1E6UA

Gdp 4-keto-6-deoxy-d-mannose epimerase reductase
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
315
structure length
315
Chain Sequence
AKQRVFIAGHRGMVGSAIRRQLEQRGDVELVLRTRDELNLLDSRAVHDFFASERIDQVYLAAAKVGGIVANNTYPADFIYQNMMIESNIIHAAHQNDVNKLLFLGSSCIYPKLAKQPMAESELLQGTLEPTNEPYAIAKIAGIKLCESYNRQYGRDYRSVMPTNLYGPHDNFHPSNSHVIPALLRRFHEATAQKAPDVVVWGSGTPMREFLHVDDMAAASIHVMELAHEVWLENTQPMLSHINVGTGVDCTIRELAQTIAKVVGYKGRVVFDASKPDGTPRKLLDVTRLHQLGWYHEISLEAGLASTYQWFLENQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-FUCOSE SYNTHETASE
publication title Probing the Catalytic Mechanism of Gdp-4-Keto-6-Deoxy-D-Mannose Epimerase/Reductase by Kinetic and Crystallographic Characterization of Site-Specific Mutants
pubmed doi rcsb
source organism Escherichia coli
molecule tags Epimerase/reductase
total genus 109
structure length 315
sequence length 315
ec nomenclature ec 1.1.1.271: GDP-L-fucose synthase.
pdb deposition date 2000-08-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01370 Epimerase NAD dependent epimerase/dehydratase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1e6uA01
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1e6uA02
1HE3A 2O4CA 3CTMA 1B8VA 3IP3A 5DCUA 4Z0TA 2DTXA 3WGTA 1TA4A 3I9NA 4LMRA 4S1VA 1ID1A 4XRRA 3FWNA 3QWFA 5H81A 1EBFA 3B1JA 4M86A 1I5RA 3WDSA 4YJFA 1JN0A 5CG1A 3N74A 4Q39A 2O3TA 3U3XA 2HK8A 2RHRA 1ZO8A 2HRZA 4I5DA 4K26A 3RIHA 1GEGA 3OA2A 2NNLD 1ZMTA 5I9MA 4YRBA 3SEFA 1P33A 4TKMA 3RUAA 1NHWA 1LRKA 4IDAA 2B4TO 3H4VA 3LLSA 3MJSA 2XPCA 4DQUA 3KVOA 4IJWA 2WJPA 2TMGA 3D5TA 4BB5A 4PRKA 3MJEA 4YQYA 2VHVA 4A73A 4IIUA 4BO9A 4FGSA 2R6JA 2X9NA 2BFAA 2RH4A 3HNPA 4ZA2A 3K73O 4P38A 4TROA 3ZU4A 5G4KB 2J3JA 3KM0A 4BKPA 1W4ZA 5A9SB 4D3SA 1LA2A 4L73A 1DSSG 2J5RA 4UVHA 3OJFA 4MP3A 4NDNE 1GQ2A 3ABIA 3GGOA 4R41A 1TVEA 3AJRA 1E5LA 1XQ1A 3I3OA 1OOEA 5KNLA 5JC1A 4IY1A 1KC3A 1YL5A 1JWAB 4IDDA 1VSVA 3VVBA 2X58A 2HU2A 2WEKA 2W2LD 3QVWA 4CV3A 1ULSA 1NVTA 1LSJA 4DUPA 2YY7A 1XSEA 4CM3A 1P74A 4HV4A 2PFGA 3WIDA 1B15A 5I9NA 1MFZA 1RJWA 4R1TA 1EBUA 2IDZA 1MGOA 4WKGA 3KLMX 1E3LA 3EVTA 4IGEA 3GG2A 2C0CA 4OXNA 3KV3O 4CLDA 5L4LA 4WK6A 2YW9A 4Y8VA 2YZ7A 1ZJYA 2DTDA 3ITDA 3AOEA 2Y1GA 3F6YA 1A4UA 3E03A 4BUCA 3ROKA 4U0JA 3GF4A 3JTMA 3MJTA 4HFMA 4XYEA 5IDWA 1QYDA 1P1JA 1RKXA 2X5KO 3FR7A 5JAMA 4WCFB 2X0NA 1BWSA 1R4MA 3KB6A 3GPDG 3C7CB 2O3JA 1Z7EA 2PKQP 1A9ZA 2ZTMA 1E7QA 1UZMA 3EVNA 4BIIA 4C4OA 3DB2A 4QEDA 4DLAA 1AXEA 1E5QA 2C5EA 5HTOA 3HN7A 1U2GA 2G5CA 3GEDA 3WBFA 3WXBA 4ZRMA 2DC1A 2GD1O 5CP8A 4MIEA 3A14A 4B4VA 4GAEA 2EP5A 4IDBA 4TQGA 1LSUA 1HLPA 2PK3A 1X1TA 1O95A 2EF1A 3PP8A 3I6QA 1AHIA 2I3AA 4BNYA 2BLLA 1RYEA 3C85A 4B8WA 5G0TA 5JS6A 2CF6A 4YQZA 3RFVA 1ONNA 3RU9A 3AU8A 1Z73A 5L3ZA 4L9RA 3HG7A 1I3MA 1EVYA 4CR8A 2VT2A 3EGOA 3WMWA 1LLCA 2Y93A 2R2GA 3FNHA 1G6KA 5COBA 4QT0A 1HEUA 2OMEA 2UYYA 3H6KA 5HS6A 5KJ6A 2VHYA 5CDSA 3S8MA 1S6YA 4QX6A 3GVIA 3V2GA 4W9NC 1F06A 3RUIA 3MJCA 4I1IA 1OBFO 3ZV4A 4BMVA 4W9NA 3GHYA 4II3A 4TKLA 1YBAA 2B35A 1E3SA 5A9TA 3GEMA 1NPYA 4R1UA 4PG5A 1K6IA 4II2A 3D3WB 3HZZA 3NJ8A 4FS3A 2R00C 3I4FA 4WUVA 1E7MA 1NQOA 5IAAA 2VWGA 3W8DA 1LLUA 1IHYA 3E6AA 1A7KA 1IPFA 2CY0A 1V3TA 3OEWA 5BNIA 4J7XA 5G4KA 1EDZA 1YQXA 3AUTA 3F47A 3I9MA 4IXTA 4M89A 2P9EA 1NR1A 1ZVMA 4IS2A 4CMEC 1C1DA 4BO6A 3Q3CA 4ITUA 4J2OA 1U8FO 1PWZA 3DR3A 1PZHA 3RJ9A 2CFCA 1LSOA 2BELA 3PPIA 4E5KA 3CMMA 5JY6A 1SC6A 4IZHA 4OHUA 4CMIB 4CODB 2B5WA 4JQCA 1ULUA 1GY8A 3O8QB 2ZYAA 4KUEA 4WLNA 1R6DA 3E5RA 4E31A 1PQPA 4CMHA 3RC1A 1CEQA 4I8XA 1DC3A 3ZWCA 1M66A 4FOOA 1V35A 2JD2A 1KVUA 4XGKA 4ZVVA 3FPLA 3Q9UA 4QFCA 2FP4A 4J3FA 2NSDA 1H93A 2P4HX 1PJQA 3ADPA 3C3XA 2YHUA 1CYDA 1QP8A 3OIFA 2AQHA 1D4FA 1UXHA 3RROA 5JO9A 5HS4A 5J23A 1X0XA 5H83A 5HA5A 2B83A 3ZHZA 2BGMA 1CRWG 3DO5A 4KQWA 4N5MA 4CMJA 4CV2A 5KJCA 4MVJA 1LXCA 4Q3BA 3SLGA 4WLEA 5HRUA 2PD4A 3L07A 3MJVA 3C8MA 8LDHA 3HE3A 3E8XA 3PQDA 3WOHA 4D7AA 3PLRA 5H82A 3RBZA 1P1KA 4CM9D 3WGZA 3D4OA 3WGIA 3L4BA 3QW2A 4OSOA 1ZNQO 2JFGA 4EI2A 1A5ZA 1U1IA 3UOGA 4TRRA 1H2BA 1VRWA 4UEJA 4DGSA 1GZ3A 2WMDA 2ZB3A 4X54A 4EW6A 4E13A 2VNSA 2X1HA 1PS8A 3GMSA 1U4SA 4MPDA 1GYRA 3CINA 1U5AA 1DC6A 2ZQZA 1FMCA 3DZJA 3AY6A 4MKZA 5KJ1A 4YJGA 4B7UA 4CM9A 1JKJA 4R5MA 4AJLA 2GZ2A 1T26A 2JFHA 2PA3A 2O4UX 1V0JA 3RCBA 3OBBA 4DPKA 3BTUA 1GEEA 4TRMA 5BT9A 5JAQA 2CD9A 4MVJG 4H3VA 2OUIA 4L75A 4PLHA 3ULKA 2QRKA 3LU1A 3Q2IA 2OORA 2WD7A 2X5OA 4NJMB 2YQ4A 4ZQFA 5KVVA 1PU2A 1RM3A 4Q3CA 4RV9A 1ISIA 4YBZA 4RGBA 3RWBA 3ZWBA 1IZ0A 5L4SA 1T4BA 3LT1A 1A7AA 4J1SA 5BR7A 1GL3A 2EJVA 4D43A 2CZCA 1DRUA 3P2YA 3HB5X 2VZ9A 4JBHA 4CM4A 1P44A 1R0SA 3WWZA 1GUYA 2I6TA 1O89A 1IULA 4OGWA 1Q7BA 4AFNA 1TI7A 3BMOB 2C7VA 2PGLA 1WDKA 4XR4A 4E3ZA 4YB8A 3M1AA 4FCCA 1VLLA 4JIGA 3AI3A 4TZKA 4DBZA 4GLLA 2HSDA 2PD3A 5DOVA 3UHAA 1P45A 1IE3A 4YWJA 3CZRA 4AJNA 4DBVO 2RCYA 2G76A 4RPLA 5A03A 4DMMA 4I5EA 2VOJA 1N1GA 1SAYA 1UDBA 3VZRA 3M2TA 5TIIA 3KSUA 4AJ1A 2VHWA 1H5QA 3FSRA 4FW8A 1U5CA 3ORFA 2UAGA 2OOSA 2YFHA 5TRTA 2PR2A 1SMKA 1UP4A 4R9RA 2YHIB 4I9HA 2OL4A 3VAZA 2V7PA 5JCXA 4K6FA 4OSPA 2D2IA 1WXDA 3ZI0A 1QYXA 4ZQBA 3BMOA 4KOAA 3GH3A 4YA6A 3ROPA 5DBGA 4BKRA 3VH1A 5L7TA 2O50A 2AEMA 