1DS6A

Crystal structure of a rac-rhogdi complex
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
181
structure length
181
Chain Sequence
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLRDDKDTIEKLKEKKLAPITYPQGLALAKEIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAS-RELATED C3 BOTULINUM TOXIN SUBSTRATE 2
publication title The Rac-RhoGDI complex and the structural basis for the regulation of Rho proteins by RhoGDI.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 181
sequence length 181
ec nomenclature
pdb deposition date 2000-01-07

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1ds6A00
3GJ7A 1KI8A 1XTRA 1TTTA 3E5HA 2GCOA 2XZOA 1GNQA 4TYYA 5FUYA 1YZNA 2QTFA 2W6JD 3BIFA 4EIWA 2AXNA 2CCJA 4WA7A 4KFUA 3QKRB 1W1WA 3BB3A 2C9CA 3IHLA 4HZUA 2IYLD 4M1KA 1X1RA 3RNLA 2BIFA 3K9LA 3LBHA 3LQRA 4MKGA 4G5OA 2REOA 2W00A 4PAOA 4C0JA 1GKIA 4M53A 4QL3A 4YC7A 1JXOA 5DYIA 3R7WB 8OHMA 1NI3A 4MYHA 2A5FA 2HT1A 2A30A 3PV0A 5JEDA 2ASEA 2Z83A 4NYJR 3OIWA 3R9XA 2P6UA 3BFKA 1XTQA 1P2VA 4Q21A 2ZS9A 1DG1G 1FP7A 2Z6VA 2A3RA 1R5OA 4BEBA 4PTLA 1HTWA 1T8UA 2YC2C 1PLJA 1RRFA 1Z06A 1G3MA 1CR2A 1SQ5A 2NO9A 1CR4A 2FZ4A 1ESMA 4HLUA 4I1UA 1C4OA 1KHTA 1RKBA 2F43A 1EFRD 2JLSA 4ZCIA 3CR7A 3I1FA 1NN0A 2GAOA 5F9HA 1NP6A 4KVGA 1FL9A 3Q5DA 4DDWA 4TTQA 3K53A 2R44A 2FWRA 1KIMA 3ZVMA 1S2MA 1S8FA 1TEXA 3JZMA 1TADA 1OIVA 2X19A 4C3ZA 1EXMA 2GJAA 2WTUA 1NVXQ 4H1UA 3CM0A 2VEDA 3C14C 4NTZA 5EE1A 1N3BA 4NPHA 4HDCA 2VHUA 3ND8A 1N6IA 1WA5A 4QC2A 3UIEA 4AG6A 4CEHB 2IYVA 4H9GA 2H92A 2PCLA 1CULC 5JI3E 1HEIA 3CW2A 2V7QA 4RKEA 3W34A 3FFBA 1G1MA 4QGAA 3GLIB 1OXSC 2ZR7A 4D2IA 2EWVA 2W6JA 3B1XA 3OIVA 4B33A 3LLMA 4L15A 3M6AA 2CJWB 2ZYVX 3BGWA 3PG5A 4IJMA 4RD6A 4RD4A 2VP4A 1KI1A 1OT3A 2HJGA 3E70C 2EFGA 3JZAA 2F3RA 3O8RA 4JIMA 4NYMQ 2H5EA 3FMPB 4G5SA 4LI0A 3GJ0A 4MYTA 2WHXA 4HB0A 3FYHA 1OFHA 1KJYA 4GOKA 2WV9A 3OE7A 3IQWA 4R2IA 3HJNA 2XZLA 1IJEA 2IYUA 5HCNA 1VHLA 1G3QA 3GLHB 3B82A 2ANBA 2IBMA 3ZLJA 1OB2A 3CKLA 2ZRHA 3CNOA 3WBKA 3VHXA 1II0A 5FFMA 1XCPA 3TIFA 4C9BA 4URZR 1G6OA 2WKQA 1YKSA 2CNWA 3QENA 1HQYE 5K8TA 3GPLA 1OSNA 3CX8A 2GVZC 2Q3MA 4TLEA 4HDQB 4LYFA 2VL7A 1KO5A 3CZPA 2H18A 2FNAA 1FQJA 3I62A 2DFNA 4DT1A 4XOIA 2G9NA 5FOWA 4CGZA 4C2UA 1WBDA 1NSFA 4JJKA 4C4PA 1NN3A 4K81B 1B23P 5BYJA 2XGJA 4XSGA 2GZAA 1XMIA 1S96A 4Q1EA 3AF3A 4Z1MD 1N5LA 5TY0A 3TQCA 3X1YA 2OUKA 1G291 3K0CC 1BOFA 2OAP1 4OI4A 3R20A 4DLYA 5AUPB 3NBXX 2AD1A 4B3FX 1EESA 2W6IA 3PVSA 1KI6B 3B5JA 1YZLA 4LJAA 3WYFA 4KCGA 3TW4A 3DL0A 3U3RA 2NO0A 1OXUA 3REFA 4D0NA 5JECA 4KHZA 3VAAA 4PX9A 1T5IA 4A8JA 3SS8A 1LW7A 3FDIA 4NYMR 2OCYC 1M1YE 1YR6A 3AVQA 2X2FA 1GFIA 1B0UA 1VG8A 4OQNA 3THXB 2Q3FA 4C0SA 1A2BA 3P20A 1KNQA 3DOFA 4JSYA 4CZ2A 1AKEA 3QIAA 3EZ7A 5DSZA 1NL3A 3NH9A 2B6HA 3I5YA 3EPKA 2B8TA 1CJMA 1E2EA 1LY1A 2IC5A 3BJIC 3SJZA 1NY6A 4B47A 2FSGA 4BUJA 5JWRA 4CEIB 2R6FA 1BH2A 4V0LA 3C5HA 3K0CA 4IEEA 3QG5A 4EJSA 2ZAOA 2H7VA 1J90A 4B76A 1Z6TA 2X8AA 1W4CA 4RD0A 1FQKA 4OQFA 1RRCA 2BM1A 2VP9A 3QBTA 4I1OA 2V55B 4R9UC 1W0KD 3BC1A 1D8TA 4Q48A 1E0KA 2P5TB 5FI0B 1XEXB 4FIDA 3D8BA 1QG2A 2D74A 1RE0A 5FPSA 4PQRA 2IS4A 2WJIA 3AVXA 2QAGB 3FHCB 3WBJA 4ZIRB 4LOAA 1QHYA 2SHKA 2ZETA 4MGKR 3LBNA 1W0JA 5HCIA 4B48A 2HF8A 2O8DA 2XXAA 2G0TA 1W4BA 2DBYA 5EZ5A 4M9QA 4HAVA 1WQ1R 2ZR0A 4PHTA 4TLAA 3L0PA 4C0AC 4W9MC 1VKJA 2BCJQ 4DLZA 1DAMA 4UKDA 3RS3A 3EZ2A 3FTQA 4Q19A 2JJ2A 2RGEA 1E69A 2QBYB 1DS6A 1PUJA 4BLSA 2E87A 1CRQA 4OQLA 4Q03A 2PL3A 1W47A 2VP0A 1IQPA 3H1TA 5HTKA 5L3RA 3ZVNA 4RZ2A 1MV5A 4JMPA 4LBVA 1E98A 3EA5A 1OLOA 3BFXA 1Z6GA 5DLQC 1R8QA 4LHVA 1OJLA 2C78A 4JLDA 1G6HA 4IDHA 3IGFA 4RKFA 4OJQA 2ZRFA 3K0FA 4LBYA 5FTJA 1OB5A 2RHDA 1I2DA 2FJUA 1CR1A 1DVRA 1KI7A 3NTUA 4A9AA 3GP8A 3AF4A 3I8XA 2OHFA 5GVRA 2YVUA 3HP1A 4MDFA 1LTQA 3WNBA 3A4LA 4OHVA 5HR5A 4NU0A 4Y0AA 4HB3A 2GJSA 3IILA 5FTLA 1E9SA 1XZQA 2CCGA 4NYIQ 5DH9A 1KKMA 3KKPA 1W7AA 4UJ3A 5CK5A 4JVMA 4P4TA 3FHTA 2PEYA 2ZS7A 3LV8A 3WY9A 4CT4B 1YZUA 2WWGA 4NYIR 1II8B 2QORA 1UDXA 1WP9A 1LS1A 3SN6A 2ZAMA 2BDTA 4DDVA 4FMBB 3SYNA 3TR5A 3ZZ0A 3LXRA 3PEWA 2YC4C 3GLHE 4Q7LA 4LWZA 4JLNA 1ZUHA 2ZE6A 2HYIC 1UM8A 5AUOB 4ASUD 1OE0A 1V5WA 2QI9C 3Q7PA 4BFTA 2QRNA 1NMXA 4U02A 1FUUA 1DO0A 1ZM4A 3IKJA 2MSDB 1TQ6A 1Z29A 2IYZA 1XXHE 2CNWD 2QNRA 3GFPA 5AJZA 1RJ9B 1HE1C 2FA9A 4PC1A 5C2JB 3AP3A 1P7CA 3AH8A 3ZZTA 2PJRA 3NWJA 5DIFA 4IKEA 1GNRA 1KSHA 2HUPA 4HDOB 1QF9A 1X86B 2RH5A 4LYAA 4ZDIA 3PJRA 4QFMA 1PVOA 4GBMA 5JI2E 5HZHA 2OFOA 1M7BA 2ZANA 1HT2E 4Q66C 2ODNA 3WMFA 3ZS9A 5JEEA 3EPLA 4A92A 2PH1A 3WHLA 2P5SA 2YOHA 1NN5A 1YQTA 3N5CA 3NEYA 221PA 1KK0A 5HKKD 1KI6A 3T5DA 3U6BA 1G18A 3EC1A 3FHOA 4JYBA 1UADA 4AWXA 3H84A 3FOZA 2FPMA 3CB4A 2BJWA 3BWDD 4TMXA 3OEHD 1R6BX 3AP2A 1AM4D 2ZRGA 4B44A 3O8BA 1GUAA 4AKIA 1SKQA 1KNXA 2A5YB 2ZRNA 4MGZR 4QBGB 4ZKDA 4HAXA 2J9RA 1UFQA 4LBZA 4M1WA 3V4FA 2FG5A 3VR4A 4B2IA 4TL9A 4F4JA 5EZ6B 2GF0A 3BS4A 3UK6A 3GFOA 1AJEA 2AR7A 1AQYA 2FFBA 5E7IA 2ZI4A 2WICA 5BYKA 3G0HA 3DM9B 1KMHB 2QUZA 5B30A 4LHYA 2QT1A 3N70A 3NHBA 5SZHB 4JT4A 2W83A 2XX3A 2Z0MA 1R0ZA 3BH6A 3VNUA 1RC8A 1U8YA 5CB6A 3NH6A 3ZVLA 2KBEA 1SGWA 1XRJA 1Y3AA 