1D2MA

Uvrb protein of thermus thermophilus hb8; a nucleotide excision repair enzyme
Total Genus 190
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
190
sequence length
582
structure length
552
Chain Sequence
TFRYRGPSPKGDQPKAIAGLVEALRDGERFVTLLGATGTGKTVTMAKVIEALGRPALVLAPNKILAAQLAAEFRELFPENAVEYFISYYDYYQPEAYVPGKDLYIEKDASINPEIERLRHSTTRSLLTRRDVIVVASVSAIYGLGDPREYRARNLVVREVLLERLLELGYQRNDIDLSPGRFRAKGEVLEIFPAYETEPIRVELGFVLFPATHYLSPEGLEEILKEIEKELWERVRYFEERGEVLYAQRLKERTLYDLEMLRVMGTCPGVENYARYFTGKAPGEPPYTLLDYFPEDFLVFLDESHVTVPQLQGMYRGDYARKKTLVDYGFRLPSALDNRPLRFEEFLERVSQVVFVSATPGPFELAHSGRVVEQIIRPTGLLDPLVRVKPTENQILDLMEGIRERAARGERTLVTVLTVRMAEELTSFLVEHGIRARYLHHELDAFKRQALIRDLRLGHYDCLVGINLLREGLDIPEVSLVAILDADKEGFLRSERSLIQTIGRAARNARGEVWLYADRVSEAMQRAIEETNRRRALQEAYNLEHGITPETV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords EXCINUCLEASE ABC SUBUNIT B
publication title Crystal structure of Thermus thermophilus HB8 UvrB protein, a key enzyme of nucleotide excision repair.
pubmed rcsb
source organism Thermus thermophilus
molecule tags Hydrolase
total genus 190
structure length 552
sequence length 582
ec nomenclature
pdb deposition date 1999-09-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00271 Helicase_C Helicase conserved C-terminal domain
A PF02151 UVR UvrB/uvrC motif
A PF04851 ResIII Type III restriction enzyme, res subunit
A PF12344 UvrB Ultra-violet resistance protein B
A PF17757 UvrB_inter UvrB interaction domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.920.40 Alpha Beta 2-Layer Sandwich Metal Transport, Frataxin; Chain A Metal Transport, Frataxin; Chain A 1d2mA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d2mA04
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1d2mA01
4RD3A 5DSZA 2OSBA 3TVDA 3EAQA 4E03A 1S1MA 4CVNA 2J0QA 1XPUA 1SKYE 1II0A 3IDQA 1T8TA 2YNMA 2DY1A 4BLSA 2ZU6A 3KZ1E 1DAKA 4TYQA 2PEYA 2VPPA 1M2OB 4PQYA 2H57A 3PEYA 1KMHA 2CL0X 4RFSB 3U6BA 3GFOA 5F3WB 1RC8A 4MKFA 1OIXA 1E32A 1QVAA 3G0HA 2JDID 3BH0A 2QGNA 3AVTA 3DPUA 1MH1A 2ZSFA 1CLUA 1T4GA 1Z08A 4P4TA 1OPXA 3K0FB 4MGKR 1SHZA 3GP8A 1NVVR 5EE0A 2SHKA 2PMKA 1GILA 2O8EB 5AJVB 5KSZA 2C03A 3ZZTA 4W5HA 1LF0A 2GRJA 2ZE7A 1N6KA 1G291 3BB1A 1Z6TA 2QTHA 2RGXA 5SZHB 4ZDWA 1GM5A 4FIDA 4G0NA 4JLDA 3X2SA 3GLGA 5DE3A 2WICA 3A1TA 2ZRDA 1VYVA 4QC2A 2IF2A 5EUQB 1NY5A 1OIVA 4Q03A 2ZI7A 1YJ5A 2P67A 4LRWA 3CH5A 3QKTA 1FZQA 4K46A 1UADA 1G64A 3PEUA 2ORVA 1ODFA 4Q7KA 2HF9A 1COWA 2ZETA 3BC1A 5JBQA 4UJ3A 2GTPA 1GSIA 4KBFA 4YXWD 3AVUA 1XCMA 3FDIA 1P9RA 1E2LA 4HI0E 4DJTA 3Q5DA 5FTKA 3V00A 4XD7D 1FTSA 1GL7A 1U81A 1M8PA 1R0ZA 3EZFA 5SZKB 1XTIA 2HT1A 2IYUA 4DDVA 3VMFA 3GLHA 4OI1A 3I4LA 2VP6A 2GESA 3EC1A 2XZPA 4RD2A 2JAQA 5FPYA 2CNWA 3LXXA 1I2MA 2IXEA 4BZQA 5AUPB 4DDUA 3K09A 2CDNA 4CEHB 1CS4C 4PSAA 3B1YA 2GA8A 3NDPA 4KITB 3GLHB 1O3YA 2MSCB 3CZPA 5F2EA 3HYTA 1Q1EA 2VQSA 2ZE5A 4JL5A 1E2EA 2R65A 1NRJB 1HY3A 2P5TB 4UXIA 1KI7A 4B3CA 5FOTA 3QNUA 1TQ2A 4M22A 3VR3A 4LHXA 1GOTA 5FPTA 4G5GA 3C41J 1C4OA 2AXPA 3K70D 3LW8A 2BM1A 4Q4HB 1IY0A 1XTQA 4IFEA 1Y63A 3AVYA 1XCGB 3BERA 3OFND 4QBFA 4P4SB 3AP2A 2X1VA 3KQUA 3Q85A 1ZU4A 3ZQ6A 4BASA 5BXQC 1YZGA 4UQOA 4GRAA 2EFHB 4WBSA 2NOAA 3R7WA 1JXOA 5EZ6B 2AHOA 3UXMA 4QFMA 4RSGA 3U44B 2CL6X 3CRQA 3ZD7A 2IWHA 1E2HA 4GDFA 4NU0A 4FMDB 1H8EA 5LB4A 4A6XA 1IXRC 1G7CA 2RGBA 4EPYA 2DFTA 1D8TA 1UKYA 5A0FA 1D2EA 4BLRA 2B8TA 1A82A 4GFDA 4DEXA 3BBPA 5JMTA 5L3QB 2C78A 2ECKA 4TSFA 2ZVQX 2XSZA 1ZINA 1UJ2A 2E1RA 2NIPA 1EG7A 4TYPA 2ZSEA 3RS2A 4KODA 3CNOA 3RS0A 1I2DA 3TJZA 2PT7A 1MABA 1G8FA 5FBQB 1DO2A 1G5RA 4D26A 3NH9A 2GHIA 1D6JA 1ZJ6A 2CLDX 3UKDA 4W9MC 3GLIE 4YMUA 2LKCA 2HJGA 1NLZA 2IEYA 3D6TB 3RRNA 1MRNA 1ZM2A 3GFTA 3KDSE 4Q4LA 2QUZA 1T5LA 2OESA 4QNMA 2LWIA 4NDZA 4D4KA 3RC3A 3RANA 4GOJA 3A1VA 5FUXA 721PA 1XMJA 4JLNA 2VO1A 4DXAA 2QPOA 1KK3A 2JDIA 3I3SR 1XRJA 3JVUA 5AJZA 2G6BA 3I92A 2BDTA 2K5UA 2Q9BA 3TLXA 4O2LA 3LNCA 1Z6XA 2YC4C 1XEWX 1E2KA 1OLOA 4E09A 2WOOA 1XTSA 1ZUIA 2VTKA 2RHDA 2GJ8A 1WCV1 4ITRC 1TX4B 5AJXA 4AI6A 1P72A 1Z6AA 2EFDB 5LBIA 2VHTA 5B30A 3WMGA 5JCZA 5FI1B 1QHIA 2PLRA 2WJHA 3SC3A 4DLRA 3K0AA 4US1R 1NMYA 1ZIPA 3RLFA 4M1WA 3KKOA 3UMFA 4D2IA 4XH9B 2XGJA 3OAAA 4IKEA 2PX3A 3SFZA 1M34E 4Y0VA 4O25A 4KSCA 1XXHE 3CX8A 3Q5EA 2ZRGA 2QEQA 4O0MA 4J0QA 4Q7LA 5DGXA 1FNNA 1T91A 1AQUA 5HE8A 1OH7A 3EZ9A 4M4SA 5IT5A 2A2ZA 5EP3A 1W48A 4OQNA 4Q9HA 4OJKA 4GP7A 3T12A 1DAIA 2GJ9A 5J4YA 821PA 2IHBA 3AH8A 2JIZD 3FMOB 3MG9A 4MYCA 1J8YF 1COWD 1R2QA 1N6PA 4PQFA 3RVBA 3P4YA 4ASUA 4YXWA 4FINA 1A2KC 2FG5A 3CRW1 1E6CA 5EXPA 3W6NA 3CF6R 3QENA 1YQTA 4MITA 5FTNA 1E1QA 3HP1A 3BFXA 5E4FA 3IGFA 3SJZA 3BFKA 4I1UA 1W0KD 1KSHA 2NO0A 3VQTA 4EFNA 3ZVRA 1S1CA 3GCGA 2ATXA 3BS4A 5FOSA 2I4IA 3S1AB 1U98A 4R2IA 1GNPA 2QM7A 2IYXA 4NL4H 1Z07A 2RGEA 2W00A 3MFYA 1U8AA 1W5SA 4TL9A 3TUIC 3KXLA 1LB1B 3FHOA 2GCNA 4D0LB 3RRYA 4TYWA 5J4LA 1DOAA 4QBIA 2W58A 3NBXX 2YHSA 3X1XA 4IJMA 2ZJBA 4NYMR 5K8LA 1R6BX 4B33A 1WBBA 2P0EA 1NBMA 1T6NA 2Q0HA 5TDHA 2FJUA 3L0SA 1RYHA 4LY6A 4YMVA 4QJ5A 4TLCA 2JJ1D 1M7HA 3F5FA 2GVZC 4LWZA 4RD1A 2O8CA 4MYUA 2FN4A 3GLHE 2DR3A 1UBCA 4RY2A 3D31A 1U0HC 2ZIAA 3UWKA 3OEED 3V4RA 1NN5A 4OQXA 2QT1A 4EQ6A 1T5IA 2FEOA 2W6JD 2XTNA 4UNRA 3WBJA 