4YJGB 5CAEA 4HBGA 4J1NA 4BQPA 3UFXA 4L76A 3RBXA 4BNMA 4KMSA 1DRVA 3RUEA 4EUHA 5JY1A 3CXRA 5FF9A 1GPDG 1JU9A 5IZ4A 5G4LA 1RM5A 3H9UA 3QE3A 4LK3A 3H5NA 4W6ZA 3IC5A 4U7WA 4WECA 5B4VA 5I7SA 5L9AA 3FTPA 1C0IA 1SPXA 3G0OA 3GVXA 3GK3A 3I23A 4B8ZA 3ZU5A 1M6HA 3O38A 4OJNA 1ZSNA 5C7LO 5CEEA 4ND5A 3ZW9A 3LT4A 1UAYA 2I67A 3PFFA 1P1FA 1P31A 1PJ2A 2O3QA 2DM6A 1PS9A 2Q99A 5EIOA 3TRIA 3QWBA 4EUFA 5FYDA 3PIIA 4FJ0A 4XIYA 3G1TA 2DFVA 1I3KA 2AXQA 4RVUA 1KBZA 1DFGA 2FSVA 4WLUA 2WDZA 3JQAA 4WE3A 3BTSA 5KVQA 5JAIA 4XQCA 1J0XO 2ZYGA 4RLSA 1HSOA 4Y6PA 3C24A 3OQ1A 2PH3A 1JVBA 5ADHA 1ZCJA 1GUZA 2O3UA 3DOJA 1DAPA 1ADCA 1NFFA 1Q0LA 1PQWA 3GNQA 3Q9NA 4IM7A 4XQGA 3TPCA 2X0JA 4A0SA 4OOEA 1ISFA 3IJPA 5T64A 4RORA 3BHMA 3CEAA 3MOGA 3CPSA 4K1LA 3SC4A 2OXIA 2P2SA 1LI4A 3ZHYA 3WGHA 3WICA 1B8UA 4KP7A 3RFTA 2D5AA 3FI9A 3IS3A 4J2HA 1TT7A 4DIOA 4RDHA 4E12A 1UXKA 3F5QA 3H2ZA 4GX1A 3V1TC 1U4OA 2QZ9A 3GZNA 5U1PA 3U49A 3H5RA 1R4NA 1E1NA 1U7TA 3KYDA 4F46A 3PDUA 2DVMA 4CLRA 3VZQA 1YL6A 2NU7A 1KEPA 2RBEA 3I5MA 5KJFA 1PZGA 1NTOA 3BXXA 3NGXA 4FJ2A 1E6EA 1F8FA 3G79A 2JCYA 3JQBA 1GV1A 3GMDA 4EJ0A 1T2AA 3V8BA 4UUPA 3OP4A 2DBQA 5BSFA 4PZEA 2LDBA 4CR6A 1NYTA 1OFGA 1WMAA 1P0FA 3NT2A 4PZDA 5F1KA 4EEZA 4CUJA 3QHAA 3D1LA 1YH3A 5A4DA 1GUFA 3BTVA 3OJLA 2NWQA 1ZIDA 2WWRA 2PH5A 2B37A 4GI2A 2DTEA 1X13A 4RF3A 2TMDA 4HX5A 3QY9A 4NBWA 4A7PA 5A1TA 2VZ8A 5T8KA 2F00A 4OXKA 4TVOA 2O3RA 5F1PA 5AXAA 3IQDB 3Q6IA 4ALKA 3DXFA 3M6IA 5FEUA 3OIGA 4NBRA 3BMCB 1DHRA 1KEWA 5ITWA 3U4IA 1HWYA 2NTVA 4ALJA 1F8GA 4C7KA 2BFPA 2D5CA 4MVJD 1GV0A 3INGA 4J4BA 2JD0A 4MVJF 3K2EA 1XEAA 5C3MA 4W7HA 3K96A 3KTDA 2VNAA 5IDQA 2V6GA 1DIBA 4WLOA 1WDLA 1LTHR 4AJKA 4Z9XA 2A94A 3KUXA 3ITKA 4D3DA 4YT4A 3K8ZA 1PL6A 1LC0A 1WPQA 2EV9A 1LDBA 4JK3A 3TF5A 3PHGA 3JQ8B 3NDRA 3P5SA 4S3MA 3ZWPA 1M6WA 3ONDA 4QFDA 1EEHA 1KVTA 5A06A 3LF1A 4Z9FA 2VYVD 3H8VA 3X2FA 1T2CA 2X9VA 4NBVA 4NU6A 3ZWNA 1UDAA 4A27A 4PGFA 3A9WA 1SOWA 1B26A 4MOWA 2OHXA 3GAZA 3NDIA 3RUDA 3K6JA 2WM3A 2BFOA 4BOYA 3RUCA 1X0VA 2CDBA 3GVPA 1EVIA 3PYMA 1V3VA 3WBBA 2JHGA 3WNQA 4JGBA 3SJUA 5GZ3A 2BI7A 3GDGA 4B79A 1KVQA 1AUPA 4K9DA 5TF4A 1ADFA 5U4QA 1QYVA 2HK7A 1ENZA 2E82A 2POQX 2VWHA 1Y5MA 2QRLA 1H6AA 3JQ7A 1C0KA 2DLDA 4M55A 1BGVA 3TZKA 1NM5A 4EUEA 1GCOA 4CMKA 1O5IA 3RVDA 4CMAA 5L53A 5IXSA 3S55A 1UXIA 5EJ2A 2J5QA 2AEFA 3WGGA 1B8PA 4CMBA 1K6JA 3H7AA 2JL1A 5THKA 2YV2A 1W73A 4GX0A 2H1SA 1E0DA 2VYND 4J7UA 3ZGYA 4FFPA 2C54A 1XGKA 5F3RA 4BNNA 3FWZA 3WGOA 2X4GA 3DFZA 3GNSA 2IXBA 1C0LA 4JJIA 4BQRA 1C1XA 1BXGB 3DBLB 2ZKLA 3FR8A 4CQMA 4JJFA 5ES3A 1NVMB 3CE6A 3ADOA 2QG4A 4URFA 1E77A 5GY7A 4D44A 3KLPX 2HMUA 3VTZA 4IDCA 5BNTA 1X7GA 1ZH8A 3I1JA 2OBNA 1H6CA 1T25A 3JQDA 5AXCA 1N5DA 1Z6ZA 5CPFA 3GUCA 3JQ9A 1QMGA 1HXHA 1MV8A 3JYNA 2P4QA 3LQFA 2FPPA 2GLXA 2UV8A 5BSHA 2OP1A 3OETA 3INRA 3VVCA 5DP2A 3ZNOA 3ROQA 4AJPA 2NU6A 1NX6A 2W4QA 1EZ4A 4R3NA 3DOCA 4KWHA 1TT5A 1JTVA 4D0SA 1KVRA 3CSDA 4LRSB 4HP8A 3WFIA 3EC7A 1ZEMA 2OP0A 1ISMA 3D5QA 3U4DA 2Q3EA 1XCBA 4XWYA 4XYGA 5JNLA 2VUSA 2V6BA 1H2HA 2O7SA 1QLJA 4GPD1 4CL8A 4CQLB 1YGYA 3K31A 1QRRA 2Y1EA 1AGNA 3JQCA 1Z74A 4ND3A 1UR5A 1YBVA 5ER9A 5DN9A 3JQEA 3JCZA 3GEGA 4KDEA 2NU9A 3LSYA 4RO0A 4WEQA 2FR8A 3D3WA 3ON5A 4WPGA 2UUOA 3FTNA 4ILKA 2C2XA 1E1MA 4GWKA 4WEOA 1ZSVA 3BMNB 3G49A 2VTEA 1EQUA 1AE1A 1ZW1A 5TGDA 3DL2A 1WZIA 2J6IA 2EHDA 3EDMA 3PHJA 2Y66A 3R3SA 5JFOA 2IYPA 1HETA 2FRDA 3IOYA 5LCXA 1VC2A 3AOGA 4RDIA 1D1SA 2IRWA 2J3HA 2D59A 3H9QA 1ZK2A 2Q49A 2NQTA 1PJTA 3L4BC 4ZHSA 3JQGB 4E2XA 3HJAA 2DFDA 4E6PA 4IDFA 4J9VA 1T2FA 3VKVA 3ZWXA 3DZFA 4G2NA 4ZQEA 4K6CA 4RF5A 3PHHA 5GZ6A 3JSAA 1N1EA 4LISA 4WGGA 4CMEA 4E4YA 4HUJA 1SBYA 2GERA 3OECA 4PZCA 1PIWA 2Q1SA 1KC1A 3DHNA 1A27A 4P8RA 4CLXA 1JAXA 4EJMA 3U4CA 4B7CA 4Q3EA 4M1QA 3DHYA 1XA0A 2HMVA 4YAGA 3ZU3A 3ZWWA 5AVOA 4DQVA 3KHUA 2WE8A 1N2SA 2O7QA 4GKBA 4BNTA 5TT1A 3PDJA 2I65A 4WASA 4MDHA 3E9NA 2HJSA 2HMSA 4TWRA 4D79A 4Z0HO 4AJJA 1C0PA 5T5QA 1MXFA 2RHCA 3EZLA 1BXKA 4CUKA 3L6EA 4OQYA 1D1TA 4YRDA 1YOVA 3I9KA 5IXYA 1HYHA 2NQ8A 4YCAA 3WNVA 1B3RA 3HDYA 3HADA 5TS3A 3CH6A 3FRJA 2GN8A 2NVBA 4RZIA 5DDIP 2GGSA 4DA9A 4E2YA 1E3IA 5KTKA 2VWPA 1KYQA 4XA8A 4UREA 4GSLA 4I9UA 2C7GA 1I2BA 1ZXBA 4P4NA 2ZTVA 2OBYA 4YAJA 2E6UX 1HT0A 4EYEA 4YTEA 3AW9A 3ANLA 4NI5A 5CFZA 3MEQA 3CKYA 3TOXA 3PXXA 2XAAA 3VPGA 5LDHA 5IN4A 5T6BA 1PJ4A 1T1RA 2GN9A 2NLOA 5I7VA 1IOLA 1DOHA 1R12A 4W82A 5A3VA 1UUFA 2C07A 2ET6A 1HZJA 5COAA 4G81A 1Y6JA 2FPIA 4Q3DA 2ZK7A 3OJOA 1VKNA 7MDHA 1HRDA 4OYRA 5JCJD 1EUDA 2HK9A 4BO8A 1MP0A 1CWUA 1MG5A 4ND4A 4ALLA 4MVJP 1QG6A 1MXHA 4DPLA 1TLTA 5CDGA 3UVEA 4A10A 1GAEO 3UCEA 2OFPA 2J5KA 1DJQA 4LSWA 4ALNA 4D3FA 2VN8A 1QYCA 2W2KB 2GR9A 3MOIA 4NIMA 3TZCA 1ZK1A 2RAFA 1R0KA 2YHIA 3JD0A 1A9YA 4ZQHA 1T2DA 3F4BA 4AG3A 1FDVA 1Y8QA 2W8ZA 1YS4A 3GA0A 5BNFA 3WGYA 1D8AA 2ZB8A 5F21A 3O03A 1DC5A 3QVOA 3MWDB 1XG5A 2FZWA 3FN4A 3TZHA 3BMQA 5AOVA 2JJYA 3GVHA 3LZ6A 1HDXA 4FSHA 3JYOA 1IY8A 1FK8A 2D4AA 4FFNA 5FI3A 4OMUA 3W6UA 4GVLA 4OOFA 1ZSYA 4FIZA 4J16A 1HKUA 1ISGA 3DBRA 4IBOA 1NXQA 2DBRA 3QLJA 4PLZA 3TL3A 1DEHA 1EK5A 1A72A 1EDOA 4CM8B 1DJNA 2CVQA 4NJMA 3HDJA 4XQEA 3ZWMA 4HY3A 4N5LA 3ZZNA 4E2WA 2PV7A 2Q2VA 4CMIA 4A2CA 1ISJA 3WJ7A 3ETDA 