4ZCLA 3U44A 2QN6A 2WJGA 3MFYA 4PZYA 1Z83A 3GLIE 2O52A 2Y8EA 4GI7A 4DLSA 2GRJA 2QP4A 2JEOA 1W36D 2D06A 4AC9A 3BRWD 3QKRA 1ZC4A 5EE9A 3SR0A 2Q9AA 3MWLA 1P62B 4TL7A 5C1BA 5LB2A 1J8MF 5JS7A 1AS0A 2CL6X 2GILA 1CBUA 2GXUA 1ONBA 2BOVA 3PCRB 3QQ5A 3VQTA 5LD2B 2EFHB 4I99A 1XEFA 2OBMA 4RD2A 2BBOA 2FOLA 2YINC 1OHHD 2RGDA 1ZJ6A 2FMXA 5CLLA 2VF8A 2QM8A 1NG9A 1TUEA 3C16C 5BN4A 2CHVA 2PCJA 3M1IA 3U6KA 5L3SB 3CPJB 4HI0E 2QG6A 3TUZC 5JBQA 1E2NA 5EE0A 1N5KA 2R6CA 1T6NA 1Z63A 1T0JB 1W4AA 3HR8A 1COWA 4P32A 2C2HA 2ZUCA 5FPYA 4AYWA 1VG9B 4HSEA 4QHTA 1NIJA 4BQSA 2CBZA 1DEKA 2J87A 2J7PA 1HQCA 1CLUA 1FTNA 3TSWA 1XEWX 1H8HA 2IS2A 2NO6A 2WSSD 3NDBB 4XTCS 2HXYA 3B6EA 3LAWA 3U3OA 1SULA 4AIIA 4TYQA 4PR0A 4DLVA 5KNDA 3V00A 1EWQA 2GZDA 5F2EA 5FPHA 2NMVA 1QRAA 4GL2A 2F1JA 5E4FA 3D7MA 4DSUA 3PITA 4KLZA 4QXAA 4E22A 3UXMA 1NJFA 2JLZA 1P3JA 4L9SA 3LVQE 2JLVA 4Q18A 2UKDA 3F0TA 2F9MA 2W2TA 2ZIAA 1ZIOA 3M4YA 3U3KA 3WP0A 2AD5A 1VIYA 4KSCA 4MRNA 2FE4A 4P3YA 4DLUA 4XH9B 5EE3A 5GJBA 2X2EA 1FNNA 5EXXA 4WW0A 1FMJA 3K1JA 4F7WA 1UEJA 1H8EA 1LB1B 4TZ0A 1Z0FA 3IEUA 4O2RA 2ZJAA 4YMWA 4JL6A 2XTZA 1E2DA 1FUKA 1SVOA 4WXRA 3FKSD 3SNHA 1DAEA 2JLYA 1D2NA 1GSIA 4AURA 1D5CA 1CIPA 4M8NE 3GQBA 4MH0R 2C5LA 2RGXA 3VKWA 3V9PA 5SZJA 2ECKA 2FSIA 1JECA 2Z4RA 1QHHA 5JHGB 4QHYA 4QM7A 3ADBA 5FBRB 1NVVR 1K6MA 3CWZA 2LKDA 1FX0B 4AD8A 4RCYA 1AS2A 3AKCA 3UMRA 3T1TA 3VFDA 5J40A 3ICEA 3RRNA 1R5BA 2VRWA 2ZJBA 4NCJA 4BASA 3ETLA 4HLDA 1YHNA 1SVMA 4A0GA 2G83A 1ODFA 5JCZA 4LCBA 1YRAA 1H65A 4TL8A 3QPVA 4URVR 2XB4A 4A0FA 4ESVA 2ZE7A 1TNDA 4PPFA 4NH0A 3UG7A 4DCVA 5FBQB 3L8ZA 2YYZA 1ZM7A 1TF5A 4WIAA 1CEEA 1MKYA 3HR7A 4BLRA 1KO1A 3X1ZA 1UF9A 4PSVA 4TYNA 2ZRIA 4MKHA 4D25A 3CO5A 1DE0A 2DPXA 2ZVPX 4XD7D 1XXHB 2O0HA 4P0TA 4LHZA 3ZVRA 2PLRA 2P65A 2QT0A 2GEUA 5TXGA 4ARZB 4ZV4A 1G21E 3SU8A 5DI9A 2IWRA 2WWYA 4DSOA 3RRMA 2GVDC 5TMPA 2V9PA 2NZ8A 2VSOA 2VSFA 2WMOB 2FX3A 3BK7A 3AUYA 3RYTC 3EPHA 1UKYA 4TMZA 1Q21A 2DR3A 2FFAA 5C4MA 1KK2A 1Z07A 1NKTA 4JYCA 3AGQA 3A1SA 4NP6A 3VMFA 5KDLA 3SC3A 3QF4B 4BFZA 4S2EA 4RFSA 4G5RA 1YRBA 4Q1CA 1JJVA 3CIOA 1VPLA 2OSBA 4CEHA 4QJ5A 1A2KC 4RVCA 4JLVA 4M1YA 3L8YA 1FNMA 1OKKA 5J5CA 2D7DA 4IW3B 5FPTA 1SVLA 3IDQA 1CJTC 1E9DA 2NPIA 2FEMA 4ABYA 3AP1A 3I3SR 4M4SA 1IN8A 5FR1A 2QSZA 3H2YA 2IL1A 1XCMA 3LRPA 1GM5A 3Q7QA 2V3CC 2O8CB 4NBSA 3GLFA 1NRJB 1GZSA 3THOA 1DARA 4M21A 4DZZA 2C98A 1D9ZA 2V6JA 1CU1A 1KDOA 2BKUA 3SYKA 3T1VA 3KUCA 4NONA 4Q02A 4G5GA 1KI9A 1SXJB 1XPUA 1TF2A 2WIBA 3U2QA 1OV4A 2B8WA 4QGGA 2QE7D 1KJZA 4IRUB 1O87A 1DADA 4LJ6A 1Z6AA 3PUWA 4PFSA 3CNNA 2QL6A 2I1QA 1TQ2A 2JLRA 3MLEA 3SQWA 5FOVA 1E9EA 2NOAA 4IVPA 3A1WA 4EPTA 2ORIA 3ZDQA 2W0SA 3GEHA 2NO7A 2G0NA 3L82B 4DLWA 5JSZA 4O3MA 1AGRA 3P4XA 4JBYA 5JSZB 1XD2B 4C7OB 3EZ9A 1F2TB 4B2PA 2R9VA 4DDTA 2VIIA 1U81A 3UWKA 2FZLA 4FW9A 4XVUA 5AJVB 4MKFA 4Q1FA 4W5WA 5JMTA 1CJKC 1RJ9A 3QF7A 1IBRA 4TMWA 4MRPA 2F1IA 2G1KA 1WRBA 5KYKA 3TNFA 2F6RA 3I4LA 3WYAA 3ADDA 1GOTA 2OXRA 2ZRDA 4I81A 3LXXA 4BLOA 3FE2A 4UXJA 1I4DD 1GNPA 1W5SA 1OFUX 1X1SA 1JAIA 3TRFA 2DFTA 4MITA 4UXIA 4RZUA 3MGCA 4JT2A 2P6RA 1Z0IA 3IPXA 4US2R 2OG2A 2IYWA 5JJKA 2XITA 2EW1A 3QEOA 1GWNA 1OKKD 621PA 3KXKA 5J4VA 1ZNZA 2J0UA 121PA 5J4YA 1XTJA 1X8KA 3K8YA 5DHAA 1S0UA 5EXSA 2XZPA 4JKYA 2QQ0A 5J4KA 4A6XA 3P1JA 4ZDWA 2IS1A 2ZRAA 4IVRA 1EFUA 3K9NA 1CXZA 3QOFA 3JVVA 3PQCA 1M8PA 3OEED 4GMXA 1JR6A 2ODBA 1ZU4A 1OPXA 4GNKA 4Q9JA 5CJPA 1CTQA 1WMSA 2BHRA 4AG5A 2BMFA 2RGBA 3DMDA 2EFDB 3DEFA 1YE8A 3RAPR 4DKXA 3D3QA 3B60A 3TQFA 2PZFA 3FMOB 2J7KA 3W6NA 3X1DA 4CYMA 1TQ4A 2IYSA 1BO6A 3KQKA 1SZPA 4V0OA 4EJSB 1P61B 1LVGA 3EW9A 4YDHB 3K70C 1TUIA 2CCKA 3Q5EA 3BXZA 3K70D 2PEZA 4C7OA 3U7HB 3E2IA 3H4MA 4PC6A 1PLLA 2WPDD 4M9SA 5C18A 4QG7A 2ZYUX 5JZVA 5AK0A 5K8IA 1FW6A 2ZUBA 2IK8A 1A1VA 1S1MA 2E1RA 1D9XA 3KZ1E 1VCOA 3I61A 2ZITA 3AB3A 4EPWA 3CF0A 3Q72A 2GJ8A 3QBVA 4G5QA 4II7A 1KI2A 4IDOA 3I73A 1ZINA 4QNRA 4R7ZA 2MMCA 2PLFA 4Z51A 4MRRA 1H8HD 2J59A 1QBKC 3KX2A 4BFVA 4D80A 5L8VA 4B2LA 5M04A 2RGNA 4F4CA 2KJQA 1G7SA 3SI7A 3U7GA 1DAHA 1LF5A 3SQXA 1Y63A 2DB3A 5GJVC 1OXVA 1N0UA 2FN4A 4LY6A 1QVRA 2DFLA 5EP4A 2A5GA 3LW7A 1GDDA 4IXNA 4LZZA 5E95A 3QXSA 3PEVA 2W6ID 4YDSA 1TF7A 4DB2A 3F5FA 5DISB 4DUGD 1E9RA 2ATVA 4B3CA 4URXR 3LX5A 3O8DA 2FF7A 5CYPA 3UATA 5H70A 4PXAA 4D4MA 1YZKA 3CONA 2ZRPA 5E7MA 4EPXA 5FOUA 1ANKA 2C99A 4C0HA 2HYDA 4UNQA 4Q4HB 4Q4AB 2GZHA 1XF9A 1II8A 2O0JA 4B73A 1UKVY 4ILEA 1UEIA 2MSCB 5FBVB 1KO8A 1P9NA 4TN1A 4K46A 2BWJA 4B3XA 3TVDA 3T1OA 4A2WA 4BFWA 3B85A 3QSYA 1SHZA 3OZXA 5F9FA 4DCNA 3OF5A 5KTYA 4JLKA 4JLJA 1SXJE 1IXRC 3EIHA 1E0SA 2DY1A 2GA8A 4KXFB 4TZ6A 1G8FA 1YU9A 4D4JA 4JJZA 1C1YA 2OM2A 1E2QA 1EFTA 1W46A 1N6OA 1FPMA 3ZD6A 2JIZD 1Q1ZA 3KXLA 1E1RD 1G5PA 1ZNWA 5SZIA 5FR2A 2XJ9A 1HH4A 1ZM9A 1N0VC 1NSTA 4PC2A 3C8UA 2FDCA 4ON9A 2FV8A 4OK3A 4G1UC 2HXSA 4EAQA 4YMUA 3P32A 4E09A 1E79D 1NBMD 1VIAA 4FWIB 4D81A 5FTMA 3ZQ6A 4LUCA 4QBHA 5EUQB 4LJ4A 3HYTA 4HLUC 5CB8A 4C0BA 5BN3A 2ZYTX 3F3YA 3KKQA 2KSQA 1A4RA 3PR1A 4Q1DA 4P4SB 3RANA 1S1CA 3TK1A 1AZSC 4XWAA 3CX6A 2CK3D 4BRUA 4PC3A 2BMJA 4KU4A 1ZVQA 1JPNA 1T0HB 4AKHA 3PIRA 1QHIA 3B1WA 2PT5A 6Q21A 