4PR0A 1QHHB 2MSEB 2VYFA 1KJWA 5JS7A 2CCKA 3ND9A 4A6PA 2OBLA 2CL7X 3A4NA 3QQ5A 4JLOA 4Q4JB 2UKDA 4HDOB 1JAHA 2B92A 4G5SA 3KXKA 4US2R 3I61A 1XBTA 3CBQA 4II7A 1OXXK 3LXRA 3OIWA 3QF4B 3ICQB 1FOEB 1ZYUA 1Z2AA 1F3OA 3CWQA 4QGGA 4QBHA 4WAUA 5JLJA 3SJAA 3SYNA 2Z4RA 4Q4HA 1Z47A 2WKPA 4FXPA 4BLPA 4C0HA 3EA5A 1JNYA 1AA9A 4EPXA 4DRZA 4ON9A 5CITA 2OILA 1KKMA 4D82A 1VIYA 3JZMA 4G5OA 3UG7A 4BQSA 3W6PA 1E9AA 3U7FB 1NSFA 4B6EA 4OHXA 2GJAA 1RJ9B 3SI7A 2ZRCA 2J87A 3B1XA 4OYHA 4TLBA 3K1JA 5BQ5A 3U3JA 4D0GA 2FFAA 5CDFA 1OFHA 3UANA 2O8EA 2XTMA 1ZU5A 1R0XA 2ZJYA 4DC9A 2KSQA 5JI2E 1UDXA 5KUTA 1KY2A 2JLWA 3RYTC 3I32A 3GJ8A 2JJ2A 1FNMA 4CEJB 4A8JC 2VHUA 4PO8A 3Q7PA 1FTNA 4Q1AA 1VTKA 3IQWA 4AWXA 2YKGA 1OJLA 3IKJA 3G82C 1D2MA 3LA6A 1R4AA 1VCIA 2IT1A 4A92A 5C2JB 3TBKA 2V7QD 2Z83A 4IOJA 4OHWA 2JLUA 2JLXA 3CPJB 3CRRA 1WF3A 5G41A 5DISB 3U7HB 4NTZA 2BBWA 4Y0AA 5BN5A 3U2QA 1CR4A 1RW4A 4M2LA 4RZ3A 4CDGA 2FFBA 4A0RA 1R5BA 2FZLA 2WVJA 1R5NA 4ZI3A 1CXZA 4URVR 4RCYA 2XB4A 4BZXA 2B6HA 2KWIA 1YE8A 4NE2A 4P3YA 3C14C 3IBYA 3MMPA 2VEDA 1QZXA 3P1JA 5LPNA 1I4LD 3K53A 3N70A 4JMPA 2CBZA 1ZNZA 1JECA 3KJHA 4PXAA 1HTWA 1BMFA 4DCTA 4N0DA 1E9DA 3B9QA 3AB3A 1GTVA 4NCIA 3P20A 3QEOA 3MSXA 1VCNA 2OZEA 3KUDA 1J90A 1X3SA 3EW9A 2QMEA 5CM8B 2OUKA 4R98A 3I73A 4I1SA 1WE2A 4BFYA 1E94E 1HA3A 5BW8A 3AVVA 2JIZA 5LDDC 2EWVA 1XXHB 4NCJA 4XIGS 4IXNA 4BRUA 2R2AA 3VR5A 4IDPA 1JB1A 3IO3A 2REXB 3BD9A 4XJXA 5D3MA 5HCNA 5CJ2A 2GJSA 1DEKA 1D5CA 3MAAC 1BIFA 1KAGA 2GF0A 1E1QD 4FCWA 4C7OB 2YYZA 4M8NE 1Q0UA 621PA 1UKVY 2A5GA 2OLJA 3VKHA 2R44A 3IIJA 2RKOA 2W6IA 2QMOA 5K8IA 3Q9LA 1LNZA 4DT1A 2V4ZA 1DG1G 2PJRA 3FKSD 1IN6A 1KI1A 1G8PA 1X1RA 4GI7A 2R6DA 3T15A 4OHYA 3DEFA 3ASYA 4IDHA 2JJ8A 3H2YA 3MLEA 4PO1A 3VKGA 4CIDA 2KJQA 2WTUA 3QVUA 3MWJA 5KNDA 2EWWA 3BB4A 3O8CA 4FCVA 4OQMA 4ACBA 4G5RA 2GKSA 1BYIA 1SZPA 1CEEA 2FSGA 4QHSA 2CXXA 2D7CA 4I99A 4LC0A 2XJ9A 2ZR9A 1V5WA 1KNXA 3OHMA 5CM9C 1G16A 4MUBA 2WWGA 1O87A 4Q9KA 4Q9JA 2YOFA 1LY1A 2ZUCA 5FR2A 4AD8A 4M9ZA 4KXFB 1Z6YA 3PQCA 4IOLA 2JLZA 2RGAA 1DS6A 2OHFA 2ZI9A 3AVPA 3UMRA 3ASZA 2YWEA 3K0SA 1OXUA 3FMFA 3LBNA 3OAAD 2AD5A 1CKEA 3CKLA 2CE2X 3B1WA 4C4PA 3QPWA 5EE3A 3BORA 4MQBA 1W47A 2R9VA 1QHYA 3CIOA 4GZLA 2IS4A 2CHVA 4MKHA 2QY9A 5FOWA 2ZRNA 4LHYA 2ZRIA 3QBVA 3LWNA 3FMPB 2OE2A 1G41A 3QOFA 4TTRA 3RNLA 2YJTD 5DHAA 2WWWA 1F2UA 3GMTA 2H1LA 4JBYA 2ZS8A 4KYIB 4EJSB 3NTUA 3FFBA 4Q4AA 4BZPA 4IXMA 2V3CC 1NVVQ 4BLTA 5AWFC 4TYYA 2C9YA 1N6HA 1JJ7A 1E9RA 1QG4A 2BKUA 1XTKA 3SJCA 2FEMA 3QXJA 5KTYA 4TMKA 2AD1A 5CYOA 3LH5A 2C04A 2EQBA 1W0KA 1GRNA 5BN3A 4AKGA 2JJ2D 1Z29A 2EFCB 2I1VB 2Q6TA 4QHTA 4ABYA 1M7GA 2IUTA 2QA5A 4IW3B 5FPKA 1UBEA 5KO2A 4MKIA 4EDHA 2GEVA 4Q66C 2F9LA 5KOYA 4CEJA 1BOFA 1JEEA 1HEIA 2A78A 1L7VC 3KKQA 3JZAA 4POAA 3O47A 5JI3E 2Q9AA 4HLDA 4I1VA 1P9WA 1DG3A 5KDOA 4WZAE 4MRRA 1GNQA 3AF1A 4BFSA 1BO6A 4PC1A 4FI3C 2N46A 2VH5R 3FGNA 3OE7D 4PAMA 3AKCA 3E1SA 1E0SA 4NYMQ 5H70A 2Z5FA 5EXXA 3ZIAA 1DARA 2HDNB 5G3ZA 2JJ1A 4XTCS 4GL2A 5GJBA 3GJ3A 4MGYR 1EX6A 3N5CA 2IBMA 4IVQA 5L3RA 1QHGA 1II9A 1CJMA 1ESMA 1G5PA 2QROA 4OK6A 4UNQA 4IRUB 1YR7A 3TVTA 2QSZA 2P6UA 2ZR7A 5H68A 4O3MA 4JL8A 1PVOA 2E87A 2QP9X 4KJZA 421PA 1W4CA 4FWIB 3H1TA 4D0NA 5DN6A 4B3FX 1BMFD 1OT3A 1RRCA 3CNNA 1NP6A 2PZGA 2ZRBA 1G7SA 1KI3A 1PUIA 2B8WA 4M1TA 4AURA 1XPOA 3B85A 1KI2A 2BBTA 1QHHA 2QSYA 3THOA 1WB9A 1W1WA 2JLQA 5E3HA 4A36A 1MOZA 4HB4A 2ASEA 3QY0A 1GL6A 4HUQB 3ADCA 2PCLA 5FPSA 4LPKA 1QHNA 2ZREA 2ZVPX 1YHNA 3AUYA 4QOSA 2HYDA 1XJQA 2AKYA 2IK8A 2V6IA 4HSEA 2RGNC 4LYJA 4BWYA 3QIAA 4JKIA 1YU9A 2X19A 4UNNA 1HH4A 3K0AB 3LO5A 4D4JA 2ZUBA 3LRPA 1IOZA 4M1KA 4Q19A 5LD2C 3K0FA 2H8KA 2CVFA 3IPYA 3RHFA 4H1VA 4JIMA 1G3RA 3BJIC 4V0KA 3U61B 4EPWA 2IX3A 4AYXA 3FYHA 5E7JA 1PZNA 1G6HA 1LF5A 4KBGA 4B2PA 4CYMA 1D9XA 1Z0FA 3ADDA 2KI5A 1RIFA 2DCUA 3BH6A 3ZVNA 4ARZB 5EP4A 1YRAA 1ZVQA 3A36A 3R20A 4G01B 2XEXA 3QBTA 4DLUA 1JQLB 3OESA 4NPHA 4LJ7A 1XZQA 1CF4A 1P4SA 3X1YA 1XEXA 3B5JA 2ANCA 3IIMA 1Q1BA 5EQTA 2XZLA 1KOFA 2O8DB 1BS1A 2QMUA 5JWOA 1T3LA 4V02A 1CU1A 3MCAA 1G18A 2CJWA 4HAYA 4A8JA 2A3RA 4KFRA 3THXB 2WV9A 1GVNB 4FMCB 1Z0DA 2H16A 2WJJA 4DSTA 3QUSA 4NBSA 5KSOA 3GLFA 3L43A 5CK4A 3FVQA 2Q3MA 1CIPA 1P2SA 2GF9A 2GZHA 2Q21A 1Z06A 2ZI5A 3QI2A 2W0SA 4HATA 5BWMA 1E2DA 1J2JA 5FUYA 2XNDA 5FH9A 1Q57A 1IN7A 2PZEA 4KAXA 3ZD6A 3CR7A 3WYAA 2VLIA 3SZRA 2OM2A 4GSYA 3ZZUA 4C3ZA 2BC9A 1RFLA 2W2TA 2ZRFA 1E69A 1P3JA 5FOXA 1N0WA 2ERXA 4NYIR 4DEYA 4XOIA 5AK0A 2WIAA 3WYGA 3TNFA 1Q1ZA 3CR8A 1G4AE 5M04A 1OYYA 1YZTA 2DYKA 4BFTA 4LDJA 2A5DA 4Q1FA 2OBMA 5TVKA 1OYWA 1S0UA 4Q7MB 1GP2A 2BCGY 2O8CB 2H92A 1JBKA 2ZXUA 4E22A 3ZVMA 2A5JA 3EIHA 2F1IA 4MYTA 1UFQA 4DVGA 4TQAA 3SQWA 2WKRA 3CNLA 1ETUA 3WNCA 3SYKA 2N42A 4XSHA 1Z0AA 3Q8XB 1E99A 5DYIA 2VF7A 1L4UA 2GEDA 1NG1A 2IS1A 1N6NA 2AN9A 3NG1A 4HAUA 2OCPA 3PFIA 3J81k 1CRQA 1W4RA 2ZYVX 3AVWA 3OIYA 5C18A 2YWHA 3BK7A 2BMJA 4YQFA 3ZYCA 4IHQA 2CLSA 1P2TA 3HPRA 5JJIA 5CYPA 5JFGA 3BFVA 4OQFA 3SOPA 3EX7C 1E0AA 4PZLA 1SVMA 3ZGXA 1VCOA 3P4XA 2MMGA 4QGAA 4DWJA 1TQ6A 3TIFA 4CW7A 2VP4A 1QHSA 3KFXA 1GAJA 1VECA 2WM9B 4B73A 1ZRHA 2F1RA 2QPAA 3NH6A 4FW9A 3N2IA 3IHLA 3KQNA 2FFQA 3V9PA 4Q00A 4NMMA 1UDWA 1N6IA 1ZNYA 4KO8A 4QGFA 4Q47A 1KZ7B 5L3QA 5CJPA 5KU1A 1DAMA 1U94A 2VSOA 1Q22A 5L3VA 3WYFA 