3NRCA 3M1LA 4EITA 1E1LA 5EPOA 2P68A 2X6TA 4TZTA 1NPTO 2CUKA 5TJ9A 2ILTA 3F1KA 3UKOA 3I4CA 4XR9A 2NUAA 4DIBA 4ESOA 3U4HA 2WD8A 4L4XA 4B4WA 3FCOA 4IJVA 4UAGA 2V65A 4FDAA 1YL7A 4YT8A 1N9GA 1Y8RA 3PRJA 3FNEA 3VPSA 1IB6A 4IQGA 2OZPA 4ND1A 3K2BA 3T4XA 3K5PA 4BV9A 2NACA 1UXGA 3NT4A 4OKNA 1IYZA 2PLAA 2HJRA 4DC1A 3CIFA 4XB1A 1W0CA 4NH4A 3H9GA 1KOLA 4OH1A 3U9LA 4L4RA 4BKQA 1WNTA 3JYPA 1SB8A 3X2EA 3CMCO 4BO5A 3IDSA 4JNKA 4J9UE 2Y68A 3KZVA 3OIDA 2EKPA 2X9GA 2FPGA 3JQAB 5F5NA 5IZCA 3ONFA 2I76A 2PZJA 3E48A 4Y98A 1HDYA 2Z1MA 5TJHA 3V2HA 3HUDA 2GASA 1RPNA 1OC2A 3ZCXA 1YXMA 1DLIA 4KZPA 2NTJA 2EGHA 2PGDA 5DOZA 3SBOA 1ZJZA 1ZBQA 1ZKMA 1MB4A 4O6VA 1EE9A 4FQ8A 3AM3A 4H16A 4MJLA 4J7CA 3VH2A 3VHRA 4PLFA 3RUFA 5KKAA 2VQ3A 4R68A 3DFUA 2IZ0A 1OC4A 1T24A 4NFSA 2YQ5A 1BDMA 1HDGO 4GH5A 3DZIA 5DNAA 3W6ZA 3HN2A 1IL0A 1YQDA 1KY4A 4NFYA 4MKXA 2GRAA 3DZHA 4W7IA 2WD7B 1RM0A 5DBFA 2ZB4A 1F17A 4FN4A 4N18A 4FB5A 3MTJA 2EG9A 4ALMA 4YPOA 4YT2A 3DEYX 1ZUD1 1VSUA 3ZH2A 4KTVE 4TSKA 1KY5A 5FWNA 4RZHA 4CM7A 2B5VA 4XCVA 3W4IA 1GCUA 3GG9A 4CLHA 2HMTA 3JYQA 4BHTA 5L7YA 3TZ6A 4Z6KA 1XHLA 2NVUA 3DAFA 4IDEA 4RLHA 1VE9A 1X15A 1IZ9A 2P5YA 1YQGA 3W1VA 4XKJA 1KIFA 2FMUA 3LDHA 1U28A 5K9ZA 2G0TA 2PKQO 3VZPA 1DO8A 3L9XA 2IEDA 4JBIA 1V3UA 3GZNB 4GMFA 3WB9A 3BHJA 4MIYA 4TRNA 4ID9A 4PIVA 5ER6A 1Q7GA 3S2IA 4DYVA 2WE7A 1E3WA 1LDGA 2CDAA 4EEXA 5G0WA 2FZEA 2Q2QA 4XYLA 1DC4A 1X7HA 2AEJA 4HNHA 3NV9A 1U7HA 1E3JA 1I36A 1PGQA 2BRUA 4K28A 2GSDA 3DWFA 4MINA 4U0KA 1GD1O 2AW5A 1GU7A 1U3TA 3H2SA 1BXGA 3IMFA 5FI5A 3G17A 5ENDA 2PWZA 4W4TA 1MG0A 4Z9YA 4YT5A 2WYVA 4WJZA 4XJTA 1HL3A 1NR7A 4OQZA 4CMGA 3WQRA 1YJQA 2QZZA 3NJ4A 4L8VA 1YJ8A 1W8DA 3HFGA 4YAKA 4XGIA 3PEFA 3LT2A 1LDMA 3WFJA 4R01A 4GQAA 4EGFA 1TB4A 3V1YA 1LDEA 4YACA 1YRLA 2J8ZA 4U6QA 4BKUA 2SCUA 4TMFA 3BYZA 1SCUA 3RQSA 2X86A 3RBVA 1TXGA 1P77A 2GF2A 3IAHA 1UZNA 5JC8A 2EKLA 1ZZEA 3NTRA 3UCFA 2V6FA 4CLOA 5JXWA 4XJSA 4UEOA 1LUAA 1XR3A 4XX0A 2NU8A 5JYDA 2AG5A 3MJ4A 3PQFA 3AUSA 4NBUA 4M87A 3JQ8A 4BNGA 5L40A 1XLTA 3DDNA 4CM6A 1WLYA 3GQVA 5JCJA 2QQ5A 4KDFA 2VT3A 2E4AA 4Y6SA 4YJHB 3PWKA 1R4MB 1K3TA 1DFHA 2EERA 2OO5A 1LDNA 3GHHA 4LSMA 3IJRA 2IYOA 5DF1A 3HSKA 4ZQGA 1MC4A 1FDWA 3DONA 1ZFNA 4A03A 1GYQA 3DBRB 1JQBA 3EMKA 1WW8A 2ZCVA 4XYMA 4WCDA 4BVAA 1VKOA 3K9QO 2AA3A 3G3EA 4NMHA 3WR5A 1YOVB 4A26A 4PLYA 1JKFA 4IIVA 1Z45A 1DIGA 2DPGA 2VRBA 3Q2KA 1KETA 1M75A 3GDOA 2X5JO 4HFJA 4E5MA 5I8WA 5U9CA 4UVIA 2IEBA 2PZLA 4XQ9A 2I66A 1D7OA 4OL9A 4P4GA 1SO8A 5TQVA 4WLVA 1GQQA 5B4TA 1Z82A 4QSMA 4OO3A 1J6UA 1SOVA 1EVJA 2YDXA 3F5SA 5B37A 3B6ZA 5JMPA 2NV6A 2QHXA 1YBMA 5CPBA 1HE2A 1P9LA 3OICA 4BMSA 4OM8A 1DIAA 2GPTA 1O6ZA 4J4TA 3PJGA 2AHRA 2W90A 4ZD6A 2Z5LA 4KQXA 1LQUA 3L77A 4GGOA 2NM0A 1OMOA 2CNBA 4M49A 3LK7A 4F3YA 1P1HA 4FFRA 1BHSA 1VM6A 1WP4A 1R37A 2H63A 3VH3A 1Y9AA 1VPDA 2CF5A 4B4UA 2ZIZA 1RM4A 1NPDA 3DC2A 4LW8A 5ILOA 5JPIA 1PEDA 2EW8A 5A9SA 3F3SA 2E48A 2FY8A 5K6AC 1Y7TA 3H5AA 5DT9A 5F1OA 4AJHA 3EUWA 4DC0A 4DLLA 1QXSA 2JAHA 3UN1A 4YR9A 4J4HA 3BZUA 2Q45A 1CDOA 4XZ3A 3A28A 3G1UA 3GRKA 4MP6A 2Z1NA 3SLKA 1XKQA 3TOZA 4CQMB 4RL6A 4LCEA 3TWOA 3SXPA 1QV6A 2UDPA 3E5MA 1G0NA 3GC6A 3V5NA 1LLDA 4L0QA 3ZDFA 6ADHA 3HB4X 3DTTA 2W2LA 3TNLA 3TDKA 4E33A 2JAPA 3FNFA 2BGKA 1DPGA 2Y99A 1TT5B 1J49A 5L95A 2NTNA 2VRCD 3I9JA 4DREA 2G17A 3S2EA 3U09A 3PJFA 2VTDA 4WOJA 4XRGA 1HZZA 1YB1A 5KOIA 1MA0A 3WYBA 4FJ1A 2Y67A 1PR3A 3NTQA 4RPJA 3UGKA 5ICSA 3GDFA 3PGJA 2UVDA 2ZCUA 4Q3AA 1R66A 5AQ1A 3AI1A 3KYCA 4FBGA 1UAGA 4CUZA 2C5AA 3DTYA 1U8XX 1PGJA 2DU8A 1JLLA 1ONPA 3ANMA 2B69A 3A1NA 4RVSA 3R1IA 4J43A 3HDQA 4L74A 2PZKA 4Z0PA 3GT0A 1NP3A 1YKFA 2EXXA 2VUTA 3O4RA 1B2LA 4CQMD 3K30A 3ASUA 2VHZA 2I9PA 1K0UA 3RASA 4XGNA 2Q4BA 4MVJH 3PK0A 3V1UA 3O8QA 2ZB7A 4NNJA 1BMDA 2PZMA 1PSDA 1E6UA 3C1OA 4JBGA 2F1KA 3D7LA 4FOSA 4JCOA 2FR0A 1BTOA 1UZLA 2HRBA 1N9GB 1I0ZA 2DT5A 3BA1A 4NHEA 4QXMA 4F6LA 2X22A 3NYWA 4BNZA 2IZ1A 4PLVA 1LBEA 2BI8A 2YV1A 1DIRA 2HUNA 4JJGA 4ONEA 1EVZA 1WDMA 1U2DA 4IGFA 2Y1CA 3JQ6A 4N54A 1LC3A 4BO1A 2I3GA 4CPDA 1YDEA 3N58A 2CVOA 3QWAA 2D1YA 1J4AA 3RU7A 3STHA 1I2ZA 3FF4A 1GPJA 3QIVA 3ONEA 1VJTA 1ZK4A 2EWMA 1YB4A 1H9BA 2QW8A 3PYXA 3R0IA 2GZ1A 2GYYA 3Q1LA 2Q2WA 3WYEA 1O8CA 3A4VA 2WYUA 1ENYA 1ADBA 1LQTA 4BMNA 4QO7A 4RQUA 1QYWA 4CV1A 4B3JA 1QSGA 2HKIA 3EY4A 1PTJA 2X0RA 4IPTA 1ISHA 1J5PA 4NFHA 2B4RO 2WTBA 4LVUA 4TVBA 3GVCA 2YV3A 5COQA 3EAGA 2Q1TA 3EHEA 4GLOA 4AJ2A 3PI7A 1V8BA 2C82A 4PCVA 4R3WA 3KXDA 1HE5A 4LN1A 2Y0EA 3NUGA 2PGJA 3JQGA 1O0SA 4XD2A 3ZW8A 1IHXA 5EERA 3LF2A 1EE2A 3KSZO 3VZSA 2A35A 3VPHA 2FWMX 1H6DA 4LVCA 9LDTA 2DBZA 3QVSA 3WSWA 3QA9A 1B3BA 5C7IO 4HFRA 1CETA 1QORA 1NASA 3JD3A 1DHTA 4JP3A 3PHIA 4XB2A 5ICMA 3JD1A 5FFFA 2DPHA 3BMQB 4Z3KA 3RKRA 4WCFA 1ZK0A 5I8ZA 4QECA 3IL2A 4PRLA 3AY3A 3ZNPA 3JQAD 4DLBA 5ITVA 2NVUB 3DBHB 4ND2A 5I9LA 4HXYA 5KVCA 4R5HA 3MCVA 1H9AA 3TFOA 1G1AA 3WTCA 4IMRA 4E2ZA 4CR7A 4BGUA 3SJ7A 1ARZA 2BFMA 2PKRA 3DBVO 1NNUA 2Y05A 4Q3NA 3LC7O 1E3EA 3ICPA 2B0JA 3SX2A 4DWVA 1HYGA 1I3LA 4YYZA 1FDUA 4DIFA 1SB9A 3EK2A 1MLDA 4YEDA 1I30A 3JQBC 3PVZA 4FR5A 4DVJA 1UXJA 4PLGA 4HFNA 2AE1A 5G0UA 3ZWOA 5AYVA 1AXGA 2V6MA 3FD8A 1PL7A 1CQIA 1HYEA 1XIVA 2RIRA 4QTZA 4D0RA 3PZRA 2CVZA 2E37A 