1R0YA 3N2EA 2R62A 4GP7A 4D26A 1R10A 1VCNA 5FH9A 3L2OB 2F55A 2WWHA 2MMGA 1Z6YA 4K8OA 2JLWA 4MRVA 4IDQA 2A9KA 4B34A 4YMTA 1XD9A 1QDEA 2AN9A 2DCUA 3B13B 4IDPA 3PXGA 4NKRA 1ZUNB 1R4AA 1XMSA 2B92A 2KWIA 3BE4A 2ORWA 4A1FA 5HPYB 5EP3A 4BZQA 1UKZA 3IIMA 2HV8A 4BFSA 1KSJA 1E0AA 1U0HC 1G7TA 2ZE5A 2AFHE 3X1XA 4BRWA 1UBEA 1G5RA 5AWFC 3LWNA 4CDGA 4FCWA 2FSFA 2QY9A 5DI3B 1QHGA 3JVUA 1E94E 3THWB 1U99A 5DYGA 4JVSB 1ELOA 2FFHA 4C30A 3EIEA 1KO4A 3GJ6A 3I92A 3ZS8A 3W5JA 4Q7JB 4FWTA 1TPZA 3OE7D 2HT6A 4Q4JB 3TLXA 3GEIA 1TEVA 2ATXA 2CE7A 5HE8A 2ZI9A 2Q3HA 3P27A 4KSBA 4E03A 3RC3A 5G3ZA 3GLFB 2VHTA 3GCGA 1ZUIA 1Z28A 3U60B 1Z2CA 2RAPA 2ODEA 3DPUA 4LPSA 1E9CA 1Z3IX 1ZMXA 5J4HA 2CDNA 4JL5A 1EFHA 3KFXA 4D0LB 1PJRA 3NBYC 3X2SA 1W5TA 3FMIA 4X8OA 3NG1A 3GD7A 4JL8A 3NKVA 4R98A 2XSZD 2HCBA 4EPYA 3Q8XB 4NYJQ 2ZSDA 1U9IC 2KI5A 2CK3A 1N5IA 5KDOA 1CR0A 1MOZA 3KKMA 1CRPA 2XNDA 1AIPA 1E4YA 4DSNA 5JHHB 2W2XA 2CLDX 3DZDA 3KB2A 4DCTA 1IY1A 2JIZA 2NGRA 3QXHA 1IN6A 1SVKA 4RJLA 4DSTA 2PZGA 2H16A 2O8EA 1DAFA 3AVOA 1AS3A 3KDSE 2O8EB 5CM8B 2F43B 4PO8A 3EZ6A 1XTSA 3ECCA 4ZDKA 1SKYE 4TYWA 2F3TA 1Z47A 2JA1A 1MRNA 2IEYA 4JLPA 3EAQA 1MH1A 5JJLA 4I1SA 1NMYA 1VCMA 1HYQA 3P4YA 3PUXA 4HUQB 5AR1A 4JLOA 4TMTA 4NCIA 2QSYA 3K09C 4O25A 1N0WA 1G7RA 3U5ZB 1JR3E 1E2GA 2YOFA 5CIWA 1N6HA 1SXJC 1XWIA 3TBKA 5G40A 2V1XA 3HU2A 1AQUA 2QEQA 3NEJA 3KFVA 3ASZA 4QJ4A 2Q21A 1E3MA 2VA8A 5JCPA 2YOGA 2XB2A 2D62A 2W58A 3AKYA 4CW7A 3ADCA 2GAAA 3PEYA 1ESNA 2BBSA 4POAA 1XD8A 2IXGA 2JJ1D 3T5GA 1LNZA 3RLFA 1WCV1 4MUAA 4ERNA 4TTPA 1TU3A 2NPFA 3L0OA 1AN0A 3MG9A 4DIEA 4ZIRA 2PBRA 4MUBA 3KL4A 3C7KA 3A8TA 1VDZA 1KY2A 4M22A 2IHYA 1IOZA 2V1UA 1I4LD 4C2TA 3SZRA 3K70B 1F2UA 5TDHA 3DVLA 4LJ5A 4L5BA 3ZH9B 3K09A 1GL6A 3KJHA 1KDTA 5FUVA 1A82A 4OHWA 3VNVA 3CH5A 2HF9A 3IO3A 3W3ZB 1DPFA 1N25A 2IYQA 4N3NA 1U8ZA 1G64A 2LCFA 2HLDA 4KYUA 1YR8A 3TAHA 2FEOA 3CR8A 2CL7X 3CLVA 4S35A 1F60A 2V54A 3IHWA 4TQAA 4D4LA 1DO2A 3MRSA 1XEXA 1NNEA 1V43A 4EFMA 4JBWA 4TYPA 4MQBA 1E4VA 2NIPA 4BFXA 5TB5A 2C04A 1VYVA 2EFCB 4GP6A 4LYHA 3SFVA 1NN1A 2PZEA 3D6TB 4BLTA 1E1QA 3QKSA 2AKAB 4FINA 1TU4A 2VHJA 5DN6D 2BV3A 1HE8B 2ZJYA 2C95A 2CHQA 4PSAA 2QMOA 2WSSA 2BEKA 4YONB 4QKQA 2OCBA 2UZIR 4QNMA 5IK2D 3K9HA 2N1BA 4LV5B 4DC9A 4A2QA 3REGA 5KSPA 4M0LA 4BZPA 2AFIE 3C41J 4L4UA 4ZDJA 1ZD1A 2C96A 1L2TA 3KJIA 2ZROA 3THWA 4NZYA 3E1SA 1UPTA 4B74A 1BMFA 1ZM3A 2XEXA 3GMTA 4TT3A 1JR3D 3AUXA 4EFNA 4G01B 4FMCF 1ZCAA 4BLQA 3AVVA 3AVWA 2GESA 2XNSA 3BORA 2N42A 5AJXA 2O8FA 3AVPA 2RMKA 3GLIA 5EXTA 4QBFA 2G1JA 4V0ME 1W0KA 4M1TA 4QGFA 4R71A 2F1HA 1M2OB 1L8QA 2ZE8A 4JKIA 1OIXA 4YQFA 2P6NA 4FCTA 1G19A 1US8B 2GTPA 1NBME 1PUIA 2DFKB 1HY3A 1X3SA 1IN5A 3R7WA 3GJXC 2WJVA 2Q9CA 3ONWA 5EUMA 2A7QA 1XPRA 2YV5A 4P4UA 5IRCD 1XMJA 1IONA 1XBTA 3QNUA 1UBFA 2J45A 5KNBA 3OIUA 4RD1A 3S1AB 3T12A 4HAYA 4W5JA 2H8KA 4LV8B 2B21A 2KB0A 2GJKA 3PFIA 5TVKA 3QKTA 4U7DA 3U3MA 2ERYA 3OFNA 1TL7C 2Z4SA 1O3YA 2WWXA 3AF2A 3BFVA 3WHKA 3THYA 4YXWA 3W8RA 1GAJA 1NBMA 2GK7A 5JRZA 1XEWY 4HAWA 4XWOA 2OLJA 2QAGA 2B7CA 3NC0C 5FOTA 2RCNA 1YZTA 2DHRA 2JLQA 4BE7B 1SKYB 4FN5A 4Q7KA 4IOJA 2XNDD 1Q1QA 1Q12A 2EQBA 2OFWA 2ZU0C 3QJYA 4JLBA 4ZO4A 3T06B 1XPOA 1SHKA 4US1R 1T3SA 4JVLA 1GTVA 4LK2A 2ZSFA 4B32A 1NIPA 1NG1A 1C9KA 3SJCA 2BEJA 3A1TA 1X6VA 2I4IA 4OHZA 1EX7A 3U7EB 4HEJA 3CWQA 2NTYC 2VF7A 3LW8A 2Q9BA 1XU4A 2ZRMA 1WXQA 4M1SA 3ICQB 3RDPA 4AYXA 1KKLA 3ADKA 1KZ7B 3EG5A 4NCHA 5FPKA 1FTSA 1KYIA 5BW8A 3VX4A 821PA 5AJYA 3W3AA 1OYWA 2JJ1A 3QEJA 1G8PA 3R8CA 2J0QA 4KFSA 3FWYA 1G3IA 4WOPA 1ZYUA 2QMHA 3FGNA 4KBGA 3AVUA 1GKUB 2F9LA 3RSOA 3GLFE 2PX0A 4Q9LA 4OHYA 2AL7A 2YWHA 3B1VA 2CL0X 4ACAA 4XJXA 1XJCA 1FOEB 3SE0A 1DELA 3X1WA 4CEIA 1E2FA 1HUQA 1E2KA 1LV7A 2VTKA 3F8TA 1GILA 1Z22A 4TMKA 5BQ5A 3W90A 2BM0A 4GOJA 4IVQA 1ZD8A 4LHXA 1DBSA 2RGNC 1KI4A 1VECA 2QAJA 2J5XA 4DWJA 1J99A 3CRW1 4LHWA 2OAQ1 1XJ0A 2C9YA 2VP2A 3WRYC 2J41A 1ZD9A 4UNRA 1WBBA 1J8YF 2P3SA 3DZ8A 3Q85A 1BYUA 2QE7A 4OI2A 4LC1A 1XD2A 2BKEA 4AKEA 5AJWA 1Q3HA 2ZS8A 2ZSEA 4BGDA 3NXSA 3A4NA 2IWHA 2XXAB 2RHMA 1AGPA 5FTKA 2HLDD 2QMUA 3EXAA 3WXMA 5H8WA 1NMZA 1W2GA 1GP2A 1TQDA 3BH7A 4FI3C 2B7BA 4V0KA 5DN6A 3SJAA 1KOFA 4NDZA 2BCGY 2QTVB 1UBCA 1MO3A 2EYUA 2GKSA 5CLQA 1E9AA 2OCPA 3DKPA 1P9RA 4DVGA 2HCJB 1R5NA 2BJVA 1BKDR 1E2PA 4JBXA 4DIDA 2QBYA 1VCIA 3GJ4A 1ZW6A 1GIAA 2NQ2C 1RPZA 3B8HA 1YVDA 3CRQA 3A58B 4V02A 5C46F 1NLZA 1X8JA 1JR3A 4A6PA 2ZI5A 2OO7A 1Z0KA 2PJZA 2D7CA 1UDWA 2P67A 5FOXA 3FKQA 2DWQA 3WP1B 1RW4A 1P2TA 1XXHA 1VHTA 4PC7A 3ZZUA 1KGDA 2CJWA 3NHAA 4H1VA 4Q9KA 3TVTA 1JEDA 4DRZA 3KJGA 521PA 1E2LA 3IEVA 4BLPA 1N5JA 4HAZA 3VX3A 1H8ED 3QXJA 2J1LA 5GJWC 2R6DA 4B75A 5L3QB 4GT1A 4HUQA 3W8NA 1GRQA 4EPRA 4LRWA 4Q4HA 4Q4AA 4E5UA 4QJ3A 3CNLA 2ZI6A 1PV4A 4WZBE 2A5DA 3KJEA 2OZEA 1JXMA 3FKSA 4CEJA 3I5XA 2WJHA 2QGNA 3KQUA 1MABA 4QRHA 2AX4A 1ZCBA 4TL6A 1OFIA 3BB1A 4X8MA 2V6IA 2WBLC 2Z43A 2J0VA 1LF0A 2VHQA 3AF1A 2YNMA 3I32A 4PZZA 3SBEA 4PO9A 4AI6A 3ZIAD 3LX8A 4GDFA 1CP2A 2FH5B 3U3JA 3SJBA 1M7GA 4KV9A 2R2AA 2W2VA 1P2SA 1KAOA 1WDTA 1J7KA 1Z8FA 1DOAA 4DDUA 3LVRE 2PMKA 3AQ4A 3H86A 3T61A 1S9HA 2TMKA 2RKOA 4B3DA 1M34E 4FCVA 