1Z0IA 2I3BA 3QG5A 1N2CE 1JR3D 4A1FA 1QG2A 1GKIA 2IYRA 2KBEA 4M9SA 5DN6D 2C77A 3CWZA 1SVOA 3K0CC 4KCGA 5HR5A 2HCBA 2X2EA 1UPTA 4LYFA 4LSGA 3GEIA 5J4KA 3B9PA 3P32A 1NBME 3L8ZA 1YVDA 5GJVC 1GUAA 2IL1A 4LV8B 4LYAA 1GRRA 4Q7JB 5A4JA 3BB3A 4Q9LA 1JQJC 4O2RA 3MRSA 2RB4A 1W2HA 4LK2A 4QBGB 2QAGC 2ANBA 2QPTA 3SDZA 5EXSA 1KDPA 1K6MA 5C4GB 2QRZA 1TAGA 2HCJB 4HLQB 3EZ6A 4QL3A 2G77B 5LB2A 4AYWA 4BLOA 1VG0B 2JLVA 1B23P 1ZM3A 4JT2A 4TL8A 1G9XA 1YZQA 4HLUC 3NKVA 1ZAKA 4Q9IA 2PMDA 1Q20A 2WWIA 4N3NA 4RFSA 3U3OA 4QKQA 4KLZA 2QN6A 4JLBA 1G3UA 1ZCAA 1IN8A 2AX4A 1QRAA 5GJCA 1AQYA 1FQJA 2AK3A 3DKVA 3SN6A 2Z43A 2ZI3A 2QRNA 1NF3A 3DM5A 4EQ6B 1XNJA 3FKQA 5FOUA 2BJWA 5B2ZA 4WZ6A 1KHTA 3REFA 3PXGA 4WVFA 3ZZ0A 4RD6A 3TH5A 4DUGA 2HXSA 2CLCX 1F5NA 1CP2A 3BIFA 1HT2E 3EZ2A 1Z0KA 4PSKA 4U00A 4ESVA 3RWOA 2NO1A 3U6KA 2YZ2A 3AQ4A 2QP3A 3K9LA 2PBRA 2C99A 1FQKA 1ONBA 5B64A 3DVLA 4PX9A 4ZV4A 1NN0A 1MV5A 2HJVA 4EJSA 3U7EB 3JVVA 4ESHA 1BH2A 4Q4AB 3WHLA 1SQ5A 2C98A 4KSBA 3MUFA 3WMFA 2REBA 2H5EA 1S9HA 1VHLA 4HZUB 4RKEA 4F93B 2PT5A 2ZM5A 4M1OA 2XNDD 1IAQA 2F43A 4ZIRA 2GXAA 5J4VA 2EFEB 3F8TA 2IYZA 4U7DA 4IDOA 4AKEA 1OKKA 4JKYA 3T06B 4DHEA 1R0WA 2Q9CA 2AR7A 3DZ8A 3GJ7A 3LFUA 3U3KA 1EFRA 4A4DA 4A2QA 2OO7A 3ECCA 3WRYC 121PA 3FHTA 2G1JA 4MRVA 4M9XA 2WKQA 4L9WA 5LD2B 2OXRA 2VSXA 3CUEF 1NLFA 4JBXA 4FN5A 4TSFD 4UNSA 4US0R 5D3QA 4C0KA 3CRVA 5J4HA 2R6GA 3SEAA 2YWGA 4V0NA 2IHYA 4CEHA 1ZUHA 3C15C 2ZAOA 1XP8A 2ZPTX 3AKYA 4PZYA 1SXJE 2FH5B 2WOJA 3K9GA 3D8BA 3PITA 4OI2A 3T61A 4A0GA 1W36B 4BECA 3EPHA 4HUTA 3A8TA 3QVVA 1IHUA 4MRNA 1XD9A 4NP6A 5KNCA 3RS4A 5SZIA 4DDWA 4PC6A 5G40A 2QI9C 1W49A 1RE0A 4XSGA 3WP1B 1U99A 5GADl 4X8OA 2WPDA 4IDQA 4DLZA 3LAWA 3AVOA 4JVNA 1KSGA 4D81A 1E4VA 3GEHA 2GZDA 5IK2D 4HZIA 2CNWD 4WOPA 1B0UA 2WSSA 2FF7A 4Q21A 3GJ5A 1GIAA 4QJ4A 1VMAA 2ORWA 3CO5A 1N25A 1T3SA 3DL0A 2GEUA 2IYTA 1TQDA 4PSVA 2N1BA 1UBGA 4QG7A 1MRSA 1ZMXA 2ONJA 3WXMA 4NHOA 5KDDA 4EPTA 1W7AA 6Q21A 3VHLB 4R2HA 2GK7A 2W2VA 4BFUA 2CHQA 1Z83A 4URWR 2BBOA 4GNKA 1GZSA 3L82B 4IFBA 2AWNA 3GLGB 1JR3A 4JT4A 4FCTA 1XMIA 2O8FB 4AYTA 2Q3FA 3NBZC 2CMKA 4CT5A 3EWSA 4OI0A 2O52A 4A8JB 5IHPA 4NH0A 4JLAA 4URUR 3VAAA 5IF9A 3DM9B 3EWAA 2FV8A 1YZLA 2ZJZA 3UK6A 1VYTA 1MABB 1XEWY 4D80A 4ZDJA 4PTLA 2AXNA 3C7KA 1KGDA 1E0KA 5CIWA 1OIWA 4BUJA 4OI4A 4GOKA 1N6RA 4B48A 1N3BA 3NBYC 2RHMA 2WMNB 1R7RA 2FE4A 4DB4A 3W5JA 1H65A 2ZQ5A 5F98A 3OEHD 3TE6A 4RFVA 3NC0C 3ADKA 4C2TA 1I4TD 2JGNA 3GJXC 2VP2A 1ZP6A 3R8FA 1HUQA 5EZ5A 1OH6A 3BWDD 1G1MA 4RJLA 3VU9A 2GXSA 3AP3A 1GRQA 3GLFB 3GJ0A 3GD7A 4IOKA 3LD9A 1RZ3A 2G3YA 3KJIA 1AJEA 2DHRA 4DLVA 4DCSA 1XDBA 4QRHA 3TR5A 1X86B 1XD2A 5FFMA 3SU8A 3ETLA 1JPNA 1PLJA 4YDHB 3GLIA 1PV4A 2Z4SA 3FHCB 4ZCLA 3KX2A 5DIFA 3B6EA 1U0JA 3TSZA 2NPIA 1NG9A 5JWHA 3W34A 3T1TA 5FBLB 3KJGA 5EUMA 4MRPA 1KO7A 1VDZA 3CX7A 3AGQA 2GXQA 1OFUX 3PEVA 4HDQB 1E2NA 2RGDA 4JYCA 5UKDA 3T1QA 1DAHA 4JBWA 1XJ0A 1JEDA 2XOKA 3NEJA 4EFLA 1FX0B 1XU4A 3M4YA 5FBRB 3TSOA 5J5CA 1UAAA 5JJKA 1G5TA 2C9OA 4JYBA 2UZIR 4L9SA 3DZDA 1E9EA 2F43B 1JXMA 4ZIRB 3IIKA 3HDTA 4YMWA 1ZD8A 2ZRJA 2B21A 3V4FA 2VP9A 1ZIOA 1AN0A 5CLQA 1G3MA 4DT1B 1XB2A 2RAPA 4B35A 2RGGA 3KQHA 3FB4A 4L5BA 2B7CA 2AWOA 1OKKD 1CJVC 1UEIA 3W5IA 1KY3A 1KO5A 1KMQA 2D06A 1OW3B 1TMKA 2YWFA 3K09C 1EFRD 4WZBE 1NJGA 1KSFX 1WXQA 1N6OA 2BJVA 3SFVA 2HEIA 1A7JA 1S3GA 4B76A 3MWLA 2FWRA 1XF9A 4URYR 4WXPA 4HZUA 3W8RA 1SVIA 2WJGA 4X8LA 2ZAMA 4EUNA 4JVSB 1US8B 3KJEA 2P6RA 3CPEA 5H1YA 2UZ3A 1SVSA 1XX6A 2XTZA 3K0EA 4HYYA 4YC7A 1M6NA 4PPNA 2AFIE 3LX8A 3TUJC 1DTSA 5HE9A 4M53A 4B74A 2BMFA 1N5IA 1A2BA 2CE7A 3B2EA 4LYHA 5HPYB 2QTVB 2AL7A 4JJZA 5FBVB 3TK1A 4CEIA 1E2FA 2BEJA 1D9ZA 3M0EA 1PLLA 3MD0A 5F9FA 2A5FA 4TMXA 1DPFA 2OEPA 2F6RA 4PHGA 2J0SA 3FOZA 3NWJA 5IK2A 4P31A 3DMNA 1N0VC 4D4LA 1SVLA 2IYSA 3BE4A 1TUEA 3A4MA 4PC3A 1SXJB 1Z8FA 2VF8A 3CONA 3F0TA 4TTQA 2HYIC 3AVXA 3NEYA 3U3MA 1FP7A 4DSOA 4Z54A 1G8GA 4NYIQ 2G1KA 1UEJA 2V7QA 1KMHB 1E1RA 4TTPA 2R6AA 4M9QA 4DUGD 1G6OA 2JATA 3R9IA 4TLEA 2X2FA 3CH4B 4OJQA 2GETA 1NBMD 3QF4A 5AJYA 1SXJA 1JR6A 4JLMA 2F3TA 3VNUA 1VYUA 4GOXA 3GJ6A 1M74A 3U7GA 2AFHE 1WDTA 4S35A 2P2LA 2QBYB 4KFTA 1NMXA 2IUSA 3AF4A 3U4QB 2AK2A 3P26A 1YR8A 2W6JA 4C0SA 3L0PA 3KXIA 2ZE6A 3ZQJA 4D4MA 3SQXA 2FPLA 4HDCA 2IYQA 4E07A 1GL9B 1TQ4A 3U4QA 3GLGE 1K5DA 2YV5A 1QHXA 4U02A 3AGPA 4L16A 2NO7A 1DELA 4A82A 3ZLJA 1UKZA 1SVWA 4B44A 2IEZA 3NDBB 1E0JA 2E9SA 5BYKA 3FMIA 1EESA 3AV0B 4XWAA 3Q72A 3RS3A 4Q1BA 4A0FA 4KVGA 5FOVA 2WJVA 3PR1A 4W5WA 4YLGA 1NNEA 4V0ME 3H4MA 3QF7A 1PUJA 2DPXA 1K8RA 2BWJA 2J7KA 1Z5ZA 5EE1A 3C5CA 3A4LA 4E5UA 5GVRA 1U8YA 5B58C 2KBFA 4LBWA 2FSIA 1LVGA 2ZANA 1X8JA 4PAQA 1G8HA 4H1UA 5TMPA 1KO8A 4Q5IA 1NIPA 5CLLA 4KU4A 4UJ5A 2PJZA 1G7RA 3LBIA 2HUPA 2ZJ5A 1ZBDA 4KV9A 1FMLA 2XJ4A 4V0LA 1N5JA 3QKRB 3ZDQA 1KYIA 1MKYA 3QKUA 2CCGA 4L8GA 2WSSD 3Q3JB 3EC2A 1U90A 4XVQA 2GCOA 4JVMA 5L3SB 2GAAA 3QXSA 3OZXA 2QENA 4B3DA 3K70C 3BOSA 3SNHA 3ZVLA 2V55B 2HLDA 4C0AC 2EYUA 4L15A 2ZSDA 5HZKA 4XVUA 1S4QA 4HAXA 2XOKD 2HXYA 4JLPA 1CJTC 1JJVA 2O5VA 5H8WA 1G21E 4GMDA 2F55A 1EGAA 2J7PA 5K8UA 4JLKA 3B60A 3SJBA 2ZYWX 1WQ1R 4TMTA 1XFAA 1J7KA 3VFDA 2QE7A 2WZQA 4F7WA 4DBLC 1JR3E 1LS6A 3QE0A 5FL7D 3QXHA 3K9NA 1CJUC 2ZROA 3W3AA 1II8B 2JA1A 2UVQA 3H0KA 2DB3A 1EWQA 2RH5A 2BM0A 2FPMA 