4CM5A 1MX3A 3WMXA 1I32A 4QO8A 3DZBA 5GMOA 4AJIA 3AU9A 4NQZA 5KIAA 1EUCA 4MVJM 4IJUA 1DLJA 1Y8RB 1G0OA 3ZV5A 5A04A 3H3JA 3I9LA 1DDOA 5JBIA 4INAA 1UP7A 2VWQA 3GAFA 3O9ZA 4J91A 1BW9A 3VPFA 3N7UA 1KEUA 1YO6A 3LT0A 4FD3A 4CLRB 5IFLA 5A9RA 4JN6B 1VJ0A 4E32A 1KERA 3C1AA 2VRCA 1EUZA 1ZEJA 3AFNA 3AUUA 3DMYA 4NPCA 4E0BA 3QV1A 4BGEA 4NZ9A 2H9IA 2IXAA 4C7JA 4XEHA 3MWEB 3FNGA 4B4OA 2P91A 2I5PO 3UXYA 1EK6A 1PJ3A 1Q2XA 2Y0CA 3PZBA 3I52A 3E1KA 5C37A 2Q4EA 3S2GA 3ETEA 5K0ZA 1YVEI 4BNKA 1PJLA 1SZJG 1VJ1A 1XELA 1U9JA 2XXBA 3RKUA 3TJRA 3UW3A 4EDFA 3DOOA 1BG6A 1FXSA 2JKVA 1I24A 3IKVA 5LC1A 3F1LA 1ZXLA 4CJXA 1IUKA 4RPHA 4NR0A 3ASVA 1Y1PA 1MC5A 4BV8A 2BD0A 5EQDA 4R4JA 3RSHA 4DL9A 1PQUA 3KBOA 4PG6A 5DP1A 3ENKA 1MFPA 3JQ7B 4MO2A 5JYEA 5L51A 4MVJI 1PZFA 2C59A 3I83A 3WSVA 2P9GA 5BSEA 4LGVA 3VDQA 4PLPA 3HFSA 5DBIA 3DBLA 4O0LA 4E21A 4CM4B 1CIVA 2B36A 1DB3A 3EW7A 5CHEA 1FF9A 5AXBA 3W8FA 3OF2A 2VOEA 3HDHA 3WQQA 1XU7A 3F4LA 4J6FA 4DYDA 4U6SA 4BKOA 2FOIA 2Q1UA 1NVGA 3WQSB 4U8GA 4BNWA 4D46A 1NQTA 1UH5A 2OGUA 3NGLA 1I3NA 4F45A 4Y9DA 4BNFA 1BSVA 1BRMA 1SEPA 4BB6A 4IJKA 3R3JA 2EGGA 3VDRA 5CDUA 2I99A 4IINA 1EFKA 4QQRA 5F5LA 1HE4A 3W4KA 3ZV6A 1QLHA 1B7GO 2FSSA 3PWZA 4LCJA 5TSDA 1Z7BA 8ADHA 3U5TA 5HM8A 1N7GA 3DMTA 2Q1WA 3P2OA 2DKNA 1BVUA 2J3KA 5DCYA 3AOEC 3QWIA 1CF2O 1Y8QB 3NKLA 5G0SA 2O2YA 3B1FA 3OMLA 1OZAA 2JCVA 4RF2A 4B7XA 1O9BA 2Q46A 3FPCA 3PIDA 3GY0A 1VI2A 2B4QA 2ZJ0A 3WX0A 3DZGA 1S7CA 3GGPA 3JQFC 5B4UA 2LDXA 4EJ6A 5IZCC 3JQFA 1HTBA 4CMCA 1E7RA 1LEHA 3O26A 4GMGA 3QRWA 1YONA 2GN6A 3LC2O 1JVSA 1JA9A 3C7AA 1Q0HA 2EP7A 2BHLA 4E5NA 4ZICA 5T8KC 4J49A 4NU5A 4YAIA 1LNQA 5CDYA 1GR0A 1DRWA 2BH9A 4MP8A 4PVDA 1R4NB 2RH8A 1NFQA 2JFFA 3KYDB 3OJEA 4GVXA 5BSGA 3DAPA 4IQ0A 1QR6A 4JROA 4M8SA 2X8LA 2ZYDA 3ZWAA 1K6XA 3MZ0A 3RAJA 4BNXA 3KETA 1M67A 1NQ5A 2Y1DA 2CSUA 5EINA 3JYLA 4R9SA 1WWKA 3RUHA 1I10A 1PZEA 1E7WA 4BNVA 2O23A 5L45A 2XOXA 1LRLA 1ZMOA 4BL5A 1JKIA 3RC9A 2YYYA 3HWRA 3WS7A 3K92A 2QYTA 2P5UA 4CM1A 1ENOA 5KVSA 1P3DA 3NEPX 1P0CA 3ZU2A 5T67A 1XU9A 2D0IA 4UUOA 4BGVA 4BNLA 4G5HA 1CJCA 4I9NA 4PLWA 4WOKA 4WNIA 4OAQA 2VUUA 1FDSA 2CDCA 3DHEA 3I6IA 3H9JA 4H15A 1VL0A 2R00A 1ZK3A 4BO3A 5KCZA 4IUYA 3UUWA 4EZBA 1SNYA 1R16A 4O63O 2C2YA 4WCFC 4ZGWA 1PJCA 2HQ1A 3GN2A 2UUPA 1IPEA 1WVGA 4O59O 1ML3A 3QP9A 5HBRA 4O5OA 3CZMA 4NK5A 1V9LA 5MGBA 2VZ0A 2PD6A 3QSGA 1ONOA 1L7DA 1NWHA 3L9WA 4E30A 1NQAO 4BNJA 3U62A 5TNXA 3OA0A 3FHLA 1EQ2A 4ZU3A 4NK4A 1FDTA 3AK4A 1T4DA 3F46A 3D4PA 1V6AA 1C1XB 3JD2A 3ROMA 2C29D 1H94A 4RVHA 3VH4A 4CLOB 3COSA 1U3WA 5B1YA 4RPGA 2GCGA 4BO4A 1Q7CA 1XDWA 4BO7A 4UUMA 1E1KA 1PWXA 2A9FA 4YJDA 4EBFA 4MKRA 4KUHA 5A5FA 1R15A 2DUWA 3NT5A 1LLQA 1JDJA 1VL8A 1PJBA 3WYCA 5DZSA 1DIHA 3TZQA 2YDYA 4IZIA 4J90A 3WWYA 2Y0DA 1Y9EA 2DUUA 1D3AA 3GZ4A 1T1SA 3OJ0A 3VOSA 5TT0A 1WMBA 3ANNA 1X14A 4J1TA 3BTOA 3AWDA 1NWCA 4RVDA 1CQJA 3KYBA 4PLCA 3U0BA 4DPMA 2X23A 4AJEA 3LC1O 3TSCA 3RI3A 1W6UA 1DAOA 4KWIA 2VYVA 1JWBB 1M76A 2YFQA 1A4IA 1H6BA 2IE0A 3FBGA 5JDIC 4IDGA 1HLDA 4UULA 4FGWA 3KO8A 3E18A 1ORRA 3L0DA 3PGXA 3C1TA 3ZNNA 3GPIA 5K6AA 5LDGA 3S2FA 3GFBA 4PVCA 1DFIA 3IIEA 3ZWVA 4PG8A 1RYDA 4R16A 4IMPA 3GOHA 2ZTLA 4JX8A 3WLFA 1I01A 2CMDA 3GR6A 4ZN6A 2GZ3A 3RC7A 4PG4A 5A02A 3PFWO 1E92A 1GDHA 3Q0EA 4P22A 2O48X 1XWFA 1F0YA 1Y5RA 2EEZA 3ETGA 4GSKA 5KJEA 1UJMA 3QVXA 1LU9A 4IXWA 3VKUA 3INTA 4FFMA 3KEQA 3WG9A 4DQXA 3NAQA 2DBVO 1JW9B 2JCXA 3E82A 3BAZA 2VYNA 2FR1A 3OQ6A 1BDBA 3GLQA 4I08A 1B16A 1I2CA 4CLEA 4AJOA 2IZZA 3L4SO 4N5NA 4W99A 4YXFA 5JE8A 2H5LA 5EL0A 3F9IA 1M2WA 4A5OA 3H3FA 3PJEA 2HO5A 2FN7A 2A92A 5EMHA 3RFXA 4FC6A 3A06A 4BO2A 4XYBA 4R54A 1KVSA 3H65A 4Y67A 3ZHBA 1B14A 3SC6A 3GGGA 5T57A 3EYWA 3UF0A 5DCWA 1U3VA 4HWKA 5HWSA 2AQ8A 4CM8A 4ALIA 1GZ6A 1NAIA 1PJSA 3GUYA 2GO1A 1GADO 4RF4A 1YDWA 5EESA 1E3WB 2AG8A 4PG7A 3AFMA 2P9CA 3VPXA 2G82A 4NJOA 4YJFB 4XDYA 5IF3A 1OI7A 3PQEA 3R6DA 1O94A 4RVFA 3SVTA 4J0EA 3ENNA 3KSDO 2JHFA 4R1SA 4DRYA 3D4NA 2D8AA 3ZN2A 4ZJUA 3AI2A 1LDYA 1H0KA 2X7HA 2Z95A 1AN9A 4Y6RA 5CG2A 1K5HA 4WLFA 1PGPA 1N92A 2QYSA 2X0IA 4FFOA 3L6OO 3HHPA 4FPXA 1PX0A 4F6CA 1FJHA 3BHIA 1GTMA 2EW2A 3E9MA 3RD5A 1F14A 1LX6A 1U3UA 1WZEA 3T7CA 2XF8A 1ENPA 2W98A 5L4NA 3ST7A 1KEVA 3OHSX 4TRJA 4BNUA 2EJWA 5JDIA 2IODA 5JLAA 1UP6A 1SEVA 2HCTA 1P1IA 2O2SA 1OAAA 3PWSA 4H7PA 2QX7A 1PGOA 3ZHXA 3WIEA 5IDYA 3NX4A 1GZ4A 1P1RA 2YUTA 3D0OA 2J3IA 1VL6A 3PLNA 4O1MA 6LDHA 3P7MA 3W8EA 4FFLA 3PTZA 1E7YA 1HDCA 4Q9NA 5BQFA 2EKQA 4L4SA 5JO0A 1HF3A 3OQBA 3Q11A 2A4KA 3P19A 5AXDA 1C1DB 3VTFA 3JV7A 2Y1OA 2ZTUA 4D45A 4KTTE 5GZ1A 4R51A 3TFQA 4D42A 1XQ6A 3BIOA 1GYPA 1BW9B 5CDTA 2HAEA 3TL2A 3HQ4O 5G2OA 2Q50A 3ZWYA 5JAZA 5KKCA 1RWBA 3OSUA 3L6DA 1LRJA 5I7EA 2JD1A 2HLPA 2O3SA 4MVJE 3UICA 3H9EO 5I7FA 4NG5A 3FBTA 1F12A 4DXHA 3AM4A 4ROSA 4M54A 5IJZA 4RCVA 3DQPA 1K89A 4R69A 3PHLA 2VCYA 2QIOA 4YAEA 5ENVA 4YVFA 3IP1A 5THQA 1NAHA 2BGLA 2BMAA 2WYWA 4AL4A 5JW6A 5KWEA 4UUNA 1UDCA 3RC2A 2E49A 1E7SA 3OH8A 3IUSA 2DQ4A 3TQHA 3D3EA 5EN4A 4G65A 3ZNQA 3V2UA 2BKAA 3DAGA 5MDHA 4BS9A 4AJ4A 4YJHA 3AY7A 3TN7A 5B12A 3KRTA 4OIMA 2FHSA 4GBJA 4OKIA 1C3VA 1MUUA 1I8TA 4E5PA 1T2EA 5A5EA 1HDZA 3WTBA 3VC7A 1YWGO 4D41A 1I33A 1EMDA 3WJAA 1HSZA 2XXJA 3GFGA 