1FFHA 4CVNA 1R8SA 3GJ3A 5JWHA 5KSYA 1CJVC 3TAUA 5AUNB 4GRAA 3L0IB 2BBTA 1IM2A 2I1VB 4GPTA 3DM5A 3AKEA 1OFTA 4L9WA 2QPTA 1F2UB 5FL7A 1W4RA 1FX0A 1TMKA 2LWIA 3T15A 3UKDA 1MO5A 2QU8A 3U4QB 4LYJA 3QVUA 4OQMA 1U98A 4YXWD 5B57C 2N46A 4URUR 1GRNA 2WAXA 3C15C 3WRXC 3LO5A 3W6PA 1T3LA 3OFND 3ZGXA 4B43A 1JEEA 1E79A 2KE5A 2GXSA 1U0JA 3DOEA 3GLGA 1IN4A 3MJRA 1W36C 3OESA 1CKEA 1XP8A 3A6PC 4BZXA 2VBCA 1KDPA 1G9XA 1QHSA 4A0HA 1MO6A 1VMAA 1RYFA 4NCNA 2AKYA 3MUFA 4EKDA 5B64A 1YZGA 4OKSA 2IF0A 3TJZA 2JLXA 1J70A 2C9OA 2VSXA 1IHUA 5IHPA 3MWJA 3IIJA 2ZJZA 4QHSA 3CZQA 2R65A 5L3QA 3QXCA 5FBLB 2ZREA 2IW3A 1TX4B 3QE0A 4IXMA 2X77A 2HJVA 3IPYA 1BMFD 1U94A 1T8TA 1W49A 2R8RA 4Q4LA 3UWOA 4CF7A 1DG3A 1EGAA 1EX6A 5CYOA 4FMDF 4RZXA 1KMHA 2ZVQX 3TUIC 4XTRA 4KI0A 2R6GA 3RS7A 2FGJA 3B7GA 1KDRA 1G3RA 1ZU5A 2QENA 1FZQA 3B9PA 3EIQA 3PENA 2OEPA 1UJ2A 4KJZA 4PO1A 4F38A 4KBFA 1G8HA 4FMCB 2JDID 1Z0DA 4MRSA 5D3QA 1LFDB 1Q1EA 1L7VC 2OFXA 1PLKA 1ZBDA 1LS6A 3RHFA 5EP2A 3I8SA 3N2IA 1G8YA 3RRZA 4BEJA 5KPDA 3A37A 4KODA 2XJ4A 4PQFA 2J46A 3SOPA 4XWKA 1XTKA 3C4JA 3MD0A 3BB4A 3HDTA 4DLXA 4HATA 3VR2A 2O8DB 1RRPA 1NKSA 1GRRA 1P9WA 4NL4H 1MO4A 2VYFA 2Q6TA 5FL7D 3TE6A 4QGHA 3UG6A 3VTKA 2RGCA 1OH5A 2QP9X 3WYGA 3VU9A 2ZI7A 2GK6A 3HPQA 2BVNA 5K8LA 3U4QA 1SXJA 1WE2A 2NO1A 4PQYA 1P6XA 3LQQA 4XSHA 3RS4A 2ORVA 2ZQ5A 3VKHA 1XX6A 5GADl 3DKVA 4MGYR 5EJEA 1UAAA 2GETA 1M74A 4XIGS 4JVNA 4BFUA 1SVWA 4A2PA 1OF1A 5DHFA 4Z54A 1U2RA 3I72A 2VP5A 3MCAA 1S9DA 1NLYA 3OEHA 1Q0UA 1ZRHA 2EVWX 1HT1E 1UBGA 2O8BA 2JJ2D 3L43A 4IOMA 5FBWB 4QOSA 3QI2A 5CJ2A 3NC1C 4BWYA 1VG0B 3GJ5A 1N6PA 1WF3A 2V4ZA 3U7FB 3Q9LA 3SFZA 4Q1BA 5KOYA 3T1QA 4LDJA 2XTNA 4DEYA 4A36A 3CX7A 4PHHA 5KNCA 1T4GA 3O47A 2FPLA 4GSYA 4Q9IA 2WKPA 4DHEA 4FMDB 3AVYA 1VTKA 2P2LA 5LBIA 5IDVA 4KITB 1CS4C 4OK5A 2ZJ5A 5BN5A 3OEEA 3NIBA 4V0NA 1FP6A 1OYYA 1N6KA 3UANA 1AZTA 2GCNA 5CM9C 4LGMA 2ZJOA 5JWOA 3G82C 3TW8B 5DGXA 1R7RA 4F93B 4L16A 2GF9A 2EYQA 3BAFA 1XFAA 4G0NA 2UZ3A 1R2QA 1KZGB 2ZI3A 2RGAA 5E3HA 1E9FA 1JAHA 4N0DA 2BMDA 3ZJYA 2CMKA 4LC0A 3CUEF 1E2JA 4ASUA 4OJKA 4A8JB 1JJ7A 2GJ9A 2ZU6A 2GEDA 1BIFA 4M2LA 2QP3A 3VR5A 3P26A 3W6OA 1G7CA 4Z8YA 5FOSA 1XNJA 4DCSA 2JLUA 2WPDA 1RRGA 2DWPA 4DB4A 5GVSA 5KDDA 2C77A 4EUNA 4CRWB 1A5TA 1J2JA 4PHFA 4WXPA 2G88A 3HYRA 3NDPA 2ZR9A 4PZLA 1NF3A 4MYCA 5JRJA 4OK6A 2WZQA 4DLRA 1X8LA 3FFAA 4GOXA 1KK1A 4ACBA 3AVTA 1COWD 4XVQA 2BC9A 5CITA 4DBLC 2YKGA 4OI1A 4PPQA 2JGNA 4PPNA 4V03A 2ZJ8A 4DJTA 2IS6A 1YJ5A 2IHBA 5B2ZA 1Q22A 1IY2A 3SHFA 3OAAA 4UXHA 2JAQA 3NBFA 2C03A 4GMDA 4EFLA 2MSEB 5KUTA 1M6NA 3HPRA 2QMEA 2OESA 3QKSB 5HE9A 1XZPA 4Z1MA 1ZNYA 3DO6A 1ZC3A 1E2IA 2A5JA 2WAYA 4L8GA 2GEVA 4LJ9A 2DYKA 4P31A 3TMKA 4KAXA 3HU3A 4KFTA 2GXAA 4TQUS 2RGGA 4TQ9A 4IEIA 5SZKB 2HDNB 4NHOA 4M1MA 2IT1A 3V4RA 3HWSA 3M0EA 4RSGA 4BPBA 2QM7A 1N6LA 1KJWA 1XB2A 3LH5A 4NMMA 1ZAKA 2WIAA 4P4SA 3GFTA 2IYTA 4TTRA 2QGZA 1XTIA 2AWNA 4N1AA 2ZPTX 3R9WA 4KVAA 2GXQA 1RFLA 4W7SA 3KB1A 3MSXA 2BBWA 3G5UA 1QG4A 4EQ6A 1Q1BA 3ZYCA 4B35A 3TSOA 3CH4B 5KSZA 2REXB 2WJYA 3LD9A 1F3OA 4TLDA 1P5ZB 4Q4JA 2AWOA 3PEUA 1YZQA 3KKOA 3WMEA 4XVRA 4HZIA 5K8UA 2V7QD 1E96A 2RB4A 4A4DA 4PANA 3WNCA 3KTAB 2FGKA 4YMSA 4B3GA 1QHHB 2QTHA 3A1UA 3CRVA 4NE2A 4U5XA 4Q7MB 4A15A 2ZTSA 2ODWA 2XOKA 3T34A 2IYXA 2E9SA 1D2MA 1IAQA 2ZYWX 5KHOC 3TKLA 1F6BA 2CLSA 1VYTA 2IA5A 3VHLB 1E2HA 3BERA 1JB1A 1MRSA 1P75A 1Z0AA 1G41A 5A4JA 4Q47A 3KQHA 3K0SA 1XMVA 4WZ6A 1W36B 3U44B 2QROA 1OH6A 3B2EA 3SDZA 4AKGA 2FFQA 4X8HA 5KSOA 4YLGA 1ZIPA 1W2HA 1YR9A 2AHOA 3EWAA 2ERXA 1QVAA 4HYYA 5FI1B 1IXSB 1EWRA 3A1VA 2QA5A 4Q01A 4XD7A 2QPOA 2WOJA 3LFUA 2LKCA 1E0JA 1E1RA 1U9IA 1VG1A 1E9BA 3AEZA 4UNNA 4OBEA 2YWFA 3AV0B 1WB9A 4B6FA 4KYIB 1OXXK 3MWKA 1MR3F 2VHCA 4Y0VA 3KQLA 4DCUA 5HKKA 1JPJA 3ZQJA 1G4UR 2G6BA 1KO7A 2AK2A 2ZRBA 4Q9HA 1Q57A 3UMSA 5JFGA 2JASA 2OE2A 4PHGA 2CE2X 2IUUA 4X8LA 3O8CA 3Q3JB 4M9XA 4KFRA 1PZNA 4TSFA 5F98A 3AGPA 4LBWA 1Z2AA 3CRRA 1NVUQ 2ZUDA 4PPGA 1P4SA 2CXXA 4UNSA 1DTSA 2ZEJA 5E7JA 1SVIA 1P60A 4F91B 1RYHA 3IQXA 4ITRC 2O8BB 3DMNA 1GKYA 4WVFA 4OQXA 4PAQA 4A82A 4YMVA 4J0QA 1P73A 3CF2A 3LNCA 4IOKA 2YWEA 2EWWA 2IF2A 3ASYA 2YHSA 4TMVA 2OLKA 3C5CA 3EASA 4Q00A 2YWGA 4LV6A 1W48A 1ZNXA 2WMNB 1GL7A 1Q20A 4HB2A 2D4HA 2O5VA 2IEZA 4IFEA 2WM9B 3GLGE 1OW3B 2JJ8A 1K5DA 4P33A 3SHWA 5IF9A 3QY0A 3DDCA 3K0AB 1Q44A 4US0R 4ZCMA 5JLJA 2WWIA 2F1RA 3EA0A 1KI3A 1F5NA 2OBLA 3LLUA 4D4KA 4UJ5A 1KY3A 2CLCX 1M7HA 1NY5A 3VU9B 4CEJB 2WOOA 2ONJA 2ZXUA 1Z5ZA 4RD3A 3KUDA 2J3EA 1R0XA 1JQLB 4C0QC 1S3GA 4RY2A 5UKDA 5FTNA 3UMFA 4PAMA 4F92B 1Z08A 2GCOB 1G8GA 3TGPA 1GVNB 5CIQA 1AKYA 3QG1A 1CF4A 2ZSAA 2H57A 3VR1A 2AXPA 3K9GA 3EZFA 5HZKA 3THYB 2PMDA 5C4GB 1W44A 3BBPA 5FUWA 2JCSA 1S3SA 4JSTA 4HZUB 2OV2A 5EE5B 4B71A 2XSZA 3QKUA 4G3XA 3B9QA 4A8JC 4DLTA 2D2FA 4DEXA 1GL9B 4JLMA 2YZ2A 4C0LA 1P72A 1L4YA 2R6AA 1ZM2A 1DAIA 1W0JD 2A2ZA 4RCZA 4I4LA 3QXXA 1KK3A 3MMPA 2PT7A 3IIKA 4U00A 1AK2A 1Q3TA 2A78A 2FSHA 4MA4A 1G5TA 4TSFD 3NVAA 1NLFA 3PUZA 4LJ8A 3T35A 3LY5A 2Q0HA 4ZKEA 1F48A 3QF4A 1S4QA 4TLCA 5KPJA 4EJSC 3PUYA 4V0MA 2WKRA 3OAAD 1IXZA 2W0MA 2L0XA 4KO8A 2GDJA 3IUYA 2WJJA 2H1LA 3TSZA 2GHIA 