1EB9A

Structure determinants of substrate specificity of hydroxynitrile lyase from manihot esculenta
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
262
structure length
262
Chain Sequence
PISKMVTAHFVLIHTICHGAWIWHKLKPALERAGHKVTALDMAASGIDPRQIEQINSFDEYSEPLLTFLEKLPQGEKVIIVGESCAGLNIAIAADRYVDKIAAGVFHNSLLPDTVHSPSYTVEKLLESFPDARDTEYFTFTNITGETITTMKLGFVLLRENLFTKCTDGEYELAKMVMRKGSLFQNVLAQRPKFTEKGYGSIKKVYIWTDQDKIFLPDFQRWQIANYKPDKVYQVQGGDHKLQLTKTEEVAHILQEVADAYA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYDROXYNITRILE LYASE
publication title Structure Determinants of Substrate Specificity of Hydroxynitrile Lyase from Manihot Esculenta.
pubmed doi rcsb
source organism Manihot esculenta
molecule tags Lyase
total genus 94
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature ec 4.1.2.47: (S)-hydroxynitrile lyase.
pdb deposition date 2001-07-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1eb9A00
1EVEA 1VXRA 4AN1A 5CT6A 5E4TA 1RP1A 4X92A 3HLKA 2YXPX 2XMSA 4MXDA 3QPCA 1MTZA 4HTAA 2V9ZA 4B80A 2R11A 4CCYB 3H2KA 3I1YA 3QMMA 4IH1A 2JGJA 2IIVA 3E1GA 3ESDA 4QNNA 2RGUA 4U2FA 5D6OA 2GZRA 2FX5A 3DJYA 1F6WA 1WPRA 5ALYA 3ZLUA 4X71A 1YA4A 3I2IA 1KU6A 2XMDA 5AO9A 5FRDA 3ED1A 1S8OA 2V97A 2VA9A 3H17A 4J7AA 3DLTA 3H2GA 5JADA 2ACKA 4BRSA 4FNMA 5BV7A 4UHCA 4BVLA 1CUCA 2WHPB 1RWQA 1U4NA 3CN9A 2I03A 1CUSA 4BTVA 3ESAA 4AN0A 2VATA 5ALOA 4W1SA 1A8QA 4EZIA 4J3JA 3HACA 1CQZA 1HKHA 5AI5A 1C7IA 2HU5A 5ALFA 5AK6A 1QE3A 1JJFA 1XZGA 1CUXA 3QZUA 5DTIA 5K3FA 3MVEA 3EF3A 3O9MA 1CUJA 5AOBA 2BJHA 2DCMA 3FLEA 1YAJA 1W4LA 3ZLVA 4JYMA 3PICA 2WILA 4C6HA 3H19A 4UBJA 2WG0A 3AZPA 5EI5A 1E8DA 2OGSA 1QLWA 1JJBA 3WWEA 2DSNA 4W1PA 1CPYA 3WKBA 5FV4A 1IUPA 1JFRA 3BDIA 1JU3A 4EB0A 1MX5A 1ODCA 3CN7A 4OU4A 3C8DA 4UFPA 4U2EA 4BE9A 1CUWA 1L7AA 3G9TA 1Y37A 2O7RA 4BYMA 5ALDA 4MQLA 1F0PA 3I2JA 1CRLA 2QRUA 4W1QA 4KAJA 4X00A 2XMBA 1BRTA 2HL6A 