4HUQA 4I4LA 4LHWA 2CK3A 3DO6A 3GQBA 4LBZA 4P4SA 4AG6A 2F9MA 4C0QC 2XXAB 1NKSA 3TUZC 2ZITA 1VKJA 4BEJA 2QBYA 2VBCA 1U0LA 1LV7A 1KDOA 2VSFA 1GWNA 3KKMA 3L0OA 3ICEA 4TL7A 4B75A 4DCVA 3I5XA 4F4IA 5HCIA 1IN4A 5HKKA 2P65A 3OF5A 3QPUA 3T1VA 5B57C 2OCAA 4OQLA 1W36C 5JHHB 5DH9A 4K8OA 4DIDA 2BOVA 4HB0A 2CJWB 2JCSA 1PJRA 2V1XA 2PLFA 1P6XA 1VIAA 3AF2A 3CLVA 3IEUA 4HAVA 1P61B 2YOGA 2O8DA 3LY5A 4ACAA 3OEHA 4QGHA 1AS3A 4R71A 4KHZA 2IUUA 4HAWA 3B78A 1XPRA 3LBHA 4BFWA 3KKPA 3KQLA 1G17A 1Y3AA 4TLDA 2ZJOA 3C8UA 2YINC 3I8SA 4A0HA 4BLQA 2ZJ8A 3VX4A 2GJKA 2ODNA 4N0EA 5IDVA 3TKLA 3TQFA 3D7MA 4NYJQ 5JSZB 3QXXA 5IRCD 2KE5A 5JRZA 2PL3A 3KTAA 1OV4A 1W4AA 4B3GA 2IYYA 4WXRA 1KK1A 3TMKA 4TQUS 2FU5C 4LJ9A 5E7IA 3SYLA 3ZIAD 1OE0A 4AC9A 1Z63A 1VCMA 5CIQA 4PPQA 4PQRA 1UF9A 4KYUA 2G83A 3GFPA 1G8YA 1VHTA 4PPGA 2YVUA 1S3SA 3RSOA 1F2UB 3THWA 2DFNA 2MSDB 3ND8A 2DFKB 2ZSAA 3U60B 1E9BA 4B3BA 5KHOC 1XMSA 3OFNA 4MKGA 2ZRPA 2C5LA 1C9KA 1E9FA 1N6LA 3SHWA 3IPXA 4TT3A 1GKUB 3AP1A 1IY1A 3HR7A 5KNBA 2ZU0C 2IS6A 4LV6A 2IS2A 1AS2A 2OBNA 1BYUA 4PFSA 4Q01A 1ZW6A 1NIJA 2XITA 2OFWA 1C1YA 1TEVA 3L0IB 4Q1CA 5JEDA 2GCOB 2ZS9A 1T8UA 5L3SA 4B71A 3A1WA 1XXHA 2O8BB 3W90A 1P2VA 2ORIA 4BEBA 2ZJ2A 1XJCA 3WMEA 3CZQA 1IONA 2Z0MA 3RRMA 2OLKA 4NCNA 3SE0A 1OFTA 2CVHA 3T5DA 2FZ4A 3KUCA 2J59A 1F2TB 3HU3A 5P21A 4B2IA 3KL4A 4UKDA 3IILA 4MUAA 3U44A 3HU2A 5C46F 4C2UA 4RZUA 3U3RA 4PHTA 1Q21A 4DDTA 2F7SA 1NMZA 4KLNA 3R9XA 1XWIA 4Z8YA 4W7SA 2ZYUX 3TR0A 1HE1C 1NL3A 1P60A 2GCPA 5FUWA 5HTKA 1KSJA 4TMZA 2CHGA 1GDDA 2G0NA 3RDPA 1E98A 4Q18A 3WP0A 3UMSA 1GG2A 4LBVA 3C5HA 1T9HA 1PLKA 5F9HA 1Z0JA 3EG5A 4YDSA 4PAOA 1FUKA 5AUQA 2F1JA 4C30A 3ZS9A 4BE7B 5EE9A 1E9CA 3THXA 4M1YA 2FMXA 2R6FA 2J3EA 4HB3A 4QHYA 2H18A 3LV8A 5DLQC 1E1RD 3KTAB 2A7QA 3DKPA 2ZSBA 4YONB 5DO9A 2O0HA 1MO6A 1BKDR 3A58B 3TSWA 1AM4D 2FNAA 5J40A 1XTJA 3VR2A 1KJYA 2PEZA 1IQPA 2ZE8A 3HPQA 4Z51A 3MWYW 3TRFA 1OH8A 2W83A 1KO1A 5A5GA 2RGCA 4DZZA 2F1HA 1J8MF 1AZTA 4QNRA 521PA 4M0LA 3CRMA 5FL7A 3AKDA 2XZOA 1IXSB 2NTYC 2FSFA 1HT1E 3VKWA 1SXJC 2C8VA 2VP5A 3VTKA 4M1SA 1NN3A 1T3HA 2P6NA 1KI6A 4M1MA 3TW4A 3LLUA 2ZTSA 3W9YA 1CJKC 2EU8A 1SVKA 4Q48A 4CGZA 1JI0A 2J9RA 4LBYA 3IUYA 1YR9A 4C0BA 1W44A 1DAGA 3THYA 2BMEA 2L0XA 2ZJAA 5HZHA 1SKYB 4LJ8A 3VR4A 2ZI6A 4KVAA 2DBYA 3FFAA 5TARA 1AS0A 4ASUD 4NONA 3RRZA 1LW7A 4H9GA 3T35A 1CBUA 1OHHA 2IA5A 3AUXA 3F3YA 2JLYA 4LPSA 1AK2A 4HAZA 1TPZA 4BGDA 3N2EA 4FMBB 4ZKEA 4AKIA 4LHZA 4XWKA 3ADBA 2BVNA 4FMCF 5EP1A 1NJFA 3H84A 2X77A 4QJ3A 1OXSC 5JS8A 3B7GA 5E7MA 1L8QA 2QAGB 4BFVA 1WMSA 1AKYA 2Y8EA 5DYGA 3QXCA 1S2MA 3KQKA 2GXUA 3PG5A 2OCYC 3RABA 1P7CA 3PIRA 2NZJA 3NHBA 4NZYA 2J0UA 1X1SA 2BHRA 2D2FA 2O0JA 2DWQA 4OL0A 1R8SA 3NIBA 4PC7A 3BRWD 1E2PA 4LV5B 4OKSA 3SBDA 1SKQA 2JLRA 4RVCA 2GK6A 4UNPA 5JECA 1MO3A 5KPDA 3QEJA 2J1LA 2QNRA 4JSTA 3NXSA 4EKDA 2EYQA 2WSMA 2P5SA 2WAXA 3K8YA 1E2GA 2ODBA 1NN1A 1TF7A 2J7PD 3OEEA 4V03A 4B43A 2ZYTX 5FUVA 2BMDA 5FI0B 1M1YE 3X1WA 1Z2CA 4LJ5A 1DBSA 3RAPR 3NBFA 2QE7D 1RRPA 4LGMA 4LUCA 4TT3D 1T0HB 2QZ4A 1Q44A 4IEIA 1WRBA 1IM2A 2HV8A 3H86A 4IDNA 1FP6A 2D3WA 5DI9A 4AKHA 221PA 4GT1A 3FTQA 4DLXA 3O8RA 2O8BA 1Q1QA 2V9PA 3FPAA 2BCJQ 2CK3D 3PUYA 1FX0A 4JVLA 1XCPA 1G19A 5CB6A 4GPTA 4PHFA 1YRBA 4EAQA 3GPLA 2WWHA 2V8OA 1II8A 1WBDA 4C0LA 2QG6A 3EXAA 2YOHA 4F38A 5J47A 3LDAA 5FTLA 4IVRA 1IJFA 4QM7A 5KSYA 1HV8A 5HKKD 1UKEA 3I72A 2OT3B 1U9IA 4FD2A 5CB8A 3E5HA 4BRWA 2XXAA 3BH7A 5DI3B 4NKRA 1EFTA 1KKLA 2EVWX 3HWSA 1TF2A 4RKFA 4ZI2A 3KFVA 1OXVA 3ZS8A 3DDCA 4HLCA 4OHVA 5DI3A 1DE0A 2OAQ1 1AGPA 1FW6A 3EZ7A 3PCRB 2D4HA 2QAJA 1YKSA 1DVRA 2WHXA 4IOMA 3VR1A 2WWYA 5G3YA 4JLVA 1KIMA 1DAEA 4OK5A 1J99A 3PENA 1DAFA 4JL6A 1AKEA 3RS5A 4CF7A 1R5OA 1E2QA 2TMKA 2IW3A 2G88A 3SS8A 1EK0A 1G20E 2OCBA 5TY0A 2ZS7A 1KDTA 1ZC3A 1XEXB 1G7TA 4B34A 4DB2A 1RJ9A 4EPVA 3SHFA 2ZRHA 3QG1A 1GNRA 2R8RA 5CDFE 5FL3A 1D2NA 5EP2A 4Q1EA 2B7BA 4ZPXA 1W36D 2W0MA 3GLFE 1CR0A 2WIBA 2BKEA 4P32A 2O8FA 1TADA 5K8TA 4MDFA 4GZMA 5SZJA 1US8A 4G1UC 4DSNA 4Z1MD 1UM8A 4GBMA 2MMCA 1YR6A 3CF2A 2XX3A 3PVSA 1MT0A 4DKXA 1E96A 1NSTA 3K70B 1CR1A 5KDLA 3NC1C 1IBRA 1Z3IX 3VU9B 3KKNA 3THWB 1TEXA 1TUIA 2VHQA 1ZD1A 3QKSB 2ZRAA 3BGWA 4LZZA 1ZC4A 2IC5A 1P62B 2J0UB 3CB4A 3TW8B 1KAOA 2WBLC 1S96A 3TQCA 3GLIB 4LJ6A 2OFOA 2ZRLA 5ELXA 3A37A 2FX3A 5ANRB 5C4MA 1KK0A 3R8CA 3GJ4A 2NMVA 4UXJA 3WBKA 3HU1A 1RVDA 1KNQA 5JCPA 4MDEA 1R10A 4XVRA 4LOAA 2FGKA 1KI9A 2BBSA 2EFGA 1U8ZA 1NI3A 4MRSA 1IJEA 4P33A 3NVAA 1XD8A 2GDJA 2W6ID 1E2IA 4RCZA 4URZR 1TU3A 5FR1A 5BYJA 1U9IC 2NG1A 3K0CA 4A9AA 4G3XA 3FKSA 1QBKC 5G53C 1FPMA 1ZM4A 4RZ2A 2J45A 4F4JA 4A2WA 3S1AA 1GFIA 1G3QA 4QM6A 4K81B 3EPJA 4LI0A 2PX0A 4EPRA 3I1FA 3NHAA 2QT0A 2BIFA 4V0MA 3HR8A 2FDCA 3LX5A 1CTQA 2WJIA 4DCUA 2A5YB 3I8XA 1FUUA 1TU4A 2HF8A 2ODWA 2QL6A 2ODEA 2RGNA 3WNBA 1F60A 2H7VA 2ZUDA 3VX3A 1IN5A 1ZD9A 2REOA 4XTRA 1KDRA 5E95A 5JRJA 1JAIA 4DLYA 1VG9B 2DWOA 2VHJA 2ZI4A 2HT6A 2NO6A 2XNSA 4UXHA 3DOFA 3TAUA 1XEFA 1IY2A 1DADA 3LVQE 3KB1A 4TN1A 2IYWA 3VR6A 4ZO4A 1P2UA 1KJZA 4DLTA 4Q4JA 3LQQA 1KZGB 5CK5A 5JHGB 4TZ0A 5DHFA 2RMKA 1ANKA 5AR1A 3QSYA 2W2XA 1W2GA 1AGRA 4CZ2A 1KK2A 1P9NA 4URXR 1HE8B 3OIUA 1H8HD 1ZM7A 3CX6A 1HQYE 4X8HA 1EFUA 2OV2A 2OXCA 2ZRKA 4GP6A 4LC1A 3OIVA 1OHHD 3SR0A 2P3SA 1E2JA 2ZEJA 3THYB 3M6AA 