3VKGA 1KSFX 4HB4A 5G53C 3B1ZA 4JS0A 2IXEA 1HURA 2X1VA 2QZ4A 4TWZA 5GJCA 1A7JA 2PX3A 2FPKA 4GFDA 3RABA 4F4IA 5EXPA 5P21A 2NG1A 1T3HA 3FVQA 4LPKA 4O2LA 5EQTA 1N6RA 2D3WA 3KTAA 3THXA 2IYRA 1N6NA 1KAGA 2KBFA 2XOKD 4D6PA 1US8A 2WVJA 3K0AA 4ZI2A 4IFBA 3FPAA 3OIYA 4UQOA 3GEEA 2GBLA 4EDHA 1NVWQ 1RIFA 1YR7A 3ZD7A 3CPHA 3QUSA 3EWSA 2D2EA 1MABB 3QVVA 4WAUA 2O0KA 5G3YA 3J81k 5BWMA 1VYUA 5DI3A 1G3UA 1GG2A 5EP1A 3S1AA 3MAAC 3B78A 4CIDA 4FXPA 3LA6A 3H0KA 4HAUA 1EK0A 4AK9A 1I2MA 1JQJC 4IOLA 4RFVA 2P0EA 5FL3A 1CJUC 3ZIAA 1E6CA 1G16A 4DT1B 3RVBA 2WWFA 2VPPA 2REBA 3IBYA 3RS5A 3CPEA 4Q5IA 5JJIA 1SXJD 1II9A 4N0EA 5TV2A 1K5GA 2IYYA 1NJGA 3LBIA 3NBZC 5IT5A 5A5GA 2Z5FA 4ZI3A 4WBSA 3TR0A 4ARZA 2J0SA 3CF6R 1U90A 3RWMB 1Z0JA 5JS8A 1P2UA 1RVDA 2IUSA 3RSLA 4RZ3A 1TAGA 3KQNA 1DAKA 1E2MA 1EFRA 2DWOA 2GBLC 4URWR 2QQEA 2G77B 2J7PD 4HLQB 2IX3A 1Z6XA 1BYIA 4IDNA 421PA 5L3SA 3GLGB 2ZRLA 3RS2A 1E99A 4MDEA 3OHMA 2WSMA 4RFSB 4MKIA 4B6EA 3AKDA 4LJYA 4OL0A 5CK4A 4HUTA 5L3VA 1KTVA 3FMFA 3CBQA 2J0UB 2ZSBA 3K0FB 3FB4A 2G3YA 1BS1A 5D3MA 5IK2A 4EQ6B 2ZM5A 4LJ7A 5H68A 4TLBA 1E32A 4DUGA 2ONKA 1HV8A 4LX0A 2VP6A 5ELXA 5J4LA 3BH0A 3PUVA 2UVQA 4WZAE 1KMQA 2FU5C 5F3WB 1EG7A 4AY2A 4OYHA 1U8AA 1QZXA 5LB4A 1K8RA 5CDFA 3A4MA 1UKEA 2GCPA 1SVSA 3TH5A 1FMLA 2ANCA 2CVFA 1XJQA 1JI0A 3IBGA 3HU1A 1XDBA 2VQSA 2IXFA 2VO1A 4M9ZA 1HA3A 2HEIA 3CRMA 4D0GA 3W9YA 1OIWA 3LDAA 3AM1A 1D2EA 1N2CE 2AK3A 2V8OA 3RWOA 3SYLA 721PA 1U0LA 4M1OA 1IY0A 1GITA 3BD9A 1AA9A 2ZRCA 2O8FB 5LD2C 1QHNA 5H1YA 4UNPA 4C0KA 1KSGA 2H17A 5CDFE 3EARA 2JDIA 2NZJA 2OXCA 3MJHA 3U61B 4FD2A 1L4UA 2QRZA 5LPNA 1F2TA 4IHQA 2O8CA 3EC2A 2JATA 4KLNA 1T9HA 4OI0A 3VR6A 5KO2A 4O0MA 1G20E 2ZRJA 4MGIR 5KU1A 3A36A 2VH5R 3WMGA 1IN7A 5DNYB 1OXTA 2ZRKA 3EPJA 3RC8A 4QBIA 4Q1AA 4R2HA 1T91A 1ZP6A 2EU8A 2XAUA 2IUTA 2OT3B 3MWYW 5A0FA 1RZ3A 3R9IA 1ETUA 3GLHA 2EFEB 2C8VA 2WWWA 4LSGA 1JNYA 2F7SA 3W5IA 5TARA 4W5HA 5LDDC 3D31A 4OHXA 3SBDA 3BOSA 1OH7A 2K5UA 2QAGC 3R8FA 4JLAA 1OHHA 3VR3A 4GZLA 4ZPXA 3DHWC 3EX7C 3ND9A 3RS0A 1OH8A 4CT5A 3B1YA 4BFYA 4NCKA 4MYUA 2GWHA 5BXQC 3SEAA 4B3BA 5AUQA 5D3MB 4EPVA 1I4TD 5B58C 3K0EA 2I3BA 2CVHA 3KKNA 3RRYA 2XTMA 2QPAA 1MT0A 4TT3D 5FUXA 2CEAA 4PSKA 1DAGA 1E1QD 2VLIA 2OILA 1D6JA 1XCGB 3L0SA 4E07A 4Z8XA 1EFCA 4D82A 4URYR 2CHGA 4ESHA 4A0RA 4QM6A 1T5LA 3IO5A 5G41A 1NVVQ 3QPUA 3TUJC 4HLCA 1G17A 3GJ8A 1JBKA 3QPWA 4AYTA 5J47A 2ZJ2A 3AF0A 2OCAA 4GZMA 4I1VA 2OBNA 4DXAA 1IJFA 5ANRB 2BMEA 2YJTD 3KXIA 5DE3A 1JALA 1G4AE 3UPUA 1QHXA 1R0WA 2GNOA 5DO9A 4BECA 4JZKA 3WNDA
chains in the Genus database with same CATH superfamily
3GJ7A 3V8QA 5JPCA 1TTTA 5U9CA 2GCOA 2ID4A 2A9OA 2YRXA 4C2AA 5FDFA 3EPRA 3BIFA 5JPDA 2Z6UA 2QKYA 4CF3A 3DMYA 4DARA 3OSUA 4KFUA 3QKRB 2ZYRA 1NXOA 4YMLA 3IXMA 1AT1A 1U1FA 3HA3A 3OEYA 1FDTA 2ZCVA 3T3MB 5DCWA 2G9ZA 3VOTA 4F96A 1ZGHA 2BIFA 1K0UA 3D2AA 3LBHA 4HRYA 1VXRA 3P0FA 1C7EA 3PXBA 2ZBQA 3F5DA 4C0JA 2CSXA 1FXWA 3U62A 1LLCA 3LYLA 4MYHA 1PZFA 1UC5B 2A5FA 1QV6A 1MG5A 3RT7A 1NNI1 2LGJA 1X7DA 3DBRB 3R9XA 2HA7A 4BDTA 1P2VA 4Q21A 1Z4JA 2BP7A 3PQFA 4FB5A 1OT5A 4OU5A 4QFDA 3M6MD 3RARA 4AO6A 5MFZA 1UJ4A 2OFPA 1FP7A 2HDWA 4F12A 5KAMA 2Z6VA 4HWGA 1UXOA 2JCBA 2FK8A 1P91A 2NM0A 1KEPA 2R8EA 1HTWA 3A6EA 1SOWA 1F3LA 2ZTHA 2WD9A 3B1JA 1RRFA 1Z06A 5D5PA 4D3ZA 2R7AA 3PSHA 5JD6A 4HLUA 1L7XA 4ZP1A 4LRUA 1AO0A 1C4OA 2GD6A 1QNFA 1Z5VA 4M0PA 4QT0A 1BHSA 1COZA 1WVMA 2PX8A 5MDHA 4MVCA 3FWNA 4ZHQA 4D44A 2WF5A 2XRMA 1HFEL 2PYDA 3DONA 2PRZA 3Q5DA 2DLNA 3MGAA 4DDWA 2J5RA 4YWHA 1WOMA 3T99A 4HFMA 2IHVA 2QLNA 2M6KA 3ZVMA 1X74A 4ZZ0A 1S2MA 2FEAA 4P58A 4E12A 1UL1X 3KE8A 3VBCA 5ESWA 2R5FA 3TD2A 3THRA 4C3ZA 2WTUA 2I7VA 3TS1A 4CIYA 2FSPA 2WDZA 3K20A 4J91A 2PKYX 4QWMA 3C14C 2LTAA 1M5UA 3HSKA 4NTZA 1N3BA 4HDCA 3LUDA 3TSAA 1IBKB 1LWOA 3VNRA 3ZBPA 3DKKA 1WA5A 1VIMA 3FPBA 4JR1A 4QC2A 2C7RA 1PNQA 2ROQA 2QUIA 4IRMA 3ZJVA 4IINA 5IMBA 3S81A 1I2CA 2JLBA 3HCCA 3HUFA 1B1CA 2QRPA 4U8HA 4YN3A 2IH4A 2CL5A 3CW2A 4OFXA 3BXFA 3W34A 3FFBA 1DB3A 1XZFA 3D8SA 1APBA 2BSXA 2YXEA 4FGLA 5F33A 3OIVA 1G5HA 4B33A 4R01A 4L15A 3M6AA 4AQYB 3OTIA 3PG5A 4RD4A 3ZY3A 1X14A 5FJIA 3T8YA 2FSVA 1FMTA 4PSCA 1KI1A 4RIGA 2JI9A 4JELA 1XAHA 1ZN2A 3E70C 5C8ZA 5DNUA 3O8RA 2H5EA 3ANMA 1RI4A 4IL5A 5KOHA 3TI7A 3CLUC 4MUMA 2WHXA 4MYTA 1P44A 1OFHA 1KJYA 1G8MA 1KA9H 3OE7A 2XZLA 1D6NA 2AC2A 4FQ5A 5HCNA 4H16A 5JC8A 1H6DA 3B82A 3LL7A 4ANFA 2IBMA 4F9TA 1JIUA 4YK7A 3EZXA 3LPAA 4LNUB 4WZAB 3I2IA 2DKFA 2Z8YM 3OQJA 4G9BA 2PX4A 5DSXA 3VHXA 3WBKA 1XCPA 3SC2A 1FB5A 4TOIA 1AF4A 1ADJA 1G6OA 1RTKA 1WF6A 3HZHA 4URZR 4PYJA 3K71B 3EG9B 1OSNA 1PJSA 3IMKA 1W30A 6AT1A 4R1QA 1F6DA 3NNDA 1KE2A 5KWEA 1CS0B 1P5HA 2WU1A 4LYFA 4TVKA 2HFJA 1ILEA 3CZPA 3IE2A 4QO8A 2H18A 3CH6A 1DQSA 3WYDA 3CSUA 3DDSA 2G9NA 1NPYA 1OI7A 1X80B 4NZZA 1X1BA 3D8UA 3RU7A 3TGWA 3UT6A 4RTLA 2Y66A 5C46F 5K7SA 1K6EA 3GFSA 4DPLA 3IBSA 5DK6A 4JJKA 4B81A 3L6BA 4C4PA 5KVCA 4G23A 4P5EA 1XVTA 5BYJA 3TW0A 3V6MA 2GQ0A 3OCVA 4XSGA 2GZAA 2WUFA 1S96A 1U7HA 3ULKA 4YRSA 1N5LA 2MTBA 3TJMA 4TWIA 3HCNA 4O4JA 3VR5H 3WWZA 2B98A 2OAP1 2EJBA 2D0OB 3S8EA 1U3DA 1K9SA 5FAKA 4Y3UA 3O2QB 5K0CA 3KETA 