The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
50
|
sequence length |
157
|
structure length |
157
|
Chain Sequence |
MLLTGKLYKEEKQKFYDAQNGKCLICQRELNPDVQANHLDHDHELNGPKAGKVRGLLCNLCDAAEGQMKHKFNRSGLKGQGVDYLEWLENLLTYLKSDYTQNNIHPNFVGDKSKEFSRLGKEEMMAEMLQRGFEYNESDTKTQLIASFKKQLRKSLK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Endonuclease
|
| molecule keywords |
RECOMBINATION ENDONUCLEASE VII
|
| publication title |
Conformational Flexibility in T4 Endonuclease Vii Revealed by Crystallography: Implications for Substrate Binding and Cleavage
pubmed doi rcsb |
| source organism |
Bacteriophage t4
|
| total genus |
50
|
| structure length |
157
|
| sequence length |
157
|
| chains with identical sequence |
B
|
| ec nomenclature |
ec
3.1.22.4: Crossover junction endodeoxyribonuclease. |
| pdb deposition date | 2000-08-29 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| A | PF02945 | Endonuclease_7 | Recombination endonuclease VII |
| A | PF09124 | Endonuc-dimeris | T4 recombination endonuclease VII, dimerisation |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | Transcription Termination Factor Rho, Rna-binding Domain; Chain A, Domain 1 | ||
| Alpha Beta | 3-Layer(aba) Sandwich | His-Me finger endonuclease fold | His-Me finger endonucleases |
#chains in the Genus database with same CATH superfamily 3FC3 A; 1A62 A; 2A8V A; 3L0O A; 1E7L A; 1A8V A; 1EN7 A; 2QNC A; 1E7D A; 1A63 A; 2QNF A; 3GOX A; 2HJQ A; #chains in the Genus database with same CATH topology 2LC3 A; 2ODG C; 1H9E A; 2W51 A; 1GJJ A; 1ZS9 A; 2KVU A; 2MPH A; 1A8V A; 3LLR A; 2QNC A; 1PZW A; 2KVD A; 4BIT A; 2KVE A; 1KHC A; 2RNO A; 1Y02 A; 1GL9 B; 1JEI A; 1EN7 A; 2RNN A; 1A63 A; 2HJQ A; 1JEQ A; 3FC3 A; 2QNF A; 1A62 A; 1V66 A; 1YNS A; 2A8V A; 1E7L A; 3QKJ A; 2G80 A; 2KFV A; 5CIU A; 2JVW A; 1H9F A; 2N1U A; 3FLG A; 3GOX A; 1GKU B; 2LD7 A; 3L0O A; 2ODC I; 4UZW A; 2WQG A; 1ZBH A; 1E7D A; 2DK4 A; 2KDP A; 1H1J S; 2KW9 A; 1JJR A; #chains in the Genus database with same CATH homology 2LC3 A; 2ODG C; 1H9E A; 2W51 A; 1GJJ A; 1ZS9 A; 2MPH A; 1A8V A; 2QNC A; 1Y02 A; 1GL9 B; 1JEI A; 1EN7 A; 1A63 A; 2HJQ A; 3FC3 A; 1A62 A; 1YNS A; 2A8V A; 1E7L A; 2G80 A; 2KFV A; 1H9F A; 3GOX A; 1GKU B; 2LD7 A; 3L0O A; 2ODC I; 1E7D A; 2DK4 A; 2QNF A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