2ATVA 2FPKA 2C96A 1NY6A 3T1OA 3EASA 4A15A 3EIEA 4F91B 1FL9A 1OFIA 2R6CA 4NCHA 4LHVA 1KTVA 3DOEA 4DLWA 3A6PC 4MGIR 2PH1A 3CM0A 1DO0A 1RPZA 2WWXA 4LJYA 1S8FA 1RRFA 1I4DD 2J46A 3W6OA 3W8NA 1K5GA 2WPDD 1ZCBA 4DSUA 1OH5A 4R9UC 1OXTA 4PC2A 4X8MA 3G5UA 1Z6GA 1XZPA 1KI8A 3UG6A 1AIPA 2OG2A 3TAHA 1Z28A 4G5QA 1E79A 1MO5A 1YZKA 2BV3A 2WJYA 4W5JA 2QU8A 3OE7A 2IXGA 1KI4A 3WRXC 5AUOB 1LFDB 1TTTA 5TV2A 1X8LA 5FTJA 1VPLA 3A1SA 4I1OA 4PHHA 5TXGA 5KPJA 5EE5B 3IHWA 3EPKA 1WA5A 2DWPA 1SGWA 2GVDC 1V43A 3UATA 1EWRA 2OAP1 3PEWA 8OHMA 2I1QA 1P73A 5JSZA 4PANA 2NO9A 1EX7A 2QQEA 4ERNA 1XTRA 1QF9A 3MJRA 2ZR0A 4TWZA 3PJRA 4WIAA 2VIIA 2D74A 2CEAA 4AY2A 5JJLA 4MH0R 4B2LA 5AJWA 4OBEA 2QTFA 4R7ZA 4CRWB 4LJ4A 1L4YA 1U2RA 1EFCA 2A9KA 4XWOA 4C0JA 3FWYA 2QM8A 4ZKDA 1JPJA 1TNDA 2R62A 3ZH9B 4EFMA 1MO4A 4JZKA 5JEEA 2G0TA 3AM1A 5BN4A 1ZNWA 1R0YA 3IO5A 4U5XA 3X1DA 2VA8A 4AK9A 1CRPA 1SULA 3FE2A 4S2EA 2KB0A 1RKBA 1L2TA 3B8HA 4JLJA 3BAFA 1Z22A 2F3RA 4XD7A 1W0JA 2D7DA 1E4YA 4DCNA 5DNYB 2WWFA 3LLMA 4YMSA 2O0KA 1JALA 1NKTA 2WMOB 1VG1A 2IWRA 2YC2C 2GNOA 2GWHA 1YZNA 2J0VA 2PCJA 3RS7A 2QQ0A 1R8QA 4OK3A 2Z6VA 3EPLA 2ERYA 1FMJA 1MR3F 2CCJA 1XD2B 3K9HA 4EIWA 3C4JA 2XB2A 4NYJR 3EIQA 3T34A 2X8AA 3T5GA 4LCBA 4ILEA 1NVWQ 3B1ZA 3AEZA 3MJHA 3TGPA 2D62A 3EARA 4B47A 1E2MA 4TQ9A 3AF3A 3RC8A 3X1ZA 1OSNA 1NLYA 2A30A 3O8DA 3UIEA 4KI0A 1EXMA 2NZ8A 3CPHA 1SXJD 3E2IA 2GILA 4C7OA 1P5ZB 4HEJA 4OHZA 1ESNA 3IQXA 2XAUA 5GJWC 1IXZA 2V1UA 4B6FA 1Q3TA 3AKEA 4ARZA 3R7WB 1RRGA 3B1VA 1ZUNB 2D2EA 3WY9A 2AKAB 4IVPA 1KI6B 1AZSC 2IYVA 4QXAA 4Z1MA 2GBLC 4FWTA 2BEKA 2FSHA 2OFXA 1G3IA 3DHWC 2V6JA 2LCFA 1Q3HA 1A4RA 2C9CA 3SBEA 1NVUQ 4KFSA 4ZCIA 1LS1A 3MWKA 2C95A 4M21A 2FGJA 3LQRA 2C2HA 4V0OA 3AF0A 1S9DA 4ZDKA 2NQ2C 3I62A 3L2OB 4B32A 3PUWA 2FA9A 3L8YA 3P27A 1F48A 1W46A 3RWMB 5EJEA 4ZDIA 4I81A 4WA7A 1G4UR 1GKYA 3LW7A 2VL7A 4MGZR 4N1AA 3UPUA 4TL6A 4RD4A 3U5ZB 1OF1A 5FBWB 2VRWA 1QDEA 4GMXA 4NCKA 4YMTA 4Q1DA 4DLSA 3IBGA 2FFHA 3PUZA 3CW2A 3GEEA 1TF5A 3A1UA 4IEEA 4WW0A 1P75A 4TMWA 1OB5A 2QMHA 3M1IA 3Q7QA 3ONWA 4L4UA 4P0TA 1QVRA 2JEOA 4JJKA 5C1BA 5JWRA 4BFZA 1E9SA 3HYRA 4KFUA 2ZRMA 3VHXA 2LKDA 4PO9A 3E70C 4RD0A 4F92B 5L8VA 4B3XA 4PPFA 5GVSA 1E3MA 5KSPA 3O8BA 5JZVA 1HYQA 3B82A 1UBFA 1XMVA 4TYNA 2IYLD 1YZUA 1E79D 1FFHA 1X6VA 3W3ZB 2H17A 3QKSA 2J41A 2JLSA 2HLDD 4HB2A 1CULC 5TB5A 2GZAA 1A1VA 4C9BA 1OB2A 4LX0A 5FPHA 2QAGA 1ZM9A 2J5XA 2VHCA 3HJNA 2IF0A 3KB2A 1N5LA 5FTMA 3VNVA 3DMDA 1F6BA 2NPFA 1F2TA 4JSYA 4AIIA 1N5KA 2ONKA 2EW1A 2RCNA 2V54A 3PV0A 2QGZA 4Z8XA 1M7BA 1X8KA 2QORA 1HURA 4HLUA 1A5TA 3LVRE 1N0UA 4FMDF 4BFXA 3R9WA 2VP0A 3PUVA 5D3MB 4A2PA 3B13B 2GAOA 4PZZA 3PUXA 3QJYA 1KO4A 3ZJYA 1SHKA 1W5TA 1J70A 1EFHA 4RZXA 3UWOA 4AG5A 1LTQA 2QP4A 3AVQA 1W4BA 4LJAA 3BXZA 3IEVA 1WP9A 2GBLA 3QPVA 1CR2A 1VG8A 2DFLA 4MA4A 4ZCMA 4D25A 3D3QA 3WNDA 3I5YA 3EA0A 1H8ED 4TZ6A 1TL7C 1H8HA 3RSLA 5EXTA 4Q02A 2Q3HA 3QKRA 3WHKA 1ELOA 1HQCA 2G9NA 5AUNB 1RYFA 2PZFA 1GITA 4F4CA 4JS0A 2IXFA 1T0JB 3CF0A 4P4UA 2XSZD 4DIEA 3C16C 2JASA 3REGA 4BPBA 1Q12A 2FOLA 4TMVA 5KYKA 4CEIB 1W0JD 4EJSC 2NGRA 3MGCA 2WAYA 4CT4B 4MYHA 4D6PA 4TLAA 1ZNXA 1NVXQ
chains in the Genus database with same CATH superfamily
3EUWA 1P0CA 2VK8A 3GMDA 5EWMA 2OFPA 1VZ2A 2OSBA 2RARA 4M0UA 4ECAA 3CVVA 4JI2B 3GBPA 2YXDA 2J0QA 2CFRA 2O48X 4AJPA 1EFPB 1W9HA 3O9ZA 3BQNB 1XA4A 1FMCA 1Y5MA 3F6YA 4BLSA 1DAKA 2AS0A 2ODTX 1M2OB 3SIXA 1ZZGA 3W2IA 3TRHA 2PNFA 3U6BA 5F3WB 4EP1A 3ZY4A 1OIXA 2R97A 2YV1A 1QVAA 2FPWA 3BH0A 5DULA 3LECA 3LDUA 3DPUA 3E81A 5BV2P 1LBIA 1S89A 5F3DA 4MK4A 1CLUA 4II2A 1QP0A 2WWRA 1P2BA 1YE3A 2CB0A 3CZ5A 3NU1A 1FUIA 1NVVR 1VL1A 5EE0A 1S7CA 2PMKA 3B38A 4BRSA 1JILA 1I8TA 4NFYA 2ZWOA 3G1UA 2CHEA 3HKDA 3V8RA 3WDMA 5AJVB 2C03A 4W5HA 4QVIA 1NTRA 4PX3A 1H9BA 4RV9A 2IP4A 2JGRA 2J3LA 4HV4A 3WGZA 4QQKA 1U4OA 2RGXA 4MARA 3H1PA 2NU6B 5ESXA 1DWUA 3A32A 1U3CA 3N3BC 4JLDA 2BE7A 4OAQA 1FS5A 4EKYA 1L1QA 2CLMB 2FVYA 2V7WA 4I4NA 2F8TA 1WW8A 4Z4QA 4QC2A 3I9V7 2R66A 2W22A 4X93A 2AB0A 2VYCA 2PTHA 2I34A 2XCTB 4J0HA 2ZI7A 2EAUA 3GWZA 2P67A 2ISCA 4L72A 4BMYA 3UT6A 2IHTA 1Q83A 1F1BA 3G2JA 2BKVA 4K46A 1UADA 1G64A 4JN6B 4MIYA 3FZGA 3PEUA 3TCNA 2VCEA 2ORVA 1ODFA 4Q7KA 3TL2A 1Y6QA 4MICA 4DY4A 4EF4A 2ZETA 2V5AA 4CKBB 5KYNA 5H16A 2PJDA 4AX8A 4CUJA 2PUJA 4O8CA 3KCQA 1G5QA 1WUJS 1XCMA 2QS9A 3FDIA 2CSUA 4HNSA 1P9RA 5LJIA 2WMDA 3B70A 4W4TA 4E70A 3OZRA 4MPPA 1E89A 3BIXA 2Z5LA 3JZFA 4ND3A 1L8AA 1USUA 1U81A 1EJBA 2LD4A 1M8PA 1R0ZA 2Z2XA 4OP2A 5DCLA 3TQSA 3EZFA 1BVUA 2PXHA 2R84A 3Q10A 1GGKA 4OLFA 4ZQIA 5SZKB 3R7BA 3GLHA 2NUTB 3VMFA 3TTTA 4B6RA 3I2FA 4DDVA 4HFJA 5BV8A 4D9IA 1RADA 2XZPA 4G97A 4YJHB 5DT9A 4RD2A 5E6UB 1H94A 4QX6A 4UATA 3M70A 4RMHA 1FYEA 4XZ3A 1I2MA 4CQJA 2PUBA 4ZVUA 4DDUA 2QPLA 2QRQA 2HRRA 4YYZA 3NNNA 2GA8A 4ZQCB 1JDJA 1O3YA 1JSLA 3RTCA 3GPIA 4WHMA 5B55A 2C8JA 3C7DB 4KWHA 3FUCA 2VQSA 3MEQA 1IWPB 4HBGA 1RLUA 2FUKA 2X3UA 4NFLA 1E2EA 4E21A 1NRJB 1HY3A 2P5TB 1O5OA 3BPSA 1YOBA 1QKIA 4X71A 3QNUA 1JQAA 3MERA 3H83A 3DLBA 2B1QA 3VR2D 3MMSA 4JCCA 1JMKC 2V0GA 3C41J 2VAWA 1C4OA 2DJIA 5LYJA 4Q4HB 4RK6A 4IYJA 2W2PA 5K4GA 1FFGA 1Y63A 2JZOA 3U26A 3OFND 1UWCA 1W94A 2B4YA 4FOPA 4P4SB 4QBFA 3WHPA 1M5UA 2X1VA 1XHFA 3BQMB 3FSGA 4BASA 3EXHC 4ENUA 5BXQC 4ED9A 1XTZA 5BUQA 4DXDA 