2PMWB 3GRPA 4GRDA 4MB6A 2W6IA 3HKBA 4QSHA 2PHZA 1T36A 4BAZA 3B5JA 1WMEA 1YZLA 3CLHA 3E9YA 4MA5A 4BN4A 1AXGA 2EW2A 2ZLBA 3JWJA 1V8OA 2ZBRA 4MQ4A 1X2EA 1L4GA 3TW4A 3U3RA 2NO0A 4DY4A 2P9JA 3QUQA 4S2UA 3FXAA 2OCIA 3REFA 4D0NA 4EVQA 5SY9A 5JECA 4E2WA 1CUXA 3UAGA 3VAAA 1NC3A 2QJRA 1J2EA 3H9QA 4LC9A 3QYJA 1ZOLA 3H2KA 2BFCB 3LUGA 4G0PA 3WWPA 4ER3A 5KREA 3PT5A 4RTSA 3FLAA 2OCYC 2H4JA 1FNSA 1M1YE 2R7NA 1V7ZA 2PPLA 2X2FA 2Y1KA 2BFWA 1U63A 4IR7A 4OP1A 3THXB 1X38A 3HNPA 1KNQA 3QU5A 3L7NA 4JSYA 1AKEA 1CEYA 2PIAA 3VJMA 4OX9B 4QDKA 4YVFA 1PU2A 1IL0A 4LMAA 3I5YA 3EPKA 5HGJA 3MGGA 1VBMA 1I5EA 3NHLA 1P0FA 3JVDA 1NY6A 3L9WA 1KFCB 4G8DA 3TTUA 2NP7A 1Q0SA 2R6FA 5CVEA 3UUEA 5KNCH 4PAWA 1DKMA 4A73A 1KYWA 4V0LA 5LBUA 2PKRA 4IV8A 4EJSA 2ZAOA 2H7VA 5AI5A 1ZD3A 1J90A 2OZPA 4KWTA 2QJWA 4ALMA 3PNBA 4B76A 1T1JA 1WY7A 2VYNA 1W4CA 4Q7EA 3OWXA 1RRCA 2D7JA 4B31A 3GCDA 3MAGA 3K4PA 1SIBE 1D8TA 2RD2A 1U8CB 5JALA 5I9MA 3O8NA 4FIDA 1W5EA 2D74A 1GZ4A 4GWKA 4OYRA 4WLEA 3IQEA 3F6SA 2FLKA 4HPXB 3AVXA 1UFVA 2QAGB 4YAWA 4KLRA 2ZETA 5TPWB 1QIDA 4G81A 1CP3A 2AFIA 1GT91 2DBRA 2HF8A 4OCZA 2O8DA 1KAQA 5ECWA 5CLJA 4OXQA 1IUPA 1ECFA 1EE2A 4M9QA 4X1KA 2ZM6B 5HNKA 1WQ1R 2ZR0A 4WNCA 3AHIA 2QW8A 4O63O 4WJKB 4C0AC 2BCJQ 4AJEA 4EK9A 1YZ3A 2XXJA 3M9XA 4Q19A 2GZRA 2ZYGA 4LKOA 3KDPA 4KQKA 1FRQA 1E69A 3G0GA 4R8VA 5JFOA 5K0FA 4DYHA 2XHEA 1CRQA 4K6GA 4OQLA 3LS2A 5T4FA 4UHCA 2PU5A 3TSYA 5HKOA 1Z0ZA 2WQ7A 3WLNA 1DL5A 1D2HA 4HWPA 5L3RA 2BTQA 1MV5A 1RZUA 4LBVA 2E37A 3WY9A 3D3WA 1GAQA 3KT3A 2IGTA 2ZBVA 1XHLA 3VH3A 1G6HA 4O4HB 1O94A 2C29D 1HDEA 4CM1A 4D98A 3AM3A 2ZRFA 4H59A 3WWEA 1D4FA 2PL9A 3ZZ1A 2AKEA 3NTUA 4A9AA 3KPYA 4EY5A 4FR0A 4TMYA 2YIVX 5M3BA 4M46A 5GVRA 2AZXA 1M5TA 1GTMA 1PR6A 3I6QA 3GFBA 2Q45A 2WT9A 3AZQA 5AD1A 2Y0BA 4HB3A 2PBLA 4J9VA 4W4TA 3PUHA 4RULA 1TM7E 2JCXA 4YCLA 3U9SA 5FD8A 1E9SA 3CY6A 3U19A 1DKRA 2PWBA 2C5HA 1V4BA 5CEFA 5CK5A 1RCTE 4JVMA 1L4KA 2A9RA 2AH5A 2AX3A 2PEYA 2PG3A 3KO8A 3KOZA 4HVAA 1YZUA 2WWGA 3AB7A 4HGZA 5DX1A 4ZVSA 1EK6A 1UXKA 1II8B 2QORA 1G20B 2XUKA 1VOTA 3DWIA 3HH8A 3HMQA 5J1SB 1AHPA 4UCWA 1WP9A 3F74A 4YRZA 4ZQIA 1F8GA 4LJSA 5EJAA 1LDYA 3G9TA 1BQ3A 3ZI4A 4M55A 5IKPA 1U0RA 2HMAA 3PEWA 4L22A 2J85A 5I4KA 4RKRA 2AC4A 3LQ1A 3NBUA 5EJMA 2Y9MB 4YPFA 1KU0A 1HMPA 1ZK1A 4YA6A 4BFTA 1W52X 5DOZA 2OQIA 1OGIA 2YIJA 1TEZA 3N8NA 2EKLA 2PBZA 2MSDB 1TQ6A 1C9DB 2WYHA 2I34A 3I2FA 4ZC8A 2IYZA 1XXHE 3GFPA 2QNRA 3EQ2A 5AJZA 1QFXA 3IDZA 5C2JB 1NVEA 1V8DA 3IS3A 5F23A 3NWJA 3W5AA 1GNRA 3FDJA 1KRXA 4HDOB 1QF9A 4UM8B 4DE5A 2H1FA 1X86B 4G9EA 4HZGA 4PZCA 1XVUA 4ZDIA 5F2NA 3BWXA 1KWKA 1LRKA 1UOOA 2PAFA 1ID1A 1PVOA 1U9ZA 3V1NA 2OFOA 1BDIA 1KFEB 2Y0EA 1HT2E 2A8YA 1E3EA 2ODNA 3D0OA 3NYWA 4QTYA 4A92A 3DE7X 3RFVA 2YOHA 1YSCA 3AIIA 3HA5A 3HB1A 3UA3A 5C35A 1KK0A 4RE6A 3T5DA 1HBJA 1EUCB 4GX0A 2Q0XA 2HREA 2VDLB 3CZCA 3HVKA 2V96A 4TMXA 2AFVA 3W7VA 5COAA 3ANNA 4FS8A 1NOJA 3O8BA 1GUAA 3BIXA 3WAGA 1IIRA 1R8YA 1SKQA 2A5YB 2ZRNA 3DOOA 2CNDA 4IQ8A 2VJMB 2J9RA 4HAXA 3CUYA 4LBZA 4M1WA 3RRBA 2PE5A 2FG5A 3VR4A 4F4JA 2NXNA 5EZ6B 2OOKA 4FYVA 1AJEA 3PI6A 3H9UA 1L5WA 3RO7A 1SCJA 2QSUA 4MQUA 2PT6A 3PGJA 1AQYA 1OGYA 3H9GA 2JGAA 4NDNE 3STYA 2PS9A 4UARA 3P19A 1FMCA 1KMHB 2ONZA 1HYHA 3OPXA 1PS0A 4LHYA 2QT1A 1BX0A 3N70A 4U2EA 4P54A 3S28A 1NQUA 1P31A 3NHBA 3ZVKA 3M3DA 3RQIA 5C0OE 4JT4A 3IVMA 3C6MA 1R0ZA 4WN3A 5IXJA 2F17A 2FCAA 3V80A 2PXHA 3JR3A 3TZQA 1K4MA 3NH6A 5FA8A 5HF8A 1FF9A 4PONA 3ZVLA 3Q8MA 3AHFA 5IUKC 4DCJA 2WJGA 1VRWA 4ESEA 4TS9A 1GTL1 3ZYZA 4ALKA 4N18A 4YCDA 1WQ3A 3LX6A 3Q88A 4HL6A 5DBGA 3OEWA 5TQVA 3W2IA 4ZK2A 1XG5A 4U7JA 1ZL2A 5KWIA 5LLTA 4DLSA 3EVTA 4FTWA 4S04A 2SKDA 4AXXA 1RPNA 2D06A 3OMLA 4M7WA 4AC9A 4EG8A 3BRWD 4POOA 2YL2A 3M4ZA 7REQA 4TL7A 2Q28A 1P62B 1Z34A 3FNIA 4QOIA 1P7YA 1B43A 4BX3A 4ZO7A 1XMPA 5G0WA 1F14A 5HIKA 2X5JO 4DQDA 2BOVA 4P86A 2EBHX 3GLTA 3VQTA 4RLFA 3DYIA 2OBMA 3D2CA 1ID8A 4OMUA 2FOLA 2YINC 1ODIA 4EYKA 4JXZA 2C4UA 2V0GA 2OBBA 1NR7A 2Q7XA 1HDOA 2E85A 3C16C 3DFIA 4M86A 2HQRA 1T2FA 2PCJA 4LNUA 4ZCTA 3U6KA 3RAEC 2XQVA 3CB2A 4HI0E 3AYZB 1ZI9A 5CFMA 1N5KA 4BBAA 4QT4A 4CKEA 3OU2A 4Z4EA 4LHSA 4CKCB 2O1SA 4QZVA 2YQ5A 4RXTA 4B7XA 2IQ5A 1IWBB 5CT4A 1YCGA 2HWXA 1GGMA 4U2CA 1UPBA 5FPYA 3NTXA 2J87A 2EZ8A 4BO3A 4PTYA 1SO8A 1THTA 1HQKA 1QKIA 4JDUA 3U4HA 3U4GA 4C0XA 4DG9A 5A5EA 1XEWX 3UGTA 4J16C 1T5DX 2NO6A 1U7OA 5CHYA 2IZZA 2FWIA 3B6EA 2NQTA 1SULA 2GPYA 1K8XB 3DTVB 5KNDA 3KLPX 2DR2A 4N54A 2NMVA 5EVCA 2C2BA 4GL2A 5E4FA 2XKJE 2FW0A 4QXAA 1CZRA 3JARB 4OXYA 4E22A 3KWMA 3IP5A 1NJFA 3F96A 3H65A 5H7XA 2HJRA 4L9SA 4WOJA 2GLXA 1F1BA 2X0NA 3CLSD 1Q7RA 2F9MA 3FTCA 4X7MA 3WP0A 1BAPA 3VSEA 2AD5A 4P3YA 1X1EA 2FE4A 4DLUA 5JAPA 3NM6B 1YO6A 3AG6A 1FMJA 2XF8A 3ZXUB 2APJA 4H1TA 5JZSA 4OOEA 3AOEA 1H8EA 2OD2A 1SQSA 2ZJ3A 4O2RA 1IB6A 2BSAA 2WUGA 2WNHA 3QVLA 5AK4A 3RVPA 5BSFA 3RC7A 3OX4A 1FUKA 2HM7A 3K94A 3WGYA 3Q8WA 1SVOA 4WBNA 1MRZA 3O3NB 1JLMA 3FKSD 4MW0A 4RHFA 3EPPA 3SQLA 1IBLB 1QM5A 3REQB 2JLYA 1XJWA 4ZEWA 1THZA 1CIPA 2Q2NA 4M8NE 5BY2A 4EB8A 1RM5A 3EZGA 5BSVA 5KCZA 1CWUA 1FSFA 3VKWA 3F6EX 3V9PA 1HETA 4PW0A 1ENPA 5ALOA 3NS7A 4EG4A 1QHHA 4NF2A 