5L7WA 2GDZA 3BMCA 3IUPA 1QV7A 5EQFA 3KOUA 4UVEA 1N8KA 2ZQYA 4RPKA 3MTGA 2NADA 2PY6A 1BXZA 1ADGA 3GRPA 3B20A 3GN1A 4QUKA 5DULA 4UVDA 2ZJ1A 7ADHA 4XDZA 5JSFA 5TLSA 2AMFA 1GQYA 1JAYA 4WNCA 1A71A 2GNAA 4CV0A 3DZKA 1XYGA 2BF7A 9LDBA 3QVTA 2VHXA 2HDHA 3B1KA 3I9OA 4GGPA 3WGQA 3DBHA 1X1EA 1PR9A 4PLTA 1AHHA 5A05A 4AICA 3ICCA 4LMPA 2HMWA 2PTGA 1E6WA 3NTOA 4J1QA 4JLWA 3CUKA 4N7RA 4B3IA 5A3JA 4PFJA 4CL3A 1HDOA 4RVGA 4XIJA 2AE2A 3T7EA 4HADA 3QJ5A 4JXKA 4MIOA 4ZRNA 5JDCC 3ZV3A 3C7DB 1L7EA 4RQTA 1QKIA 3B70A 1EFLA 4OXYA 1R0LA 4I5GA 3WLEA 3UH1A 4BNHA 4JP2A 1LSSA 2WSBA 3GNTA 1N7HA 4GX5A 4Z3DA 2G1UA 4GL4A 2H6EA 2C20A 3LVFO 4PN3A 3QWHA 2GN4A 4HKTA 3OFSA 4GWGA 4AVYA 4BGIA 1DXYA 1PGNA 1C14A 1Y81A 1YB5A 1NBOA 1TEHA 4KUGA 4J0FA 3BMNA 4DTIA 5IN5A 3EZYA 1PS0A 3W4JA 3QQPA 3UCXA 4HNGA 1GFSA 4UVGA 5G0VA 4FC7A 1CERA 1YE3A 3AM5A 2AQIA 1NFRA 4YRAA 2ZATA 4R1NA 4YDRA 3JD4A 2YJZA 4IQ8A 5C7OO 3PYLA 1L1FA 2AQKA 4E5YA 1DBVO 3T4EA 4CQLA 1K2WA 3OEYA 1Q0QA 3DMTC 5ILGA 5JDCA 3AUAA 3LLVA 3M2PA 2Y1FA 4BNIA 4IS3A 3UAGA 5JMWA 4LRTB 5C5IA 1LJ8A 4P4LA 4GKVA 3NDJA 2NVWA 3KYCB 1X7DA 5IDXA 2GUGA 5IG2A 1Z75A 5CEJA 1BVRA 1NHGA 3RJ5A 4U5QA 3PJDA 4I5FA 4NBTA 3IKTA 2DAPA 4DMLA 3LYLA 1B0AA 4RJTA 5CEFA 2W2KA 2EIHA 3KEOA 4B3HA 4BO0A 3OM9A 3S1LA 1PL8A 2QRJA 2PNFA 4UEKA 1KS9A 1WAMA 2D3TA 5TC4A 4GX2A 5TX7A 1HDRA 3D64A 3JQ9C 1Q1NA 3E9QA
chains in the Genus database with same CATH superfamily
4LJLA 5FWXA 3QMMA 4FHCA 2O4CA 5C1BA 4OYLA 3IP3A 4Q1FA 1C3LA 3VR5H 3VU9A 1ADYA 1R00A 4LMRA 1T4GA 3IVMA 1S01A 3NFRA 4MLCA 1TUBB 4XRRA 1EIZA 1H05A 3OY2A 5FL7A 5H81A 2DGDA 4CF5A 3WE7A 1XPJA 3NVKI 5DX0A 2C3PA 2C31A 3NTUA 4YJFA 3WDSA 2P78A 3J81k 3FJOA 3U48A 4LI0A 5JV5A 3H83A 2RHRA 4G0YA 1I6MA 4M1KA 4XUCA 3FLEA 3O2NA 5KB3A 3CZQA 4KXQA 2HLNA 2O14A 1C0EA 4F2WA 4TS3A 4G4IA 2IOFA 1ZLXA 4H9GA 4C0WA 1VSTA 2AZDA 5KEIA 4HBZA 5LNK6 1R9JA 3IMKA 4XM2A 1LRKA 4J0IA 1RZVA 2RG1A 1A8PA 3PFKA 3FMIA 2HJGA 3VNAA 3GT7A 1UOQA 4FYYA 2B4TO 3MJSA 4A91A 4Z2AA 3F6RA 5DYYA 4R6WA 3VUFA 3ANSA 4HNQA 2FGJA 3RO7A 4YREA 5EWJA 1EXDA 4YQYA 3DXYA 3JYHA 3M4NA 5DSZA 4OB8A 2PM8A 4X61A 1YHNA 4IIUA 3VSDA 4W8OA 4ZI3A 1A8IA 2X9NA 4EHAA 2XQFA 1S1MA 3MT0A 2FSVC 4FYMA 2BFAA 2RH4A 4ZA2A 3MG9A 3U61B 3K73O 2LP4Y 1FW8A 3KJFA 1JRLA 3L46A 1JSRA 2RBGA 2H5JA 2HZ7A 3L8ZA 3P9NA 2VYFA 5G4KB 4MTLA 2GLUA 3TAUA 1WZ2A 3I34X 1DSSG 3BPSA 4CTKA 2XE7A 4R1QA 2X8BA 2ORYA 4K81B 1TVEA 3AJRA 2ZIUB 1XQ1A 1AS3A 3EA5A 3I3OA 4TLCA 3WLQA 1V2HE 3PGA1 3U16A 4Q34A 2NZUG 3AHFA 5D5HA 3DOEA 5TR9A 1C9YA 1RMYA 2RGDA 1DZIA 2XX3A 3IDFA 3QVWA 4ND7A 1T6YA 4YJ3F 4CV3A 3U39A 5GJWC 5AIBA 5IABA 1YJBA 2ISCA 1FRVA 1Z0DA 2G72A 3MWFA 1HQKA 2IPNA 4DUPA 1G38A 2HT1A 3SJAA 1OKKA 3WIDA 4CIAA 2EFGA 3I5UA 2OO3A 3LWNA 2IDZA 1MGOA 1TF5A 2IQIA 4RXMA 2J5XA 3GNLA 3KLMX 3M70A 1TUEA 2Q41A 4MRPA 4IGEA 4MX8A 5K3EA 4M3NA 2R8ZA 2C0CA 3GG2A 4CLDA 2CSXA 1G4HA 1XFDA 5L4LA 2YW9A 4DR5B 1M73E 1O97D 5K0LA 2I6GA 3AOEA 5JSZB 1A4UA 2WZQA 3QGMA 1ZU5A 4MVXA 4H60A 3JTMA 4ZJYA 5AVYA 5IDWA 4CBVA 2OCXA 1RKXA 2X5KO 1JJBA 3FR7A 4N03A 4WCFB 4JI1B 2PUFA 3NWJA 3KB6A 1MBZA 2E55A 3GPDG 4Q6WA 5EJMA 1WB5A 1UZMA 2ZTMA 2SKCA 4KO3S 3AVQA 1CP2A 4X84A 2P27A 3BJIC 1KKMA 1U2GC 1AXEA 1E5QA 1ULHA 4M21A 4XE5A 1S2DA 1ETHA 4ZO6A 4ZJPA 1ICEA 5B5SA 5HTOA 3WBFA 1ITZA 4KDCA 5AJYA 4C0AC 5CP8A 5FA6A 2IYZA 5LD2B 4M8IA 5LWHA 4B4VA 3GFOA 1FXWF 2OM2A 2ZS8A 1DKOA 5HG0A 5B2ZA 2J5BA 2FFAA 2EF1A 1G20A 1U6IA 1XL1A 2XUAA 3I01M 3K15A 2ZBQA 5F77A 4KFUA 3I6QA 1AHIA 2B8WA 1R9GA 2BLLA 4B8WA 3L49A 1MVNA 1EFAA 1WCIB 4QUDA 5JS6A 3B5IA 2I4IA 4H7KA 3LO8A 4F93B 4DFDA 4YAOA 5LFAA 2MSLA 1FXUA 4ENSA 4BQNA 4JZYA 1COWD 1BGWA 5FFNA 3TUJC 3WMWA 5BUSA 2BEVB 3H4TA 3I72A 4GRAA 2WWVD 3DR5A 3QKSA 1IUNA 3FNHA 2WAXA 4GNKA 2EBUA 3OU7A 3R0JA 1HEUA 2OMEA 3H6KA 2IBTA 1I1HA 1Y8AA 5BSKA 2VHYA 3NH6A 4EB6A 1Z4JA 3RK0A 3WSTA 3QPDA 4QX6A 3GVIA 2W42A 2WG1A 3LQ1A 3IUMA 1DADA 4W9NC 1F06A 4V39A 4I1IA 5DYTA 3RUIA 4F3KA 6CHYA 3I3SR 3NNSA 2H5IA 4II3A 4TKLA 1W59A 1KSGA 1YBAA 2E4WA 4H7HA 3CF4A 1X7XA 2B35A 2FPPB 2YY5A 4IJQA 4RD6A 4EGCB 1Z5PA 5CBPB 1P0QA 1XX6A 2B78A 3A7EA 2GCIA 1UK9A 1G3MA 2PJUA 4IAOA 3D3WB 1QFZA 3SEZA 5LIPA 5AI6A 4ESVA 3VU3A 4KO4S 2JIMA 1S3SA 1E7MA 1U0EA 1H8HA 3H4IA 1J9ZA 2QB5A 4EDHA 4TKVA 3L02A 1PP4A 3B89A 4HC4A 1AQYA 4AMUA 2GYWA 1XXLA 3ITNA 3N0XA 5CVTA 1V3TA 4BCDA 4J7XA 5G4KA 4BAZA 5KNCD 2BFBB 4ZVLA 4IXTA 2VHJA 4WHMA 2P9EA 4IS2A 3TLZA 4CMEC 4HVTA 2PKXA 2PCLA 4TMYA 1FX0B 1GG9A 3E22A 3A6HA 1U8FO 2P5SA 2VDPB 4MWOA 1PWZA 5KHLB 5M7EA 3DR3A 4JJAA 2FQ1A 4PC6A 1C50A 3UJHA 3VR6H 1V4VA 2GDJA 1SC6A 1C3EA 2Q5IA 2NO7A 2X7JA 2WU1A 1EJ2A 1OWLA 1SBZA 3DT6A 1RBZA 3EN0A 4IKPA 4KPUB 1GY8A 3EH2A 4BATA 1W0JD 2FQQA 4EVQA 4BN0A 1OY1A 1PQPA 5AM1A 5JS2A 4CMHA 7GPBA 3PR2B 1JEEA 4UTXA 4H2DA 1E89A 1YS7A 2X5NA 3K4PA 4DNXA 1DC3A 4XDGA 3V7WA 1M66A 1CLUA 2JD2A 3ZWCA 2SBTA 1WPGA 4IR7A 3QXCA 4ZVVA 3Q9UA 1BVYF 4ZVKA 5BMOA 3CVWA 2H57A 2NSDA 3CM0A 5EHGA 1AM4D 4QPPA 4DDHA 4R9VA 1EB9A 2JIRA 3NHLA 2WWFA 2AQHA 2J4FA 1D4FA 1SRRA 1UXHA 3RROA 2I9KA 2HF8A 1ACLA 1X0XA 2FN3A 2B83A 2H52A 3DO5A 2ZE8A 4KQWA 1VIMA 3F6PA 2GPJA 5ECYA 1LQ2A 4CV2A 2RHGB 1LXCA 4BQEA 4BECA 1SN7A 3RYFB 2XRMA 4AMYA 1IIBA 1M74A 2XKJE 3D6HA 1SIOA 