1UXHA 2APJA 3H9CA 4MYSA 3BZBA 4RIGA 6REQB 1JXOA 3V97A 1PYOA 2ZKIA 5H3HA 1U2QA 2NXCA 3G79A 2C7RA 2ZCJA 1YRYE 4R40A 4YRMA 4PNPA 5KWEA 1J2UA 4NU0A 2VCHA 3HJTA 4FMDB 1H8EA 4OREX 4UBMA 4A6XA 1G7CA 2RGBA 3OWXA 4EPYA 5JZBA 2DFTA 5A0FA 1PL8A 2VYQA 5C7LO 2HV9A 3MRXA 1EZZA 1WSAA 2GCGA 3KQTA 1A82A 1JZTA 1DEXA 2HEGA 3BBPA 4GFDA 5H59A 1O94A 5L7YA 4EA6A 4XWGA 1LQ2A 1N2XA 1M72A 5FLEX 4RM2A 1ZINA 1ECFA 1UJ2A 4HNUA 3OZIA 3F3MA 2CLFB 3QVSA 7ABPA 3WYNA 1R4MB 5TX7A 4KODA 2E48A 1ZOLA 1KY4A 5FBQB 5HF8A 1DO2A 1RWQA 1Z82A 4L57A 1WLSA 4D0SA 3LQ1A 4CTJA 1D6JA 3I5UA 4WY5A 3UKDA 3N2KB 3OUZA 3OZTA 4PYRA 4YMUA 3GLIE 1NLZA 1MRNA 1GNTA 2AC2A 2EJUA 3GFTA 3QYPA 4YIKA 4AY6A 4PIPA 4KAJA 4Q05A 3GH1A 3NDJA 1XZJA 4YROA 4EQZA 2EP7A 3T3KA 3C4VA 4HQOA 4X54A 4YCAA 5FUXA 1EAMA 4EG6A 4JLNA 4I9GA 4R8SA 1L4LA 2TYSB 1KK3A 3D3WB 2Q50A 2C54A 2E55A 3MWEB 3FD8A 2A9RA 1K88A 1E3JA 1V1RA 1YO6A 2JDIA 3D6AA 3I3SR 4Q15A 1XRJA 1Q0QA 2J9YB 4O33A 3HL4A 5AJZA 2K5UA 2WTNA 4O2LA 4U1RA 4KHPB 2BDEA 3T9BA 2Y4OA 1XEWX 1Q50A 2VWHA 2NYAA 3A11A 3C98A 3PI7A 3RJ9A 4MZDA 3T0FA 3KZNA 1XTSA 3UMVA 5HW0A 3I6YA 5IWCA 1EX9A 4OHUA 4UFPA 3V7FA 5AJXA 2EFDB 3M1LA 4IKOA 1N2HA 3FOAA 1GLVA 4TXMA 3IUBA 3WMGA 5MDHA 2AJ8A 3ZLBA 1QHIA 4AB1A 2WJHA 1T3TA 1JA0A 1B1CA 2HMUA 1NQOA 4YLEA 4DLRA 1NT2A 3OLYA 3SZOA 4Y98A 1FJGB 2CUZA 5C5CA 1X1BA 5EUCA 3OAAA 1UOOA 4X7BA 3BZUA 4YK7A 2PMBA 1M34E 4IVNA 4QWMA 4RF5A 1F20A 3MK31 3OKFA 3SD7A 4ILKA 2QEQA 4O0MA 4Q7LA 3PQDA 3F4LA 1FNNA 3M4NA 1AQUA 4H7FA 5IABA 1ORDA 3W77A 2PH3A 1WUHS 4TMYA 2RD2A 3AU8A 4HWTA 2A4MA 2WHPB 2UZ1B 1AKMA 1SZCA 5J5VA 3OQMA 4OJKA 3TLMA 4GP7A 2EX4A 3II6X 4MLPA 5AM3A 3AUTA 2JIZD 1QYIA 1B16A 4JNCA 4N5IX 5K51A 5AM4A 5A4DA 3M49A 3IERA 2X5OA 3NXKA 4BHTA 3K71B 3NBUA 2Q5FA 3CRW1 4G85A 1E6CA 4Y2VA 3UGTA 4N5HX 1A71A 1CFJA 2AG0A 3W6NA 1X87A 3FUTA 4MITA 5D51S 3DOCA 1J8VA 1ISHA 2FOXA 3HP1A 1N78A 2QU7A 2XDYA 1VC2A 2Y1XA 3R3VA 5FEMA 2NO0A 3BE6A 2WDZA 4EFNA 3ZVRA 1S1CA 3GCGA 5IANA 3D3KA 1Q6ZA 3A31A 1PTJC 1SD5A 3HM2A 2Y93A 2QM7A 2WYHA 3C2QA 3D8HA 3GYBA 3GWGA 2VAVA 4R2IA 4TRRA 4DG5A 1YAHA 1U8AA 3HGTA 3JY6A 3KXLA 1E59A 4PLPA 4XQCA 3RRJA 1J97A 3GGPA 1CY2A 2GCNA 1HZJA 2D0IA 2OBXA 3Q2OA 5IKMA 5HNKA 1VKOA 5J4LA 1DOAA 1TZJA 1Z6PA 5JW6A 3EULA 4B6OA 4IJMA 1THGA 4HKTA 2ZJBA 2J9ZB 4NYMR 3JD1A 3CCBA 3S2YA 1L1EA 1FDVA 3JQ7A 3QKWA 3IEMA 1WBBA 2P0EA 4J1QA 1NBMA 1JU3A 7MHTA 3ZE1B 4LY6A 2ZB8A 5TNXA 1T0IA 4YMVA 2Q4TA 2HO5A 2GVZC 2B0CA 5FD8A 2PL5A 4X6YA 4FXOA 4EBFA 1QK3A 4RDHA 3IEKA 1GR1A 2OWDA 3UWKA 1F14A 4I46A 4OQXA 2QW1A 2B8JA 3OURA 5K6TA 1A76A 1QC5A 1D03A 1Y4AE 4EUKA 1WCIA 1NJSA 4XB2A 5EIBC 4QOIA 3HDQA 5CAEA 3G2MA 3WOHA 1TQ8A 4CQNA 1G38A 3AIOA 2QTTA 4RENA 4A6PA 2CL7X 2BP7B 3QQ5A 1GGMA 2VOJA 4P86A 4UZFA 2MYPA 2PMWB 10MHA 3A27A 1GFZA 1JAHA 3ICWA 3MS4A 4I4IA 1I13A 1WEHA 2HBQA 4YCCA 3THRA 1U3UA 1XBTA 1B1AA 2OMKA 5KNBH 3OLWA 1BH6A 2HADA 1GCGA 3LXRA 2XH8A 3OIWA 3QF4B 5AKGA 5EMMA 3WJ2A 1Z2AA 2WIFA 3HJUA 4G2TA 2JFNA 2Q3EA 4WAUA 5JLJA 2JBWA 3TXAA 2XUDA 3SJAA 4MA5A 4BO4A 2WKPA 4C0HA 4UEWA 1ZCFA 2FW7A 1O94D 3OCYA 4GMFA 4X62B 3HXQA 3OZFA 5CITA 2WTBA 3UO8B 2P78A 1P3Y1 1TTHA 1IN1A 1VIYA 5M34A 1YONA 1ZGBA 3KT0A 3W6PA 3UWMA 2C57A 3WYEA 1LY7A 3OZUA 4B6EA 4MWOA 1ZMOA 1PL7A 1FFDA 2J87A 3U3JA 3LC7O 3AUFA 4TLBA 1YKFA 4KQIA 4BOYA 2FFAA 4OYLA 3ZZ1A 3EGEA 4KGXA 1O0CA 3NBKA 3EQ8A 4TUYA 2KSQA 4DC9A 3HGMA 4C3VA 2EW2A 1E2BA 3MBIA 1KY2A 5KUTA 4IJWA 5HQJA 2JLWA 1BTOA 3GJ8A 3PKJA 1FNMA 1TLLA 4ETNA 1I0IA 4KWEA 5FRDA 3NTQA 4PO8A 4BXOB 3PD1A 5BT8A 2I66A 4IF6A 1A69A 4Q1AA 4LZWA 4Y1RA 2PH5A 3IQWA 4RHXA 3C74A 3IKJA 1XQ9A 3JQBA 1UXKA 1NM5A 1D2MA 1ZMTA 4K6HA 3ZXXA 2DQYA 4BQFA 5KWIA 4MKRA 4RY0A 2ZM6B 4A92A 9LDTA 3JQ8B 1WZEA 4JEHA 2V7QD 3WLEA 3U9LA 4IMRA 2ETXA 4LZJA 4X9XA 3PQ2A 4S05A 5I7AA 3CRRA 1NVTA 3U7HB 3IAHA 3TQIA 3D4NA 4NTZA 3DEAA 4YH1A 2BBWA 1IEQA 3Q2IA 1OZAA 4RPHA 4WTOA 1UM9A 2GI4A 4Y0AA 3FLMA 2G9RA 2OZPA 5AKHA 4NS4A 2FFBA 5CCBA 1R5BA 2RAVA 2WVJA 3IDZA 3IOMA 4ZI3A 1F0YA 3EZGA 2QUBA 3LT1A 1PV1A 2GHTA 2NX2A 5J2UB 2X9VA 3RVLA 3B9BA 4QYXA 5EIFA 2OV8A 1QZXA 2VEDA 3P1JA 1I4LD 4WI1A 1BS2A 3O03A 3K53A 2FQLA 3N70A 4LZAA 3UMGA 1LK7A 3EVZA 3LYLA 4ERXA 2QG9A 4DCTA 5JT1A 3CVXA 3ZXYA 4GM4A 4G4IA 2QTCA 4CCYB 1E9DA 1ESDA 1IXKA 1GFWA 1GTVA 4GKVA 2OK8A 1MIOB 1VCNA 2OZEA 3NKLA 3TNDA 1IXYA 3EW9A 3ZHSA 2WIDA 4OQZA 5T8KC 1P0FA 4DA0A 5CB4A 1ZX1A 2QZSA 4FQ5A 5CNIA 3G5MA 5BW8A 2JIZA 4B3HA 4I55B 4ZYYA 1K86A 4XIGS 2CJPA 4BRUA 2R2AA 4KFCA 1HMPA 1EM6A 1H3NA 3VNRA 2ZXEA 3PT5A 4EX7A 1M76A 2VKTA 4F3KA 4RNCA 1KXJA 4WASA 4Y9SA 4D9HA 4A26A 3F46A 4OOEA 4EATA 3KSRA 5T41A 2QR3A 4E3WA 1T10A 2H1FA 2YYZA 4PS1A 5CLJA 3MC1A 1Q0UA 3VKHA 1UKVY 2A5GA 1C0EA 2ZULA 4YRGA 3QVLA 1U28C 3VOBA 2W6IA 2QMOA 4P9NA 2Q5QA 2FUG6 4FGJA 5K8IA 1YTUA 4DT1A 1DIGA 1QTRA 2PAAA 2Q1UA 1NFRA 3N9IA 1PEYA 3HVJA 3L0CA 2CJXA 4I6JA 1ZN9A 2XQVA 3FGZA 4R54A 5LZ7A 1DXOA 4CEHB 1XVAA 2O3SA 2JIQA 2R6DA 4U0KA 1X92A 3T15A 3DEFA 3ASYA 4BNFA 2JJ8A 2IH5A 1CUDA 2JKYA 4NBKA 3CKKA 2OENG 2KJQA 2QTLA 1E6UA 3MWJA 3QKIA 4ZYUA 2EWWA 4PEVA 1OYOA 3U3DA 2WHYA 5IVIA 4F4UA 5BQFA 3DBHA 4ACBA 1GGNA 2X5KO 3JQEA 2JI8A 4DRXB 4LI3X 1QX3A 5DNWA 1JQ5A 3LCMA 1DHTA 1JR2A 4X6LA 3VV2A 4UM9D 2XCLA 2D7CA 4I99A 5H81A 1BXZA 2ZR9A 4E4RA 1C9MA 4YAKA 3OHMA 5IH7A 5K20A 5E9AA 3VV3A 5EEGA 