2QV7A 4L8WB 4F8EA 3VVCA 2NV6A 5FBRB 5HRUA 1FJGB 1I1QB 1POWA 3JD2A 2YHIB 4X62B 1B6RA 2LKDA 1FX0B 2JZCA 4RCYA 1C7ZA 4BO0A 3T1TA 1IZYA 3KV3O 4HBGA 2YHIA 1HDYA 4MI1A 4KDCA 4BNXA 3DE3X 2QJOA 1R5BA 3GUVA 2JB9A 4NCJA 3WIOA 2ECFA 3ETLA 1BD4A 3GCZA 4CF6A 1XFDA 5JZBA 5EZYB 1SVMA 3I1YA 3E4DA 2G83A 4PIMA 5HSGA 1MIOB 2EERA 1E66A 3NO4A 1YRAA 4BWGA 5JCZA 4C05A 3F7NA 2QIOA 3TKYA 4BB5A 4MNTA 3IBTA 2P9FA 1E9VA 1T9KA 1RU3A 1ULBA 2ZE7A 4ESVA 4EGCB 5D84A 4NH0A 2Q2VA 2VQFB 1RQNA 4KIJA 2ABWA 4MMYB 4ZV7A 1ZM7A 1TF5A 2WP0A 4FEGA 4UCXA 1CEEA 1MKYA 3C5VA 2XWSA 4ISBA 4BLRA 3QEMB 4LRXA 1J2TA 2BGTA 1UF9A 1BKYA 1QCZA 3ANLA 3O03A 1DO8A 1DE0A 3RSHA 4IP0A 1XXHB 4ZZ3A 4P0TA 3H4TA 2FLVA 3BKXA 5LQAA 2P65A 5HP4A 5DF1A 3FTDA 2QT0A 3IT3A 4RJJA 5EHIA 4ARZB 4G2NA 3PZRA 4FKZA 2WWYA 1T5TA 1MOQA 2CB0A 2HN9A 2NNLD 1Q1NA 3R0IA 2PM8A 4C5AA 4GAEA 4UVDA 2GVDC 1RQXA 3P45A 2V9PA 2NZ8A 2VSOA 3F9CA 3PXXA 5B1HA 3RYTC 2VAPA 3EPHA 1W85B 2FFAA 2AXEA 1KK2A 1YJBA 2JS7A 2V6GA 1FS5A 3FVTA 2PY6A 4G0QA 5JDIC 4RKWA 1EPUA 3IDAA 1OOEA 2LZ0A 3A1SA 1L3BA 3IAEA 4NP6A 3OPYA 5DWDA 3UJPA 4DTIA 1TUGA 4S2EA 4G5RA 4YJGA 3DCIA 4QQNA 1JSRA 1XF1A 3MJVA 1VPLA 2OSBA 5PNTA 2E4XA 3SR4A 4H3KB 4QJ5A 3L8YA 3O2JA 5BMOA 5AOVA 3RUIA 5KYYB 1KC3A 3ZY6A 3Q7SA 3PC2A 4UM9D 2VHVA 2O5EA 1CJTC 1P39A 2PZLA 1E9DA 2WHRA 2XQJA 2R8YA 4I5DA 4TTJA 4PYKA 3C7TA 3W5VA 5BNTA 2X8WA 4RVHA 3AP1A 5BV1A 5LUBA 3A1FA 1DRVA 1SAYA 2W2LA 3VSCA 1Y8RB 2QZPA 5H3HA 1SA0B 1XCMA 2V3CC 5EKXA 1Y80A 5ICMA 1U1EA 1KF0A 3BGSA 3LCVB 4HUJA 3ZN2A 5LQMA 1DARA 3CGWA 5BYBA 2V6JA 5U1PA 2AQHA 1DTEA 1CUDA 1CUBA 4ND8A 1Z82A 1JHAA 1WTCA 4N7RA 1UT6A 4BYGA 1XPUA 2DH5A 4DIFA 4YCNA 4K6HA 1OV4A 3PJEA 1U6JA 3ZGVA 3TZCA 1Z6AA 5LOVB 1MHPA 1WMFA 1TQ2A 3C7AA 4QXPA 4WNAB 1IHPA 2EG5A 3MNFA 4IVPA 3F6CA 5GWXA 2ORIA 3ZDQA 2W0SA 2YWXA 5B55A 5CDTA 5K0TA 4OFZA 2NO7A 5E4JA 1T4DA 3LSYA 1KXJA 2CFOA 1CV2A 1RLJA 2GZ2A 3V33A 3HLYA 3YASA 1XD2B 5FIUA 1L6IA 3NP9A 3EZ9A 4JNCA 4X9XA 1FFWA 2R9VA 3TDKA 4B2PA 1F51E 1AQNA 2HRRA 1YE5A 4F3YA 1I3NA 5CXXA 1UZNA 1UDCA 5A4MS 3L0YA 1MN6A 4XGNA 2QRVB 3GP3A 4I6EA 5CB6A 1TQHA 2GEJA 3H9JA 1CJKC 4KSYA 4LZLA 4TMWA 3QF7A 3RTEA 3EF3A 5L9AA 1WRBA 5CM2Z 5B7QA 4IHAA 2WSBA 2HK9A 2V3VA 3DBLA 2F6RA 2JFFA 2PQMA 1OFUA 4JGBA 3WYAA 1GOTA 2OXRA 3UT0A 3CZAA 3HFGA 1H05A 1IZ9A 3LXXA 3DBIA 2G71A 1NYQA 3FE2A 3WOVA 4Y6SA 1RWPA 1W5SA 3ZDRA 1IOVA 1X1SA 1JAIA 3Q98A 5LM3A 4LCJA 3FCOA 2QX8A 2JRCA 4RZUA 3G8DA 3W2FA 4DLKA 4DRYA 2GUGA 2IYPA 2W48A 3QEOA 4UDXX 2PSEA 5F77A 2B4KA 1OKKD 1OTHA 5ELMA 4BWVA 1NZFA 3II6X 4Y6LA 3WK9A 1VSBA 4ZK6A 5LYJF 5COBA 1B8NA 1X8KA 3BA6A 5EXSA 1S0UA 1LSOA 2VSYA 1JFRA 5AM0A 2IS1A 2IJGX 3GA0A 3ETCA 1BVUA 3K9NA 2D8AA 3TNLA 4NOJA 4EMBA 4FLEA 3QHPA 4OMCA 3CEPB 1BQ4A 1N1DA 2B8JA 3M49A 4AUEA 2I55A 3V97A 3DPSA 5C1IA 2GCIA 2RK3A 2ODBA 3LUBA 3FH0A 3IQZA 2QYHA 1SQ6A 4GNKA 4Q9JA 5IBPA 4FQ7A 4M88A 4QTZA 4XA8A 2PMEA 1CTQA 1WMSA 4AG5A 2OBYA 1RWOA 2AMYA 3IPAA 2PMCA 4ZCPA 2UU9B 5IJAA 2FQYA 5FLEX 2D1QA 2J09A 2ZUUA 4MMXB 4DLAA 1RHQA 4MULA 3D3QA 2RBKA 3TQFA 4TV8B 3WK4A 1HKHA 5KYXA 2FW6A 3EYWA 4DLBA 1P0QA 5B36A 2RHJA 1SVUA 1TQ4A 3WTBA 1EVYA 4KQJA 3DMGA 1XCLA 2OXIA 1LPNA 5L7TA 2ZBFA 1P61B 2Y1LA 5JDCC 5EG5A 3LC2O 1UBNA 2JF0A 1M34B 1R6UA 1RC1A 3EW9A 2B6NA 5IJ9A 2IIVA 1NOIA 3NI2A 3Q5EA 4K0KB 1TM2A 3KQOA 5H82A 5JRDS 3DZHA 3NCHA 4HEQA 4E30A 3OT5A 5C18A 4FFRA 1VE5A 2BCEA 5F2OA 1GZ6A 1O6BA 1T1RA 1WCIA 2CXTA 5A4FS 5JZVA 5IYZF 1HMYA 2BONA 3FYSA 4KN9S 1U6KA 1QGED 3WFZA 1BCRA 1S1MA 5JYEA 1XSEA 3MCZA 1D9XA 3I61A 1IN1A 4RKQA 1NQ5A 2QTVA 2WHYA 3AB3A 4BZWA 1P0MA 3CF0A 2I78A 4OGGA 4D9KA 3I73A 2GN6A 2ZJ0A 4FDTA 2IX9A 2Z5VA 5JNLA 1ZH4A 4C14A 5LQSA 4R7ZA 1AUVA 1DXQA 4AQ7A 3VDMA 3ZIUA 4XGIA 3HHEA 3HLTA 4LY9A 3L01A 5E1OA 1QBKC 3KX2A 4DV5B 4B2LA 4H4EA 1AVTA 4DC0A 2RGNA 4YTEA 2HK8A 2KJQA 3RE1A 5IT0A 3O1HB 2YVKA 3IP8A 4EUKA 2Z8YA 2QLFA 2WTEA 3A4YA 3K1TA 1BJKA 2F90A 1QGZA 3ONVA 4WKBA 4DMCA 5IMSA 1QVRA 3GFRA 3A70A 1ECLA 2A5GA 4J75A 2XE7A 2G7MC 1J5XA 4N3AA 3JQAB 3DZIA 4RZQA 4ZPJA 5E95A 4CQMD 4EFDA 4YDSA 1PGNA 1W87A 3WGJA 1EQ2A 4U6SA 5H9WA 3KR2A 4J6EA 4IV0A 5DYTA 3SG0A 2A9QA 1DGQA 3BMXA 2P2SA 2V98A 2ATVA 4IDCA 4EY7A 3C3EA 4BO6A 4CLEA 4B3CA 4GMGA 1K2VN 4URXR 2H4XA 1V1MA 5CYPA 3UATA 1FFBA 2SKCA 3VNAA 4CF4A 2M1ZA 4D9IA 3S27A 1UDAA 2AW5A 1Z5NA 1JG1A 3ECSA 4PXAA 4D4MA 1HNZB 5EMHA 5FOUA 4C0HA 4HYTA 4UNQA 2VDJA 2GZHA 1XF9A 2O7VA 2BYTA 4ILEA 2I65A 3CN9A 5TE9A 5LFAA 1VE1A 4E7PA 3RVQA 1SVNA 4TN1A 2JCYA 3FOWA 1NQVA 4TXNA 1T2DA 1ZNQO 3IHKA 4H7KA 2RBGA 4B3XA 3NANA 1D2CA 2E4UA 2QN7A 3AV3A 3PLNA 3RIXA 3D43A 3T1OA 3QSYA 1DQPA 2CWDA 4UEKA 2I62A 1ISMA 3LT4A 3OWOA 4XFJA 5E4YA 4D99A 4NEHB 4DCNA 4JGIA 5CG1A 1IK4A 4J90A 1MJGA 4JLKA 4JLJA 4RTRA 1Z75A 3BAZA 1IXRC 1HSZA 1NBEA 4KKVA 2GA8A 1Z4KA 2V65A 3OFSA 1G8FA 2O7NA 2RCYA 4JJZA 1C1YA 1W46A 4BLVA 2G82A 1XRNA 4IKPA 1TO1E 3NRBA 4RMJA 1ZNWA 1ZWLA 1QV9A 1QVVA 2O6HA 2XJ9A 3U1VA 2A7XA 1ZM9A 1OAKA 1YOVA 1DHRA 3TGLA 3C8UA 4NNJA 1Y6GA 2Y68A 4ON9A 1QRUA 1ISSA 1RAEA 3VI4B 2HWUA 3LZ6A 3MMXA 4EAQA 1KBQA 1V96A 1ZH8A 3EMDA 2HSEA 1VIAA 3OE5A 2YFQA 4DV4B 5FTMA 3C3JA 4LUCA 3S99A 4H3SA 1QYIA 2X3YA 3HYTA 3HO8A 4LJ4A 