3C8MA 2O57A 4QYXA 8LDHA 4YO8A 3PQDA 2IEZA 3R7FA 1EH5A 2QUIA 1WB4A 4CM9D 3WGZA 3D4OA 5T4BA 1Z3CA 5DRYA 2PBRA 4UTVA 1E79A 4YONB 1P9OA 5CT6A 4EI2A 4RC9A 5FPQA 1MT3A 1A5ZA 3QEBZ 3G8BA 3BQ9A 2G71A 2HV8A 3TLMA 1D8TA 1VRWA 4BBZA 4UEJA 4NMMA 3A1CA 2FW7A 4KDRA 1KK0A 1IOVA 2CVHA 3NOXA 4JI3B 3GFVA 4E5DA 3GMSA 4OMDA 5IANA 2P11A 4AYTA 4CIDA 4EJSB 5JWOA 3LT5A 1DBSA 3EVZA 3D6FA 4IOMA 4I9FA 5TVKA 2ZRCA 1Y82A 1DG3A 5EI5A 1KH1A 3NG1A 4KXUA 1ZH6A 1J9GA 1JKJA 3CCBA 3D2BA 1E2NA 2VAWA 2I1WA 4GBGA 4Q9KA 4QYSA 4I1YA 2O4UX 3RFFA 1XTJA 1M2HA 3LFHA 1R3UA 2JZCA 1Z13A 3A27A 3OQIB 3BTUA 3RCBA 3CUEF 4M8KA 4TRMA 1DCMA 1UK6A 2JAWA 3HVRA 1AG9A 4IFBA 2CD9A 5CJPA 2I54A 3D8RA 3TQCA 5KYWB 3FCEA 3QKIA 5JNVA 5CIYA 2OUIA 4H27A 3TLKA 3CSSA 4PLHA 1RKBA 5K0NA 4ZO7A 2CUTA 2X5OA 4RAQA 4WZAA 2GPWA 2GCPA 4WZ6A 1RM3A 1VLMA 4JUBA 2X9LA 1YQTA 1ISIA 3I8OA 4YBZA 3SK0A 5KREA 2NUTB 5BSTA 1TM7E 3LT1A 3UWDA 4DSNA 4Z7JA 5E1OA 1QZ3A 2CNNA 2FF7A 1RMTA 2GJ4A 2WQZA 3KZCA 2EJVA 4IRXA 3MLAA 3ZE0B 3Q12A 4D43A 4EL5A 2CZCA 1PEKE 3P2YA 3EJ6A 2YJ3A 2VZ9A 4HZGA 4CM4A 2XMPA 4P7GA 4P6VF 4OGWA 1A69A 2WU8A 4D9GA 1NBIA 3AEUA 4D56A 2P1ZA 2WMNB 3BMOB 4LE0A 5T4FA 4GKKB 3HPQA 3HKDA 2OCAA 2XV1A 3AILA 3LQRA 1T35A 2B98A 3EXIA 3M1AA 4I4TB 1MAUA 1Z2EA 4NOMA 1XRMA 1ESZA 3AI3A 3B7WA 4JIGA 2PD3A 3NWEA 5ICGA 3UHAA 4YCJA 2Y0PA 3CX8A 4HDQB 4YWJA 4DBVO 1KRHA 5JAHA 1IJKA 1UM8A 2F3PA 4DMMA 1GKYA 1SAYA 4JBLA 5IJXA 3M2TA 1PDOA 2OK8A 4OY3A 4TTTS 3KSUA 1XJWA 4AJ1A 2UU9B 3MFYA 2F8LA 1H5QA 3FSRA 2HBQA 3FCYA 4P5EA 3F97A 2YNMD 3ORFA 1GGJA 1GNVA 4ZK6A 4YBRA 5CW1A 1PZMA 2C4KA 4Q1DA 4CEIB 4TPKA 2ZBGA 3GV0A 3K32A 1GPAA 1CXZA 1SMKA 1UP4A 4DWWA 4I9HA 2R7LA 3KZKA 1NOKA 3H7IA 5J4KA 2OL4A 1L8LA 4MMYB 1FQOA 2CCKA 5D3KA 1WKVA 3P2IA 2PT9A 1WXDA 3OOYA 1QYXA 2R84A 2YWFA 3UGQA 4LF9B 3H2HA 4YA6A 4C20A 4C7OA 2C0QA 4RMJA 4CCYB 3L7NA 5HDBB 3BJRA 4IV5A 3X1XA 5DKFA 2C4HA 1DRJA 4IKEA 1VZ2A 4HBGA 3A3OA 4YJGB 4POAA 1IN7A 1J22A 1B93A 3UFXA 3T1YB 2Q62A 3RUEA 1E6LA 4ECAA 5FB3A 3GIDA 4L6CA 4N5DA 5FF9A 3VR2A 5JY1A 1JU9A 1WUYA 5IZ4A 1L6RA 3H9UA 3R2JA 4LK3A 2QG6A 4A8JA 3JVUA 3P2KA 3NTXA 4I55A 4COOA 4WECA 2D1SA 2C4NA 4RSHA 3GZTB 3W78A 5C46F 1BYIA 3IKLA 2CJPA 3QOXA 2GAIA 1FFCA 3AL3A 1R0BA 4DEXA 4EGQA 5CH8A 3TQQA 2OFWA 3O38A 3O8OB 3T7DA 2WHPA 3G89A 3IO5A 3AERA 3K0CC 1VKRA 4ND5A 4WV3A 1GZVA 5HFNA 3OZGA 3SMVA 5DX1A 5F64A 1QDUA 4P7BA 3ZW9A 4UPEA 5H80A 2QAGB 2IS6A 3KTAA 2Q2OA 2YY6A 1U80A 4EAAA 1P1FA 2ZI6A 6REQB 1P31A 2EBFX 3DEZA 5ANRB 5E8RA 4UE3S 5BRAA 1RD4A 1PFKA 1KK1A 4UCQA 5FYDA 5CCXA 3F3YA 1P6UA 1R7RA 1TCBA 2H0RA 3KALA 1FL9A 3G1TA 2DFVA 1I3KA 3VPCA 1I5EA 4RVUA 2BISA 3SZOA 1MR3F 4DB4A 2PVSA 1DFGA 2OSVA 2KHZA 3BRSA 1UFQA 3QF4B 1J2EA 4CHTA 2RHDA 2V54A 5JAIA 1MD9A 3AT1A 1J0XO 3R41A 4G0OA 1FMJA 1HSOA 1DQPA 4Y6PA 3C24A 1QS0A 5FYQA 1L4MA 3CZ4A 4OHVA 1DV2A 3E3OA 1JVBA 3TYXA 2C5BA 5I3CA 1TJYA 1FA9A 5SICE 3DOJA 5JNTA 2BFCA 1Q0LA 2WIAA 3Q9NA 1NDQA 3W3AA 5THXA 1X38A 2X0JA 4LKRA 4R1MA 1ISFA 3IJPA 2PL3A 4WY5A 1OCEA 2BDTA 4WQMA 5BURA 2QW1A 4RORA 4N3AA 3CEAA 1NXWA 1NLUA 2QM7A 3AUKA 3CPSA 4G1EB 4K1LA 5EXSA 3SBDA 4MR8B 2OXIA 4DJDC 3WGHA 3WICA 3HVUA 4YUAA 1V11B 4KP7A 3X1MA 1TGYA 3FI9A 5EIFA 4J2HA 1TT7A 4DIOA 3D7NA 4RDHA 4E12A 4EFDA 3M7IA 2JGLA 3PCRB 1KMNA 4ETNA 4JYBA 1U4OA 3FXAA 4G2TA 2CKMA 5KYKA 4YRMA 1OR8A 1W44A 3J81A 3GH1A 1V7QA 4YMTA 2UZAA 1R4NA 1E1NA 1Y80A 1Z83A 3K2QA 3KYDA 1UBCA 3M8KA 2JFZA 3ZQKA 3W5CA 4BLPA 1JLRA 1KSFX 3MMSA 3MXTA 4B5LA 1KEPA 3I5MA 4QOGA 1NTOA 2D74A 2H59A 5IEJA 2G40A 3FZEA 4MB6A 3VBCA 2GVZC 2G5GX 2JCYA 3AYZB 3JQBA 3KUDA 4YH1A 3TAXA 3WK8A 3QI2A 2DBQA 5BSFA 4BUZA 4YJKA 1XBTA 4CR6A 2B25A 3BEOA 3UC9A 1WMAA 1F4PA 1H4VB 4HLCA 5AI8A 4WN9A 3WKCA 1WZNA 4EEZA 1EFRD 4GPZA 1LBHA 1CY4A 3ND9A 4KNWA 4BASA 4EVRA 2WWRA 1F2TB 4BJ5A 4YS6A 5BNZA 4W1QA 3HYNA 2XF2A 4GI2A 1N6PA 2PMBA 4R7TA 1UDXA 5D5QA 3H5TA 2NXJA 1T1JA 1U2QA 4TMXA 2NAFA 3OHPA 1QTRA 2F00A 4URZR 5EVJA 5IVHA 4N8EA 3PGLA 5LXTA 2VDRB 1PWEA 1F48A 2FMKA 3ID6C 1Z28A 2B92A 1O96B 4XFDA 4ALKA 3M6IA 5FEUA 4MV0A 4QGGA 1CNEA 3UFXB 1R5JA 3BMCB 3OLQA 3E9DA 1WUKS 1DHRA 3DCJA 1NVUQ 5ITWA 4R2IA 1ZC3A 2ZI9A 4ALJA 2WOOA 2J41A 1N2CA 3N8NA 1F8GA 4D2IA 1E2BA 1EFRA 4G6ZA 4J4BA 3K2EA 3HRHA 1K8YB 3N2EA 5EKTA 4KXYA 2A1TR 1SCBA 3PXAA 4WZBB 5GV7A 1UBKS 1YI1A 2V6GA 6YASA 3G2KA 2RJOA 3U4MA 4AJKA 3X44A 4YRRA 3ZDXB 3GJ8A 2EW1A 4C29A 1ZOIA 1TIBA 4YT4A 3R40A 2WA2A 1PL6A 1LC0A 1ZZGA 4RPIA 3FM9A 1MIOB 3P20A 2JI7A 4JK3A 4DIUA 4QJ3A 1OXSC 3P5SA 5IVPA 1DS6A 2C98A 4IIDA 3CZ9A 2MYTA 2UZ0A 2MT9A 2WV9A 2XJ9A 5JU6A 3LF1A 3OT1A 5FDFA 3WKEA 3MVEA 3FMVA 4CW7A 1DBRA 3ZWNA 2X0DA 4PGFA 2GAOA 5BVGA 1B26A 4B80A 2OHXA 4BJHB 1W9HA 5FA8A 3GAZA 1OXVA 3WKBA 3F7NA 3PXBA 2J7PD 1XZAA 1X0VA 4JBWA 2Q3LA 2CDBA 1SG0A 4M0MA 3GVPA 5IJ0A 2DWQA 4HEHA 1V3VA 3C3WA 4PQGA 3CHYA 4BMOB 3L05A 1QG4A 2GS9A 1AUPA 1FU4A 3KZOA 2YIDA 5TF4A 1ADFA 2YWEA 1BWRA 4IWXA 1GTL1 5LYYA 5U4QA 3T3EA 5LQMA 3QI7A 2C3YA 3AR6A 2JGKA 4M7RA 5E2IA 2PRJA 1ENZA 1Z35A 2VWHA 3KT0A 1Y5MA 2QRLA 1H6AA 1E5XA 4NKRA 1C0KA 3I2HA 4MA5A 2DLDA 4Y2RA 3NCTA 5F52A 2QORA 3MWEA 1PE0A 2D4HA 3KKKA 5CM9C 4EUEA 4CIXA 1GCOA 4CMKA 4CMAA 1ZVQA 1SUEA 4H4EA 5ALEA 4BX9A 1KRWA 4MKFA 4BN4A 3LK6A 1B8PA 1K6JA 3AF0A 3T9CA 