2NZWA 4O2BF 4Q9JA 3NIDB 1LY1A 2X0RA 4AD8A 4YUAA 4F3TA 4FOOA 5K0GA 2X2OA 2JLZA 1G60A 2RGAA 3NX4A 1CR6A 1DS6A 2C2ZA 3K15A 5C8YA 1YA4A 3N2LA 1YHYA 4AZ3A 5IUNC 3AVPA 3GXOA 1CY0A 2EDCA 3ASZA 4G36A 1YOVA 3WGVA 2F9FA 1IB6A 4RHFA 1K3FA 3FMFA 2BHNA 1UKCA 2HGZA 3DDHA 5AD1A 3B1WA 5ELLA 3RVJA 3BORA 3I4CA 3BHJA 3D8NA 1ZSNA 1EBBA 1LVHA 2CHVA 1F38A 2NPOA 4R2XA 4BKUA 3QBVA 4KN8A 1FDSA 2YY5A 3TNJA 3FMPB 3N0TA 2OO5A 1JG3A 1WV1A 3HFJA 1G41A 5C4IA 1TVEA 2FK7A 3OPXA 3WTBA 1GTG1 3H17A 4FYVA 5JR3A 5DJ5A 1ZY2A 3D4PA 1JA9A 3ML1A 1SIWA 3QYAA 3B1JA 3UOWA 5JJKA 1U9JA 2PT6A 3QOYA 3FFBA 4AZ0A 1M33A 3PTZA 4K3VA 4WJKB 4DSZA 4P78C 4GEGA 3O4VA 1NI5A 1G2PA 5AWFC 1R8XA 4ZVQA 1V2HE 3R40A 4UW9A 1VLQA 1N6HA 2PAFA 4PPYA 1QG4A 2WD7A 5TMEA 2GF2A 1O03A 2BKUA 1XTKA 3LDFA 1MNAA 4MR7A 4MW1A 3N5KA 4RZIA 4TKMA 4Y0NA 3SJCA 5LSAA 2VSYA 1TPYA 3R7DA 2AD1A 3CZCA 5BNTA 5CYOA 4MQFB 3VRHA 1J24A 3CWCA 2FUG1 3RSSA 4ZREA 2J09A 3BF8A 1GCOA 4IHAA 1QTQA 1K5HA 4AKGA 3E3OA 3HP4A 3FNGA 5E38A 3RTEA 2B2XA 2JK0A 3S5DA 2AFHB 1PG5A 2IUTA 4IW3B 4B3MB 4EDHA 1SQFA 1ZQ1A 5AI9A 3HU5A 1BOFA 1YDGA 1VJ1A 1M8GA 3O9MA 5KOJB 2WWVD 3JZAA 3YASA 2Y6VA 1PZHA 4TWJA 4B5LA 5JI3E 2Q9AA 5L9AA 4I1VA 3SVZA 2ADMA 3V2GA 4BO9A 3FCUB 2YQZA 1EXWA 4WZAE 2FPOA 1BO6A 4RWEA 1IPFA 1AH2A 2KQUA 2N46A 3S68A 4CEJB 4UHDA 3ST7A 4GX2A 1DARA 1O97D 1S8NA 2IELA 5G3ZA 1XNQB 3KBOA 2I62A 3TLAA 3HHPA 1ECGA 4GL2A 5GJBA 2ONZA 1QE5A 1W59A 2Q5EA 2IBMA 5H5JA 4X1KA 1II9A 1ESMA 4AP5A 2W2NA 2BGRA 3WAKA 4QYWA 4IRUB 4TV8F 1XRLA 3GELA 4CGYA 3K1TA 3TDMA 4J0EA 3UOGA 4KJZA 1PS8A 1HLFA 1Y37A 1PJ2A 3NHMA 4RTNA 3JSAA 1F2VA 3RQIA 2PZGA 3VZDA 1G7SA 1KI3A 2WVGA 5CT8A 1Y6GA 3DLIA 3PF8A 5JY1A 1KI2A 3EGOA 4NJOA 1QHHA 1WB9A 2C31A 1W1WA 5FI5A 4A36A 2XMPA 3QTLA 4WWHA 3NHUA 2ASEA 4MQLA 1GL6A 1AN9A 1NXTA 4L0MA 2PCLA 5K6AC 5BWOA 2YXLA 5FPSA 1PR1A 3VPFA 4D6YA 1QHNA 2ZVPX 3P2MA 4F1WA 1EWVA 4R0NA 3CLKA 3VU0A 4RSMA 5EHGA 1KDVA 4BMSA 1LLQA 3CJQA 4HSEA 3RF6A 3WO1A 4BWYA 3HM9A 3AY3A 1U0OC 1YU9A 3HLYA 4CHGA 5JJCA 5JSQA 3FHJA 3E03A 4JFRA 2FMHA 3K0AB 1QS0B 4D4JA 4E5YA 1W35A 3OPQA 1IOZA 1NQXA 3EZLA 4M1KA 4Q12A 4U2GA 2H8KA 2AZTA 3OVMA 4H1VA 3OZ7A 3BJIC 1HTTA 1MAAA 3BMOA 4QYMA 4V0KA 2XB9A 1FJ2A 4P58A 1S2NA 4EPWA 2IX3A 1RRMA 2DLNA 4EJFA 4AT1A 4CYMA 1SU8A 4B2PA 2VFAA 4H4DA 1Z0FA 2Y4NA 1XAJA 3AX6A 3ED1A 2IV2X 1RIFA 3KALA 3VGPA 1J5EB 5LYYA 1HTBA 3ZVNA 2CVPA 1QCDA 2EGGA 1QYDA 1Z5PA 4DLUA 3OESA 3EB9A 5D2CA 3VKUA 4LJ7A 4IIJF 1XZQA 2OORC 4TKUA 1U7OA 1DNPA 3OX1A 4NBLA 4U2FA 1M54A 3X1YA 3H2GA 1XEXA 3B5JA 2ANCA 3IIMA 1XZLA 3BRWA 4TXJA 1NBHA 3RK1A 3F49S 3TW6A 2XZLA 1BS1A 1ECJA 1RM4A 4TOIA 5JYCA 2A3RA 2JA2A 4KFRA 4CMEA 5AP9A 5ILGA 3Q0EA 3TN7A 1H22A 3RBZA 3HCBA 2FJ0A 2H16A 4BLVA 3QUSA 4DSTA 1I3MA 3GRZA 3RYHB 5KSOA 3L43A 3ZKAA 1CEQA 3FVQA 1CIPA 1YRHA 4ZVTA 2Q4DA 2ZB2A 3ADOA 3RUHA 2DCMA 3I2YX 2NV6A 4HDNA 1DJNA 1SPXA 4NG5A 5JMPA 5AJUA 5GIPE 3F4KA 3T1YB 5TRTA 2Z08A 4AO6A 1UT8A 3PS9A 1Q84A 3E9CA 4KAXA 5F33A 1GU7A 5HBRA 3CR7A 3LHDA 3NONA 1I01A 4NAUA 3V8BA 2VLIA 4JI5B 4DLAA 2OM2A 1K7XB 1XLTC 2HZ7A 2WUEA 4LFCB 1RXCA 2P90A 3U7QB 1QQ6A 4UUMA 1DQPA 1RFLA 2PT9A 3WB1A 2B25A 2HSJA 1GQ2A 1IHPA 4PG7A 5CXQA 5FO0A 3B52X 3V8MA 1B73A 4XOIA 4PAWA 2DECA 2HSWA 4FHGA 3EVEA 2PXXA 1DBWA 2VATA 4GPIB 2DYKA 1UXGA 2A5DA 3C97A 4N8EA 1Q0HA 5ARCA 1S02A 2MR5A 2X7JA 2O8CB 1JBKA 5ESWA 4PYMA 2A5JA 3SGLA 3MMZA 1DBRA 1UFQA 4TQAA 4DVGA 5MN4A 1KDZA 1ETUA 2FEKA 3WNCA 2N42A 1MTOA 1Z0AA 2B37A 4HO1X 5CJJA 3QHQA 1L4UA 1VGQA 1N6NA 4DCMA 3NG1A 2QTWB 1Y33E 3DTNA 1W4RA 4PY2A 4NBNA 4UHCA 4GLLA 4G1VA 2NUPB 2CD9A 3QLUA 3FSJX 3TTYA 1J23A 2YWHA 3R5JA 4J1TC 4UAJA 4QOEA 4WGFA 1GZ7A 1ZKDA 3TOZA 2CLSA 4KXNA 4F6RB 4JP5A 5JAIA 2AGVA 2AOWA 4FONA 4G9BA 3DMRA 4S04A 4UQLA 3BG5A 2IITA 3P4XA 3MGAA 4B80A 4QGAA 4DQLA 4KQJA 3F5DA 4CW7A 1L5SA 2VP4A 5JH7B 4NVRA 1U2SA 1Y1TA 1BX1A 5BNWA 3K6JA 2F1RA 2QRVA 4BBJA 3W78A 2HK6A 2F3SA 2FFQA 2WEKA 3SZUA 2EFJA 3OM0A 2Z58A 2K4MA 3MINB 4I6EA 2PSDA 5CVDA 5LKRA 1W5EA 4WXHA 1DAMA 4UREA 4J0IA 1XL0A 2VSOA 4WFQA 3V1LA 4XUDA 3DD1A 3WX0A 2JLAA 5L3VA 2Z4TA 5KMGA 2I3BA 2VHEA 4YRSA 4RE5A 1POXA 2QXTA 5FNVF 2HR1A 1GSAA 3AEYA 3DDUA 1T2NA 1T3GA 3WHIA 4PQGA 3CGGA 3SSEA 3COSA 1LDNA 1S2OA 1UDBA 5L7WA 3DVQX 2LIPA 2Q5CA 1CNEA 1MVNA 1N7GA 3PRYA 1QWSA 4LSGA 1MDFA 3GEIA 2VJPA 5AOBA 4PGFA 3BL8A 2LRHA 2UYOA 2ZWIA 5EZQA 4IHKA 1BGWA 1PK8A 1X15A 4QVGA 4XRRA 4AZ3B 3JVIA 1XCJA 5CBKA 1FFXB 2EL7A 1A8QA 3TLEA 3QLVC 2AXEA 3BB3A 3RVPA 4YRIA 5KSWB 3MRSA 2RB4A 4QJBA 3HXKA 5KTPA 2QAGC 3HGQA 2TRSB 3AG6A 4GDMA 4HQRA 4L27A 3GX1A 4CR8A 5FNVB 3WICA 1KBQA 4LDRA 4LK3A 4YX9A 5LQUA 2E49A 2FAXA 2GEKA 3EVFA 1AURA 1KDPA 4REMA 1P45A 2X2PA 3F7TA 4XIIA 1LPNA 2QRZA 3RNOA 2BGLA 1ND6A 2O2JA 5DGIA 2ENUA 4JJFA 3H4TA 4BUZA 1P1KA 4ZV9A 2E4XA 1ZM3A 1JSXA 2VNSA 4JT2A 2OHIA 3CEHA 4L07A 1G9XA 4NJEB 4P8RA 3NKVA 1ZAKA 4EW6A 2WWIA 4RFSA 1QG0A 5CDYA 3HRHA 1CUXA 1T8YA 3NM6B 4JLBA 1NU6A 3ELYA 1IK6A 1ZCAA 1IN8A 3UAWA 2AX4A 4I36A 1MB2A 3ETEA 4LOJA 4P7KA 3N6VA 3V6LA 2F67A 3BTOA 4QLOA 3V9AA 2AK3A 4DL9A 3RR2A 2NSJA 3E15A 2ZI3A 1K9SA 3ZHZA 4HH3C 2YXPX 3OZWA 3TS1A 3DM5A 4HTFA 1XK7A 1N1MA 4B4VA 1M8FA 1SO8A 2P2GA 1ZK3A 2BJWA 3WJ7A 4WZ6A 1KHTA 5JNWA 1FZTA 5KCZA 2K87A 2B3TA 2IOFK 1Z2DA 1ZL0A 1SNYA 2ORYA 5DPMA 1ENYA 4RD6A 3TSCA 4F3RA 2HXSA 3EVAA 4PVCA 1XVLA 