2FVXA 3UUWA 4YUWA 5BN3A 5DEOA 2KSQA 1A4RA 1JMYA 3KFLA 3QA3E 4Q1DA 5K8CA 4FE3A 2IXTA 2JFYA 2W22A 2IHJA 4JAVC 1WG8A 1XV5A 2WP8J 2X58A 3E3OA 4QE3A 4K9RA 4F1KA 2B2NA 3MTIA 5DM4A 2ZYDA 3UK1A 3UFXB 4TM7A 3QYFA 2HTEA 4EOGA 3CEMA 2ET6A 4QVKA 1WU7A 4BFCA 5BMVF 2R6ZA 4GPZA 2JFWA 3H17A 4JVOA 3CVOA 4ZAYA 3L2OB 2C2OA 3H5VA 1RACA 2V9ZA 1L7OA 1Y48E 3OCZA 2RGRA 5K03A 4YS6A 2XCUA 5U4QA 1JT9A 4B34A 5AHKA 3L7BA 2AN9A 1HDCA 1RXWA 1ESCA 1M6HA 1NI4B 1RXIA 4IDPA 4N8EA 3R7AA 2B92A 2KHZA 3TOSA 1PIWA 2CXQA 1PGOA 2LPMA 3BE4A 3EDOA 3AW8A 3QWBA 4HQKA 1RJFA 2ZT8A 5EP3A 2X6QA 3FROA 4QTTB 2O20A 4RSRA 2L2QA 2GRUA 4BFSA 2HMTA 3OT4A 3KYJB 2AEMA 2YRFA 5EIAA 3RNOA 4NFHA 5CCDA 1IYZA 3IC5A 3UXEA 1Z2NX 1Z6ZA 5AWFC 3B3AA 4QPDA 3UF0A 1ISRA 4CDGA 1I80A 4BQRA 4C29A 4JV5B 3WWDA 3AI7A 5DI3B 1QHGA 4LCEA 3I9FA 4J9UE 1MC8A 2I4NA 1CY7A 2FFHA 1ELOA 1JKFA 1IFXA 1DEXA 1RWKA 1WXHA 4K6KA 3UOAB 1A5BB 4M8IA 3VYTB 3NAQA 3FHLA 2HEGA 1RIIA 3BXGA 4Q7JB 4I5IA 4KXXA 3SXPA 4Q4JB 1KAHA 3GEIA 1H1TA 5T57A 5AW0A 3UYLA 2JG3A 1OTXA 3LHFA 5KVVA 2AEFA 4ZVQA 2ZI9A 4KSBA 4B85A 5BRJA 3TLBA 3AHDA 5HM8A 3Q7TA 3GLFB 3CTPA 4JY7A 3BK2A 1YE3A 4CL8A 2PA3A 4L95C 3CNQS 4X1KB 4LPSA 1NQOA 1E9CA 1S7GA 1LPOA 2CDNA 3BXXA 4NG4A 5DX8A 4N4AA 5EWLB 3N2KB 4D0LB 3U81A 4KUGA 4EECA 4FC7A 4IIDA 4X8OA 3VU0A 3BF7A 2ECOA 4DA8A 1B2RA 4I3HA 4OATA 1UINA 3EY4A 3QVGB 4JBIA 4ZQGA 1IBMB 3I28A 2M9MA 3IOMA 2NTJA 3ORYA 2IUYA 2O23A 1U1IA 4OA5A 4V24A 1U9IC 1N5IA 3IH5A 4B4UA 2R6JA 1E4YA 4DSNA 3OQOA 1PR3A 1TT5A 1QR6A 2HIGA 1ENYA 4YNBA 4Z9BA 1O54A 2NGRA 2Q29A 2XA1A 1I9GA 3DE6X 5B1EA 3LSTA 3O6VA 2NXJA 2X9LA 4HWSA 3V9AA 4QEZA 4M49A 4ER6A 4WLUA 2H16A 4RXMA 4YP1A 3S1SA 3HCPA 1QGUB 2WG1A 3DQQA 4PO8A 5BWBA 5T4EA 3H2JA 4A23A 5JVDF 4KQXA 4UC0A 4JLPA 3EAQA 1MH1A 1DEAA 3L6EA 4I1SA 2CFSA 1DXHA 1VCMA 1Z25A 1HYQA 3I9V6 1C8VB 3PUXA 4HUQB 2UZ4A 1E4OA 1T6BY 4PSUA 4R6WA 1ISGA 3GEBA 5BT9A 3B38A 4W9NA 3VNQA 3ROGA 1N0WA 5LQKA 2K6GA 1BZYA 4WXMA 1LW6E 3R6WA 4JA2A 2PQ6A 1YXMA 4J2TA 3WGIA 3KYIB 1L8LA 2WB4A 4HYQA 1N6HA 3GZ4A 2I33A 4BMCA 2REQA 5CNMA 1PDOA 2P69A 3WFIA 4L5IA 4TV8A 2V1XA 4GGMX 4UBJA 1AQUA 1H5NA 1IAVA 2L19A 3T9DA 3NEJA 2Q21A 4IIGA 4R2WA 2RHTA 4Q9DA 16PKA 2D62A 4G4SO 4K0RA 1LSJA 4D6YA 1H2XA 4UAGA 1PV1A 4MK4A 2I4OA 5T6MA 2A33A 2BBSA 3TTSA 2J67A 3MMZA 3N1UA 1XD8A 3BDVA 3ETHA 3BKWA 3ZCTA 1J42A 3VH1A 3ZWNA 1JG3A 5ECDA 1ULHA 1ZHHA 4EHBA 2DFPA 5F5XA 3T5MA 1U1CA 1RSZA 3BL8A 3MG9A 3PE3A 3H5AA 1W4LA 1VZ2A 5MFPA 4EHDA 2PBRA 1AUQA 2YS7A 3KL4A 1EX9A 5BSTA 3KHSA 4R16A 1JH8A 3ABRB 1BA2A 1W93A 1FFXB 5LMNB 1F2UA 3B89A 3K1AA 4DGQA 1QJ4A 3L93A 5CGZA 3DVLA 4L5BA 3ZH9B 3KUUA 5I3CA 1A8UA 2BFOA 3ESDA 3H2GA 3K09A 3QPAA 3KQTA 1EG2A 1U0BB 4JI1B 1A82A 5IAGA 4E2XA 3NXKA 3QMPA 4LHEA 1DPGA 2HF9A 1DPFA 1NVBA 4ZQBA 2IYQA 4QLOA 3TAHA 3F6RA 3AUTA 1UMBA 2FEOA 4MP3A 1NU8A 3IAUA 1Q0LA 2BP7B 4HDRB 3RVLA 1U2PA 3EG9A 5G1NA 5IJ0A 1HEYA 2DG2A 2BKLA 3BF8A 1F60A 2FEKA 3FGOA 2YWCA 3R7FA 4EFKA 5CB4B 1DO2A 1EHYA 1P4GA 1XEXA 3AUSA 1ACJA 2IKSA 5B7GA 3IBFA 5C32A 2QN3A 4XB2A 1JMKC 3RYIB 1NUSA 1YGYA 2ZIGA 4QULA 5TB5A 2W5UA 2EFCB 1VYVA 2NU7A 1L3IA 3DT6A 4BLTA 3D6TB 1CNEA 1CDOA 1K75A 4R9RA 3KJQA 2P68A 2QDXA 1GPH1 4FYPA 1GRVA 1Y3FE 3U48A 3LY8A 2GHTA 4HCJA 5DN6D 2ZR8A 1B2LA 1JJAA 2BV3A 1R0SA 1XZKA 2NUPA 4YGXB 4MQMA 4L5JA 1HTBA 4QOJA 2WSSA 1GZ5A 4IDFA 1Y3IA 2BEKA 4A0QA 5KIAA 2Q6KA 2WHQA 4YONB 2IVFA 1ZY2A 2ADFA 2C9DA 4NBWA 4QKQA 3ROXA 1DXOA 2JD0A 3MILA 4H31A 3ILXA 3OQ6A 5EIBC 1YVPA 4A2QA 1CDEA 1SHLA 3IEPA 4S24A 4EJ2A 4DJDC 5JSUA 1L2TA 3GFVA 3WIEA 1ZH6A 2ZROA 5A3SA 3THWA 4C0WA 1G9TA 1NPDA 1AB5A 2X8JB 4RBNA 1ZM3A 4CN9A 4KPEC 3GMTA 2G07A 1S8NA 3AVVA 1TLLA 3HCBA 4QUGA 4AZ3A 5JTUA 3JQ9C 4ZTUB 2VBGA 2IVZA 3FPGA 5B3JC 5L7YA 2P0YA 3DCNA 3MOSA 4ATNA 2QXTA 3GLIA 2RMKA 5TR9A 2VYVD 3GXBA 3HCFA 4JB8A 3GFGA 5AKIA 4BMPB 4R71A 1TVKA 1Q6ZA 3E9RA 1L8QA 2NXCA 3JY6A 4JKIA 1SBZA 1YVRA 1ZLXA 1XA3A 5G2OA 3V42A 3PTLA 1C9MA 2W43A 2P6NA 1G19A 3OLXA 1E5QA 1MAWA 2QVLA 1BRMA 3DL2A 1MUUA 1OVMA 2QR3A 1A8SA 2WINI 3MIIA 5A3JA 3GAFA 3R7WA 2WJVA 1QIJA 2Q9CA 3PJFA 2OWDA 5EUMA 5LYJB 1V11B 2A7QA 5AHXA 1JWLA 1VHQA 4WE3A 4BX9A 4TLLB 2VAVA 4DCGA 3BSWA 2HGZA 2AIRA 2YV5A 3HRIA 4P4UA 4X95A 1IONA 1S3IA 4DIMA 4QGSA 5B7PA 2P2CA 2H2GA 3SF8A 3A3KA 2J45A 5IBRA 3W1EA 4CPDA 2DE0X 1YT5A 2IOHA 2O59A 1AGYA 3PYLA 3PFIA 1ZITA 5TVKA 2JVKA 4U7DA 1I24A 2ERYA 3PFKA 4C20A 1TL7C 5K6AC 4CV3A 3NPMA 3C1AA 3AF2A 4UZEA 2ZWAA 2P75A 1Z4IA 1GAJA 2P27A 3EXEA 4F5WA 4WGGA 2OLJA 3ABQB 2B7CA 3NC0C 4BTEA 2NP6A 3EB9A 4H7EA 4FN5A 1YOVB 3L8CA 4Q7KA 4GI1A 4J7UA 2OFWA 2PZ8A 5DZSA 3MM4A 3UPTA 4JLBA 4ZO4A 4BNJA 4US1R 1JIVA 1FJHA 1YA8A 1NIPA 4FFNA 1QMGA 1O03A 1VRCA 1XKQA 3REOA 3RF7A 4CDNA 4YAIA 5LN1A 2BEJA 2K7ZA 4HGPA 1X6VA 2HHLA 2I4IA 4OHZA 1AH2A 3T7DA 3CWQA 1ST3A 1EA7A 4GZ3A 5HQJA 4F3TA 4HEA1 2V6FA 2VF7A 2QRHA 2ZBDA 4FJ0A 4IIUA 2W7TA 2CUKA 4YRBA 1ECGA 2EHJA 3FX2A 3MT8A 2ZWMA 3E9QA 4EW3A 3JATB 3Q3IA 4MJLA 2WJAA 5TQ2A 4JA0A 4N49A 5F21A 2UV8A 3THSA 4EI8A 4U7HA 3ZKWB 1UBTS 4JC0A 1KKLA 3UMYA 3EG5A 3ZD9A 1FTSA 1KYIA 4Q24A 4XM1A 5AJYA 2P6MA 4EABA 2WV7A 2VHYA 1H2AS 2J0QA 4KFSA 3FWYA 3T3DA 4BB9A 4F9FA 3FFTA 2EX4A 1