1NXOA 5EWMB 5AVSA 2YV2A 1UXOA 5LQRA 2ID7A 3KD3A 1XZHA 2YVUA 3ZGYA 4KRGA 1GFZA 4QXQA 4U02A 3Q8MA 2C54A 1XGKA 3OBIA 4N4AA 2GZAA 4MI6A 4BNNA 4B3GA 3WGOA 2X4GA 1PYOA 2VA9A 3W7AA 4X6UA 2EYQA 1IBMB 1N6NA 1FFHA 4MH0R 3C70A 3CNNA 1MKYA 1VDMA 1JFFA 4KPGA 1JQ3A 3CISA 4Z4HA 1X9GA 3DDUA 4CQMA 5SYNA 4JJFA 3TRHA 4J76A 2C7QA 4Q02A 5ES3A 4URFA 1KI6B 1SGWA 1X7YA 1E77A 2VDNB 3ADOA 4ZPXA 3KLPX 4TXHA 5AQEA 3VU9B 4BJ6A 4CI0B 2PRYA 1X7GA 3T5MA 4DIMA 3BIFA 4V0OA 3OAAD 1T25A 3JQDA 5AXCA 3CVOA 1XI2A 3RYHB 3AG5A 3RAEC 3JQ9A 2W6IA 3LBHA 1RWMA 1RP1A 1HXHA 3IULA 3TMKA 2L0XA 3WNDA 4L78A 4MWZA 4TQ9A 1MV8A 5KBYA 3EC1A 3KKMA 5A6SA 4F4FA 3LQFA 4LPSA 4R1PA 1E3QA 2G06A 2UV8A 1CY2A 3K35A 2PL5A 3I05A 4GBED 1EX7A 5FHRA 3V1NA 3U80A 2EKBA 3E3LA 5DP2A 4S05A 3F6SA 4CDMA 2NU6A 1NX6A 1NOIA 3HB1A 2W4QA 1SBNE 2Z8ZA 1OUMA 2CVFA 3CEMA 1TT5A 1DDIA 4OUKX 3VISA 3CSDA 3DD5A 3RVOA 3D5QA 3ESYA 2AFRA 3VR2D 4XWYA 3GLIA 2IIPA 3DH0A 3HU1A 3OO1A 2ILVA 3DFMA 4F06A 3W79A 1KRXA 2J09A 1GNQA 4GPAA 4B17A 2Y1EA 4D57A 4D9IA 1Y7PA 2IYAA 3KOYA 4Z7OB 1AGNA 1TQ8A 1K75A 4ZO9A 3THSA 1NIPA 3CLTD 2QU8A 1JR3A 3JZDA 3JQEA 4H4CA 1CVLA 3JCZA 4PC7A 5C53B 3FTFA 1Z4QA 2PX4A 1QHHA 1B6RA 2W22A 3Q3JB 2IPXA 2QUAA 3KAPA 3RF7A 2H4ZA 5KTTA 3LRPA 4ILKA 1XZDA 1NURA 5KYNA 2VTEA 1G5PA 3T12A 5K3BA 4RH0A 3BS4A 3M9LA 4NFLA 1AE1A 4BMCA 1CB7A 4UASA 4NH0A 5CK4A 1WZIA 3EDMA 4PC1A 3KVVA 5IDVA 1XC7A 2BBSA 4MZDA 4G4SO 4LXXA 1HETA 1FFYA 3AFIA 4M88A 5LCXA 3C5HA 1GSAA 1VC2A 3AOGA 3QEAZ 5ALMA 4EB8A 2ZJZA 3GJYA 1YV9A 2IRWA 3LPNA 3U7QB 2NYAA 5DLDA 5GONA 3RWMB 4NBNA 2NQTA 3L4BC 3MCWA 2E87A 3JQGB 2C2MA 1GSHA 2JVJA 4RHUA 5CA1B 4D1YA 4E6PA 1D04A 4W9RA 5D00A 2N1BA 3G9UA 2YRXA 5DLYA 1T2FA 4Q4AA 4M1TA 2PS0A 1W48A 1F6BA 3VO8A 4BJ1A 1HOTA 3KSBC 1Z33A 4G2NA 5F9MA 4RF5A 4I2NA 3T1TA 4PQYA 4JKYA 3U44A 4DSTA 3IXLA 4HATA 2VJBA 1SBYA 1ZVVA 2GERA 3OZAA 2PQ6A 1R6AA 1IWPB 5JXJA 2I62A 2QMEA 1PIWA 1IC6A 2RAPA 1RJDA 4PZCA 4OI1A 3V7UA 4OMCA 3DMHA 3JATA 4H3KB 1N6OA 3UAYA 4CLXA 3B36A 2QUJA 3CB2A 2LCIA 3LNTA 3G88A 3MPUA 4B7CA 5JZSA 2QUHA 3ESXA 2B6HA 2D5LA 5EWJB 4QGBA 4AWBA 1V8ZA 2DFKB 4DILA 4MV1A 4WY2A 4D74A 1JZQA 1G5FA 1L4UA 4BNTA 4MULA 4OU5A 3ZCUA 2I65A 2ZOSA 4MDHA 3UHOA 1QFJA 5BP7A 2CJFA 3R8FA 4OM7A 3DE1X 2BR4A 4QU0A 1OFUA 4Z0HO 1S4MA 4AJJA 1EVQA 6REQA 4ZOLF 2BZGA 5AHRA 2FSPA 2HQSA 4JHXA 4N5HX 1MXFA 3EQ8A 4XH9B 1E1QA 3K9LA 2DCMA 4M9ZA 3L6EA 4OQYA 1ZIXA 4AG5A 4EVIA 3E8SA 3RHZA 1D1QA 4PPYA 2B30A 2MR5A 4EATA 1WXFA 2WWHA 1CD5A 2NQ8A 4PC2A 5IP5A 5C8VA 1A2OA 4YCAA 3MAAC 3ZYCA 5K3DA 2BFNA 5CGZA 2WT4A 2BEWA 1P91A 4ZVOA 2NPOA 4DA9A 2JI4A 4E2YA 1H8EA 1P9RA 1U1FA 2VWPA 3ZZ0A 4PSVA 4GKAA 4I9UA 2C7GA 1D07A 4XJXA 3GQBA 1P2BA 1ZXBA 4MDYA 2QVGA 3C43A 3DP9A 3O4FA 5DWQA 1JXAA 3AW9A 3C97A 4WY8A 3OLYA 2XRZA 4KNYA 3KSMA 3NALA 4NV1A 3EXAA 2ZSUA 4CF3A 2J0SA 4BAUA 3JTEA 5ESXA 4MCHA 1PJ4A 1W1UA 1XTBA 3GJRA 5I9TA 5FJIA 2J1LA 1ND5A 5AHWA 2ZT8A 5I7VA 3LGSA 4XGRA 1TJPB 3A36A 2ORED 4W82A 3AERB 2ZUEA 2HIAA 3OZBA 3OTQA 4W1SA 3IEPA 4G81A 2QSZA 4XXHA 3BILA 3FKJA 2C42A 1TKCA 2A4MA 1M54A 7MDHA 4OYRA 2P41A 5INTA 5F98A 2AOXA 2HK9A 4YWHA 4R1LA 4Z8YA 1MG5A 3D0QA 2JH8A 4I4LA 4ND4A 2BIFA 4ALLA 3W0LB 2E4XA 3PUIA 1JEYB 3EHDA 2ODWA 1MXHA 3LUCA 1G6HA 1QB7A 2AIRA 2VSNA 1X1AA 1VE5A 1T9KA 1TLTA 2JEZA 2BUAA 2XRFA 5K8IA 3UCEA 5DM70 5LP1A 1H4QA 1V8DA 2OFPA 1RW4A 4EI7A 4OQ4A 3AR3A 1DJQA 4AX8A 5KOHA 5MFPA 4HVCA 5LLTA 1MQSA 1P8JA 1EA7A 1QYCA 3E70C 2W2KB 2GR9A 4LYJA 3TZCA 2P6PA 1R0KA 1VYHA 2WUGA 2YHIA 3JD0A 1T2DA 4WOPA 3P9QA 2XUHA 4KCGA 5CCBA 4JQSA 1WY7A 4RMNA 4D99A 2L19A 2W8ZA 3RAPR 2CLIB 1TFRA 1T15A 3TW8A 1FMLA 2EFYA 1I4TD 3MWDB 1RWPA 4RFSB 4XUGB 3PGKA 5I4BA 1NXXA 4NU0A 2JJYA 2XBUA 5HGJA 1KDVA 2R7MA 3JYOA 1IY8A 5FI3A 2A9QA 3H8WA 4IQ4A 5H70A 5HIKA 2IS1A 1PTKA 4MR9B 4KRXA 3NHFA 2QT0A 1SCIA 1VYVA 1CJMA 1ISGA 2XHEA 2DX7A 2HRDA 1A98A 2DBRA 2QGFA 4OLFA 3FGZA 3U26A 4RM2A 2HWYA 1GWNA 4GP6A 2JJQA 4F4HA 3PI6A 3A2LA 5BSVA 1TIPA 3T7SA 3TL3A 1M1YA 3MAJA 4RIGA 4WNYA 1EDOA 3TQOA 1UPBA 3T7TA 3U3MA 2OQRA 1XCGB 1DTEA 2B3DA 3GUZA 4HZUA 1IIRA 1Y48E 3WO1A 4QGAA 2XMSA 2FJ0A 2EX1A 3SEQA 4QXOA 4MEJA 5HIIA 4A2CA 1RZRA 3RT9A 3TAHA 4U1RA 4G1UC 3NRCA 3M4XA 1NRXA 5J5CA 1R6VA 2W2OA 3IIMA 1NPTO 2CUKA 4WK2B 5TJ9A 3SJBA 1LK5A 3MMPA 1VECA 4G09A 4PNZA 1ZU4A 4DIBA 4XR9A 1A77A 1FLNA 4MW2A 1YNOA 1SU6A 5EWLA 1WHSA 2JGNA 2ICAA 2NZ2A 1XP8A 4MW0A 2D54A 3MGKA 5LLDA 3L7IA 3FGNA 3FZQA 4ZVMA 2Z3VA 1SXJA 1T8YA 2FFBA 3WYFA 1W0KD 3GLIE 1KE1A 4IQGA 2Q7OE 4J0CA 4QFMA 3K5PA 1XTKA 1G8PA 3HBFA 4Y2VA 3CIFA 3LLUA 1XDBA 4XB1A 1M1YB 1W0CA 1E63A 3VNSA 3H9GA 1KOLA 1UOOA 4OQNA 3U9LA 2PU5A 5DSTA 1HO3A 5I5GA 2W6QA 5D3MA 2B4KA 2RI1A 3B5JA 4LV5B 3ZZTA 3WLHA 4D9NA 1DZ3A 2RKWA 3MMXA 5BV2P 3CN7A 4ZVNA 4YLEA 3IDSA 4GZ3A 4J9UE 2ZWOA 2B0CA 2JFNA 5ALNA 2I55A 3CXUA 3PNSA 3EIXA 1HYQA 1KKUA 2AYYA 1J2JA 2GK4A 3F98A 3LQ4A 5EMJA 4JVMA 5C31A 1RCTE 4U7GA 4XIIA 4HNUA 5JH7B 3JQAB 3NV7A 4JXXA 3K9BA 1XFAA 4ARVA 2QTFA 5ARDA 5IASA 1G8GA 2M1XA 1HRKA 4DV0B 1KH3A 2O2HA 4MGEA 4B1FA 1MABB 4Y98A 1C1YA 3HUDA 1Z25A 4XB6B 3ZHTA 3FRHA 3GAMA 3ZL9A 1KEKA 2O8CB 4MCIA 1JFVA 2PVCA 2RGNC 2EGHA 1ZN2A 2PGDA 3SBOA 1ZKMA 4MV3A 1OXXK 1MB4A 2ODEA 3OJXA 4NBSA 1EE9A 4H16A 3AM3A 3WAJA 4IVRA 