4TS3A 5HKAA 2D1TA 1T4BA 1UXOA 2Z57A 4R69A 4L85A 2O7SA 3Q9SA 3QY9A 4RQBA 4FB5A 3RAEC 1RQPA 3L92A 3U0BA 3AQ4A 3ANSA 1ORHA 2Z1NA 3LQ2A 5B64A 2XIQA 4O2AF 3UUGA 1MAWA 2D1FA 4QDTA 4FNOA 1NN0A 1UJBA 4EY3A 4PLYA 4ESHA 4ZZIA 1MAUA 2IYFA 4PCLA 5K99A 1U1FA 1VL2A 1EWYA 2UVDA 1M0TA 1PFQA 3CUVA 2VPIA 3HDYA 4PG4A 1PFUA 4UUOA 1EUYA 6ADHA 1NQAO 1C9EA 1L4EA 5CVTA 4ZOCA 4NZMA 3DJFA 1V7PC 4QRDA 3QV2A 4TYMA 1HGXA 2NUAB 5KWVA 2GPAA 4M8LA 3DA8A 3CB2A 1NBWB 2X40A 2IP2A 4JITA 1P2FA 1Q6YA 2ODPA 3AOEA 3ESQA 3N2GB 4PR3A 4ZO6A 3SX4A 4HDMB 7ADHA 2AFIB 3DCJA 1ZVMA 3ICCA 4NZPA 3LFUA 3PNYA 1EFRA 5DNCA 1WB4A 1WULS 1K89A 1QV6A 2OO7A 1FU4A 2P4EA 4L78A 5KVAA 3K9FC 3TO5A 3I6QA 3DO5A 2G1JA 4M9XA 2YJNA 1C8VB 4AJNA 2XZTA 2PUVA 5GZ3A 1SAYA 1W96A 4TSFD 1E0DA 4C0KA 3ZKWA 5D3QA 5J4HA 4P84A 1L4MA 1NUHA 3SEAA 4BVKA 4ZMRA 5ADUS 1GU1A 5B1DA 1P1JA 2FG7C 4B6PA 3R0XA 1CNFA 5KQLA 1BMTA 1VSBA 3S5EA 3ZUPA 4ETWA 4G5FA 4N5LA 2P3LA 4E1BA 1FVXA 2WOJA 5U1PA 3UV3A 4YMIA 3UW3A 2EEZA 3ORQA 1H23A 4L8YA 3BHIA 4RGBA 4BECA 5AO9A 3A8TA 3QVVA 4OJMX 4XUEA 4HUTA 3IALA 4MRNA 3GRKA 3UMMA 5HTOA 1QB7A 1PDOA 2X9LA 2DEUA 2MR6A 2Z2YA 2B4KA 4ZQBA 2AHRA 3W79A 1W49A 3WP1B 1U99A 4MVJE 1X7YA 2WPDA 5EJ7A 1BE8A 1OFUA 5GADl 4Y7DA 1BGXT 4DWOA 2A9QA 3PXUA 1MVOA 3FCYA 4HZIA 1KJ9A 5DHSA 2CNWD 1QS0A 4H08A 4WOPA 1PW5A 2FF7A 2V65A 3VU1A 4U2BA 3GF4A 1QVVA 4M7WA 1XCOA 3R5XA 2ORWA 4HFMA 2HU8A 4S1VA 1TAUA 3MYRA 4J9UE 1LLFA 5BMVB 1TQDA 3HXLA 4CKEB 2A67A 1JZSA 2N1BA 4K5QA 4QG7A 4KIFA 1N7IA 1T9GR 1ZMXA 2I0FA 3M4JA 4NHOA 4RF3A 4GNRA 2PSJA 3PHJA 1JH9A 1KVQA 4FJ2A 5JD6A 4XFKA 4FUQA 6Q21A 3VHLB 4BFUA 1ODTC 2GK7A 3GGOA 4KR2A 1W87A 3AO0B 4AG3A 1EP2B 3NYRA 4E5VA 1NQ5A 1O6ZA 2BBOA 4GNKA 4KN6A 3EEOA 1GZSA 3C8ZA 4IV0A 4IFBA 4OAOA 1MMFB 1JHXA 3SMQA 3GLGB 1FW8A 2O2CA 4MPTA 3BT7A 4BJ1A 4JOQA 4DHWA 1DKMA 1I2CA 1WY7A 3CIFA 4DIUA 3IIEA 4WX2B 4RVHA 1YUNA 2Z6AA 1JI3A 4A8JB 4EI7A 4KVFA 2A9OA 2PVPA 2BMVA 1WHSB 1E4EB 2QZ9A 4UTRA 1E5VA 3VAAA 4GKJB 2FV8A 3NASA 1OC2A 1YZLA 4IJUA 2B8EA 5G0TA 1X77A 3RJ5A 2RH9B 1HE4A 1GAQA 2V6BA 1XEWY 1QV9A 1NE2A 4ENRA 2IYNA 2MYNA 4Q3BA 4ZDJA 2ID7A 1JBEA 2G9UA 1MB4A 1RBZA 2AXNA 4DJFC 3Q12A 1KGDA 3QVTA 1DX4A 1J8DA 5E1DA 4BTVA 1OIWA 2IYOA 4N9QA 4QPNA 1Z17A 3H4IA 2YWXA 3SZ3A 1H0RA 1YL6A 3JYOA 1ICIA 4GOKA 4INOA 1DWQA 1BXRB 2X0IA 3NBYC 4JIGA 2RHMA 5B3JC 3K5WA 5BN5B 3K72B 3ETHA 3T9FA 2UYGA 2BEUA 3T8YA 2ZAYA 4DB4A 1H65A 3JASA 1F1JA 3QE3A 4GX5A 3SLGA 4CL3A 3HUFA 3TE6A 1CF2O 3ADKA 5IX8A 1BAPA 3GJXC 2VP2A 3ZHUA 4ES6A 2EC5A 4M0MA 4RJLA 2BI8A 5LZ9A 2GXSA 3IPRA 1MZPA 3SCZA 5AXDA 3ZCRA 3I83A 1Q91A 3GJ0A 5TJHA 4TKVB 3VPAA 4C01A 2IPNA 1CQPA 2G3YA 5IM5A 4FLFA 1AJEA 3WWDA 1G1AA 2DUMA 3BSWA 1KPHA 3PNBA 5BSRA 4MUMA 1XDBA 2PRIA 2I8LA 4QRHA 1J0CA 5SY4A 2X4DA 5FFMA 3SU8A 1WDMA 5YASA 4ARBA 3ETLA 7AT1A 4F8YA 1PLJA 3EBOA 1Y9JA 3G1WA 3WQRA 4IILA 4YAGA 1PV4A 1NG9A 3RVSA 3WL8A 1GPJA 3IC5A 4MUYA 4UMVA 4X7PA 5JWHA 2EBWA 1YH3A 5NULA 5FWAA 1CUYA 2DAPA 3BWCA 5EPUA 5F78A 2OUIA 5FUBA 2QOEA 4FFMA 3V5NA 4AZSA 3AEUB 5BUCA 1FSSA 3QUBA 2H2IA 1K6JA 2AEMA 2WB2A 1E2NA 5A5VA 3AVVA 3NCTA 3L41A 1K27A 1WXGA 5UKDA 1UBUS 3H3FA 1XJ0A 4GZ6A 3M4YA 4NK5A 2B1RA 3CHYA 1RI2A 2BGMA 3TSOA 4BB5A 1UAAA 4INZA 1U3VA 3RV4A 4EFDA 4CM9A 1P9LA 4ZIRB 1JXMA 3TIXB 4IJVA 4YMWA 4R1QA 3V4FA 1C2TA 2AEJA 5CLQA 5BURA 4Y18A 4E4TA 5BXYA 1KYZA 1H1LA 2GPTA 1GPUA 4IF4A 1DQZA 2IPXA 4MS4B 4TVKA 4YA6A 3HCNA 5HGJA 2ZJ4A 4B35A 4WT7A 3QJGA 3QOWA 5JDCC 3AU9A 2OAEA 4LMPA 5J2TB 1OW3B 2YWFA 3PDHA 4RANA 4ARCA 3KYBA 2G5TA 4A6EA 4N0MA 1NJGA 4B76A 2BJVA 1JWBB 2HEIA 3WWPA 2N75A 3MWLA 4AUKA 3ENVA 4KXLA 3KETA 3N6RA 5C7IO 1UBSB 3DUFA 3TZHA 1JE1A 3M89A 3RFFA 2OHVA 1MOPA 3TECE 1TJ3A 3CPEA 4HCJA 4HYYA 2OD9A 4HDKA 1ULAA 2BPOA 4IGFA 1JTVA 2W42A 1HYBA 4M53A 2I7VA 1FNBA 3ED5A 1MORA 1N5IA 1A2BA 1D0IA 1WDKA 2CE7A 3VC3A 4HLNA 1U7XA 3UK2A 1ULBA 4J6EA 2Q1WA 4GKBA 4B7XA 1EDEA 1O9GA 3LL4A 4UCFA 3KG2A 3TK1A 3UBMA 3QU2A 3PQ3A 3AR6A 2Y1FA 3FB1A 1GV1A 2A5FA 2ZBPA 1Z4LA 3HBMA 4OUDB 4Y2GA 1XF1A 2F6RA 4PHGA 2M9MA 4HF7A 2QUIA 3FOZA 3JQRA 4IKPA 2FOIA 2OHJA 2WA1A 3G2PA 3P5BA 4TKUB 4BNKA 3KE9A 4AQ7A 1D1PA 1Q14A 5IFKA 4NJEA 1RZRD 3QTBA 3UKOA 2XYPA 4TSRA 1WMEA 5CB4F 4JZYA 3EXFB 1AY0A 1G8GA 4NYIQ 1YBVA 2NTVA 1GG9A 2G1KA 2Z9DA 4ME6A 4U7PB 3ZDEA 2HIMA 3M1YA 1B14A 2V7QA 3OWHA 1E1RA 4FK8A 4M9QA 4DUGD 2JATA 4BAZA 3R9IA 4FGZA 4TLEA 4DMCA 4ZK2A 5I8WA 3O4HA 2D5CA 3CH4B 4RPJA 1O5IA 4WOKA 2GETA 4NBWA 5AJYA 1J6UA 4C2AA 2GAJA 1SXJA 1E5TA 5DRYA 1JR6A 1QVWA 4JLMA 3LL7A 2X9NA 3F6EX 1K9VF 3GJ6A 2NTEA 4GOXA 2CVQA 3RBXA 3EVNA 1KJIA 3RSQA 3U7GA 1TCUA 1MG5A 1WDTA 3IQZA 5AOVA 4AJJA 1PF7E 2GWRA 1QOQB 1SUFA 3KT3A 1AMNA 4Y9DA 9GPBA 1ZG3A 1Z75A 3PLAE 3EDQA 1SBNE 3P26A 2CNOA 5EKUA 2X0DA 4DAEA 3GGGA 5KJEA 2VEOA 3L6CA 1HC7A 5ED0A 3DLCA 3NR2A 2SKEA 3MAJA 4D4MA 4U4AA 1OFVA 3KP1A 4E07A 3PGLA 2HFJA 3B6ZA 3F9CA 3TTVA 3DLPX 1GL9B 4FYXA 4JUFA 4CM6A 2P2NA 3U4QA 4E94A 4U02A 4MWTA 2GN2A 4L16A 4MR9A 3F1KA 3ZHXA 1RAHA 4AM8A 4B44A 1TMYA 2IEZA 2PSEA 2W37A 1OWNA 1E0JA 4WZAA 5BYKA 4M7RA 1VFNA 4AJ4A 2IW1A 5TQJA 1HETA 1ZICA 3UK1A 3UXEA 1BQ4A 2DKNA 4S3MA 3RS3A 2G7ZA 3W6UA 1XEAA 4Q1BA 3NS7A 3LG2A 4IS2A 5JXGA 1GVHA 3GN1A 4YLGA 4RYLA 1XVTA 3F6SA 4KXUA 5TE9A 4OJTA 4QTZA 5IF3A 4BNNA 4Y9RA 1DT3A 1K8RA 1NRXA 1VQ1A 3CRZA 3QWFA 4IQFA 2A0UA