA 1FNNA 2WP8J 2I6FA 2NXJA 2BEUB 3MPOA 4UPDA 3RVDA 1UDWA 2EF1A 5ISMA 3HC7A 3L7OA 5E0KB 5A4MS 2XAUA 3EZXA 4PTZA 2R47A 1FTSA 2YW9A 2V7VA 4BX8A 1IMJA 4GL2A 2XB2A 1KAEA 3MERA 5J23A 3AERA 4O02B 4Y3UA 3CUVA 5I7AA 3V42A 1YRHA 3CJQA 4GX1A 4U2KA 4CTJA 1U63A 1J4AA 3B9RA 3JQEA 4GI5A 3DXFA 4GKBA 1ADBA 1Q0LA 2F3QA 4B73A 1XRJA 1TM3E 1H6AA 2X8WA 1XP8A 2CFRA 2VRCD 3TIXB 1A77A 2QMHA 2XXAA 1U1EA 1KOJA 1P5RA 4EFNA 1U3DA 1YOBA 2V5AA 5A4IS 2ZXUA 1LFDB 1GGVA 3CLTD 5ALPA 1DRJA 2HU7A 2I7DA 1QP7A 2C7GA 8ABPA 1P19A 3QTTA 2MYTA 3TGLA 3AEYA 2ICAA 4DCNA 5D2CA 3A27A 4E2FA 3L07A 4WPGA 1APBA 1F2VA 4BECA 2VHJA 1T3TA 1XROA 4PHTA 3V9AA 2OSBA 5I8PA 2QW1A 2NZYA 4TXLA 3R9IA 5K7SA 1CY4A 1PL0A 4PYQA 2Q1WA 3W04A 3DT9A 1JSLA 1F5SA 1U9YA 5JI2E 2P2CA 5CVVA 2QR5A 3DQQA 2VFAA 3HL0A 4R40A 5ILQA 3BTUA 2JD0A 2WWXA 1RW4A 3U6KA 1JFSA 1X70A 3LIIA 3VI4B 1Q7TA 1I3OA 2X8AA 3FDJA 2CJYA 3PX3A 4CPDA 2CF5A 3FMGA 1Z4LA 4OQZA 4EA9A 3R5XA 1T4CB 3K6JA 3W3ZB 1GG5A 3G0HA 4MP6A 1AJEA 1XVAA 3C5VA 2FEWB 4KACA 2IOYA 3EQ2A 3VDNB 1F8GA 4E94A 2JHCA 4P4NA 1PEKE 1PZMA 3M4XA 1OWLA 3EGVA 2HPAA 2ZPTX 3OF5A 3LUJA 1YJ5A 2PHZA 5EWJB 4DRZA 1LY1A 2K4MA 2ORIA 1JHAA 1F4LA 1ZWLA 3NETA 4OLFA 4PYRA 4X1IB 4ZVPA 2R62A 5JNLA 1VRWA 4HWGA 1OXSC 4LYAA 4E5PA 3T5CA 4DXAA 2AVDA 2OQRA 3IB3A 4C4YA 5C32A 4GH5A 2JFNA 1QFZA 1QH0A 4QXPA 2QTNA 4RE5A 1Z63A 4F7WA 4BNLA 4G36A 1O6BA 5CLJA 4YRMA 4GOXA 4EATA 3F6SA 5B58C 4HGZA 5BV7A 2A7QA 2XZDA 3LUDA 1XMQB 4F8YA 2CNWA 1TE2A 2C9BA 5ALXA 3H2BA 1JXMA 4PG8A 5I9LA 3Q3GE 1GDHA 5C3UA 2B5VA 4B2LA 1RT9A 1TVKB 1W35A 1OBOA 4LTNA 1B0PA 5IAAA 3WWZA 2AC2A 4FNMA 1HDRA 3H3XA 1IK4A 3ICVA 4A1FA 2FZVA 3BT7A 5BUCA 1UWKA 3TE6A 5HQTA 2O0HA