5A71A 1ZJ6A 2VH5R 5K3SA 4DR1B 1QOZA 4J7CA 1Z07A 3VHRA 2ECFA 3G82C 3SPXA 1SKAA 3VH2A 1Z0FA 2FNAA 4ND8B 3U60B 1RLMA 1RHRA 2GN0A 2VQ3A 4MRSA 3LKBA 1DBQA 2IZ0A 5C34B 2YQ5A 5FTJA 1BDMA 3HCBA 4Y0AA 2JHAA 4GH5A 5CB0A 1IL0A 1EGVB 2OCKA 1DO2A 1NL3A 1FBTA 2QMZA 4N0QA 4YP9A 1J97A 3CLTC 1E9AA 5TQ0B 4DA4A 3TLEA 3DZHA 4W7IA 5H3LA 1RM0A 2D2EA 5DBFA 3SIXA 3I1YA 1J8MF 5K1ZA 3CEJA 4N18A 2YBDA 5HHTA 1I7SB 3T1VA 1AB6A 1Z5NA 4G1FA 5KYUB 3QUTA 3D4IA 4KTVE 1TC1A 3EXEA 3K6SB 4JEIA 5HZKA 3OZWA 4JVSB 4RZHA 1O54A 4F6RA 4QDKA 3ESAA 2PQMA 2ABWA 3KPJA 1JP7A 2P62A 3PXUA 3JZIA 5BOSB 3W4IA 1GCUA 1LWNA 4ZMRA 1JEYA 3TZEA 2PSEA 1YFZA 4NS4A 2VEDA 1XHLA 2NVUA 3WL8A 1QR2A 3OMWA 3S81A 3GCGA 4TUYF 1BIFA 3QF4A 4IUBS 3CX4A 3L7MA 4K8RB 1KIFA 5JAUA 4HUQB 2FMUA 3LDHA 4L57A 3W6PA 2WJYA 3OO0A 3TUZC 2Q6IA 2ZXUA 4GZLA 1WNFA 4C4SA 3GLKA 2PKQO 2HJVA 4NMLA 1TQ2A 2BEUB 4TT8A 2ZSKA 4JBIA 3HGQA 4NXMB 3GZNB 1BJRE 3DV2A 1EHYA 2ODNA 4QHSA 2B4YA 3WB9A 4ZOLB 4F9GA 3K1YA 5E9QA 4TRNA 5ER6A 2PBZA 4B7ZA 4KITB 1D9XA 2DERA 4K2AA 2WE7A 1A4RA 4C21A 1GAXA 1EM6A 1T5BA 1S8AA 3KHKA 2CYAA 3NXKA 3SX4A 4EEXA 3F2IA 2CZQA 3ZCTA 1DC4A 3DEHA 1U8UA 4G5OA 2R96A 4HNHA 1FYFA 3W1EA 1E3JA 1XRRA 1Z5WA 2BRUA 4K28A 1YZ3A 4M6WB 3IT2A 5JNSA 2H9YA 5FI1B 1Q22A 1GD1O 2EDAA 4W5JA 3EZFA 2OPBA 2HA3A 5CJ2A 5ENDA 2HNBA 3DL7A 2PWZA 3P9XA 5IUNC 1BNCA 2Z2JA 2CJXA 3KWMA 1GCIA 1MG0A 4W1PA 3NBKA 4YT5A 1ZM2A 2IZ5A 2WYVA 3GJ6A 5C32A 4WJZA 4KHPB 4QOJA 4UATA 3U37A 1RFGE 1PCXA 1VYTA 2CLHB 5FO1A 1HL3A 1V16A 2Q6VA 3CUVA 2AB0A 4KLNA 4ZAGA 3WQRA 5C8YB 5I6DA 4L8VA 1M1ZA 1FLVA 1G8JA 1TZ2A 1WSAA 4HCJA 4TTRA 1YJ8A 1W8DA 5CLQA 3HEMA 1XCMA 3WAKA 3NWPA 3DWEX 2ISSD 3HLKA 4GYWA 1BX0A 4RTPA 4EGFA 1TB4A 1KP9A 1A1VA 3QOWA 4U6QA 1U0JA 2SCUA 1BFDA 1WO8A 3OIUA 3W2EA 5JTTA 2Y3IA 4Z4FA 2X86A 1I6LA 5DWVA 3FPJA 2Y27A 4PXSA 4AI6A 4JB3A 4PHGA 5FBWB 1T0IA 2WDPA 1JYEA 5IC5A 3RBVA 3PXEA 1XRQA 3WP1B 1XHEA 4A1FA 4RGVA 1YZTA 4PU0A 3UCFA 3HXMA 3UAZA 4UXJA 3L4JA 4UEOA 3WLNA 1J9EA 4ETWA 4JP1A 2HOQA 4M53A 4B2LA 2WWWA 5K4GA 4DJJA 1U7XA 3HO8A 4NBUA 4Q16A 4FU0A 1ZITA 4QXAA 4UUQA 1GTJ1 3JQ8A 1II8B 2IYSA 4AZWA 2QS9A 2W83A 3B85A 2ZIXB 2WA1A 3ECAA 2XVXA 1JG3A 1XMSA 2QQ5A 2YZGA 3A1VA 3TVYA 3WIBA 4KDFA 1JSZA 3CZCA 1XZKA 1SQ6A 2VT3A 3FMOB 2JCSA 2R7AA 4KQHA 1LF5A 3ZE9A 1GDDA 3F8TA 4YJHB 1IOZA 2FSGA 2QXYA 4PFKA 1R4MB 2D1FA 3A1FA 3IJRA 1ORTA 2IYOA 2V7EA 3L01A 3WRXC 2WM9B 2ODQA 3HSKA 4HD8A 5K5EA 5IT9A 2VP9A 7YASA 3AEQB 1ZFNA 1PJ8A 2V55B 1V1MA 3ES9A 1JQBA 3IUEA 3QUQA 4LECA 4U7HA 1G2IA 4LXYA 4GI3A 4NNPA 4WCDA 1YUNA 3N2ZB 4RH1A 3IUBA 2AA3A 5CT5A 3SSOA 4BFCA 4CQJA 1QWSA 2QQFA 4A26A 5J58A 1E2MA 1JKFA 1ZJ4A 1X1DA 3HL0A 2NV0A 3OEEA 5LSAA 1KZ9A 1QHIA 2VRBA 2CK3A 3GDOA 1T8UA 3GEPA 4R7ZA 2XCLA 4KQJA 2QXTA 5HTKA 5U9CA 2XGGA 2H2DA 2R87A 4XQ9A 1T8RA 1NUAA 1MO4A 3N8KA 1D7OA 5TQVA 3WHIA 1TF7A 1SC9A 5G1NA 4WLVA 4YJ2B 1GQQA 1KBOA 2PZBA 3SZRA 1AKWA 4F4UA 1Z82A 4YALA 3VX3A 1GAJA 1Y8CA 4TLDA 2VJPA 4XWTA 1GHTA 5KQMA 2VG8A 1PV2A 3F3MA 4L07A 4BWFB 2CFTA 4D8VA 1F0PA 1KY3A 3V1MA 1YKSA 5F7OA 1NBME 4E14A 3HTXA 4LJ5A 2FWAA 4FSDA 4B87A 1FEZA 4QQ8A 3T9AA 2X3UA 3PITA 1J70A 3KQWA 4EY7A 1OI2A 4UOZA 3I2GA 1RC0A 4MSUA 4OM8A 4AZTA 4BMSA 5ALQA 2XKKA 3HB7A 2IVFA 1N5JA 2FZVA 4J4TA 4Q66C 3W90A 1KIAA 1RCUA 1QQBA 3PJGA 1PD1A 2IIBA 1XVTA 2ZUDA 2VEOA 2ZWMA 1M2JA 4HSEA 1EHCA 1RQGA 4QHTA 2ZI5A 3L77A 4GGOA 1L3BA 3N8HA 5BNWA 5CFQA 1Z7WA 4CKEB 2VCEA 2FWIA 1NT4A 4M49A 3VBEA 3LK7A 2ZBUA 1ISRA 4MYCA 1WD7A 2ZYHA 3A70A 1P62B 4C06A 1WP4A 3IAUA 2YNMA 4B4UA 2Z3ZA 4ES6A 4IYJA 2XB8A 2OAP1 3G2OA 2PRSA 2AOWA 4HHEA 4N3CA 1T6BY 4DA7A 5ILOA 5HQ3B 1ONBA 4F9EA 3WB0A 1DJMA 2EZUA 1X1SA 4RA9A 3VR6A 5DT9A 4DC0A 3P5BA 4DLLA 3S99A 4LDPA 3K9HA 3UN1A 3QEMA 4R6XA 4ZIRA 2Q45A 4QATA 3A28A 3GRKA 2EBWA 4LG1A 3BULA 4MP6A 4LYEA 1KJQA 2ATEA 4CQMB 1TQDA 1ZM9A 1JEDA 3UXEA 2FMIA 2PX2A 2YXDA 5DN6D 3ZDEA 4L0QA 1HQCA 3HB4X 3DTTA 2C9YA 2OORC 4E33A 3FNFA 4G1BA 1J49A 3V4LA 4LXTA 4Q3LA 2BFDB 3I9JA 2RGWA 2G17A 3S2EA 1GGKA 1VFNA 2OHGA 3D6UA 1TTTA 4YMSA 2JAQA 4MI1A 3B51X 1JHDA 1U8ZA 1WU7A 1S96A 1YB1A 3C14C 3GLHB 3OZFA 5KOIA 3ICVA 3DT9A 3EWSA 3WYBA 1GL6A 1QGDA 2Y67A 3VM6A 1YZUA 1W30A 3W9SA 1OYOA 2UYGA 2HSWA 4GOXA 3EVGA 1WX1A 2JAXA 3NATA 4Q3AA 1VBNA 2OUKA 3R5JA 5JXGA 2A9RA 3FUWA 3QOFA 4X1KB 2I78A 3AI1A 4ZOQI 2GKOA 4FBGA 4PNHA 4O2AA 4OYHA 3U40A 5B3KA 4CUZA 1QRDA 4LFBB 3C98A 2VL7A 3DTYA 3M9WA 3NAGA 3OI7A 4P81A 5E7IA 4QOSA 4BGDA 1JLLA 5KQGA 1ONPA 2QJTA 3OQOA 2JKYA 1M8PA 1T36B 3QVVA 4M1MA 4MZXA 4L9WA 4XIGS 1UT8A 2QD5A 5SYAA 3ANMA 3A1NA 2BZSA 4FMBB 4LE2A 5CLFA 3HYRA 1EPUA 1V5IA 1H1LB 1Q7TA 4BCBA 2RJNA 1T5TA 5A3SA 3GT0A 2EXXA 4ISCA 4NXNB 1B2LA 1C81A 1UANA 1M5TA 3KWFA 2P0AA 4OA8A 1LBIA 3H11B 2VHZA 1CHDA 3QFFA 3ZIAA 1FSFA 1Y63A 2JGRA 1RZUA 4XGNA 3DKVA 1WCWA 3PK0A 2C2OA 3O8QA 2JPDA 5EJIA 3ZGVA 4NNJA 3GI1A 2DHQA 3DEFA 5EE1A 1O0BA 2LKDA 1V1RB 1U3GA 1P0PA 3E61A 3C1OA 3VR5A 3QG1A 5IAGA 4AMZA 1WTAA 3EBPA 2Z2XA 2O2EA 3HDVA 4L0CA 1LD3A 1TCVA 4XOIA 2FPSA 3QU2A 4D8UA 4BQFA 1X8XA 2E4YA 3CH7A 4UOQA 2Y6VA 4FYWA 4Y6GB 4E2FA 3JRWA 4QXMA 4QNRA 4B33A 5IAOA 3H16A 3BEDA 3GUVA 4ZV7A 2FQYA 2BI8A 3S5JA 1QFXA 2CLMB 4DQ0A 3PQCA 3KU4A 1LVUA 1RI2A 1WDMA 2VHQA 4RE6A 3L6CA 3E9EA 2Y76A 3D5