1TCCA 4J0HA 3F96A 3G9UA 1ETHA 3B5EA 3HYSA 4BCCA 2DQZA 5ALRA 3IUJA 3OOSA 2QXUA 2XUQA 3K9BA 5JANA 3WZMA 1CLEA 4K6HA 2XLBA 5T4HA 1HPLA 3D0KA 1J1IA 1FSSA 4BVKA 4DSAA 3KD2A 3WK8A 4Y2UA 2X8BA 3DL4A 3TGLA 4U2BA 4FKBA 3HEAA 1O6GA 1UKBA 4X91A 3DDUA 1ISPA 4YK7A 4W1RA 1ZIYA 3D59A 3OURA 5AI9A 4E11A 1QONA 3NOXA 3VKFA 1JI3A 2O7VA 3IUMA 5C7YA 3FCXA 5AK3A 4DYHA 2CJPA 3DOIA 3R3WA 3H1BA 3I2HA 3PFCA 5CH5A 4K6GA 1QIGA 2OG1A 3WK6A 5KWJA 1VE7A 1X2BA 4ZI5A 1XZDA 3C6ZA 3D3NA 1YS1X 1ZD3A 4CG3A 4KAFA 1QIEA 3V9AA 2OCIA 2C0QA 1XFDA 5AI6A 1SCQA 4Y2QA 2WIDA 1CUBA 4FLEA 2XUOA 1ZIXA 4BB0A 1N5MA 4PV7A 3LIIA 2I3DA 1E3QA 4X90A 4B85A 1UKCA 1UOOA 2QOEA 4DMFA 4M0FA 3AIMA 5SYNA 4ZRDA 3PDCA 1EK2A 5JZBA 4BZZA 1CQWA 5ALLA 4I3FA 1LPNA 5EHXA 1WM1A 1XZJA 4QWMA 3WI7A 1WOMA 1QGED 1MX9A 4FDMA 4IH4A 3G9XA 4EA6A 2ZYSA 2Y1KA 1UK8A 3FOBA 1H2WA 4OYLA 1DTEA 3RM3A 4KAAA 4IH9A 1ORVA 4GI1A 1GKKA 2XE4A 3O4HA 2AJLI 1DU4A 1UKAA 5T4FA 3R3YA 1W1IA 3LCRA 2RAUA 5ALEA 5HZGA 1EI9A 4DMCA 1R50A 1BEZA 2WTMA 2XUAA 5AOCA 2WSLA 3QPAA 2AJBA 4KJXA 1E8MA 1IZ7A 5ALWA 3X3HA 1FFEA 3IDAA 5HCUA 3STWA 1BE0A 3U1TA 4WFKA 1UK7A 4A23A 3I1IA 5JZ9A 4KRXA 2ZJ6A 4HRXA 3F8SA 5D3ZA 2XUHA 2Y2VA 4FOLA 2VAVA 3A2NA 4KACA 4AO7A 2HA6A 4Y2TA 1JU4A 3IA2A 4UFOA 5E4YA 1I6WA 2EDCA 3I6ZA 2HA5A 2BUCA 4HZGA 5ALKA 4QDOA 1XZBA 2EDAA 4J03A 1C4XA 3F98A 2XUPA 1XZLA 4OB7A 3STUA 2J3QA 2O2GA 2WIKA 4ROTA 1H22A 3E0XA 4QA9A 5AM4A 2GBCA 3UUEA 2JGFA 4OPMA 5EIHA 1WB4A 2X5XA 2RHTA 4GECA 3WL5A 4YPVA 1WPXA 1ZD4A 5K3AA 3CXUA 4N5IX 2GZSA 1SCIA 4Y2SA 1BCRA 3C6YA 2LIPA 4HRYA 1ZI9A 4ETWA 2PPLA 5LZ7A 1EHYA 1MJ5A 3F67A 3H04A 2XMCA 3QMWA 4PO3X 4V2IA 1JMYA 3DEAA 4OCZA 2I3ZA 2CZQA 3N0TA 4KE9A 3R3VA 4Y2RA 2VSQA 4EY4A 5AJHA 5JYCA 1A88A 1DQZA 1YASA 4LYEA 5ALMA 2Q0XA 1Q0RA 3W05A 4F21A 1O6FA 4QLAA 4BATA 5LZ2A 3OTQA 1EINA 4KRYA 1R9NA 2ZSIA 4G8BA 2BGNA 3HZOA 3WKDA 3LP5A 3V48A 3G9ZA 5LLSA 4RE6A 1TCBA 1QIMA 2VJCA 1XQYA 3KOOA 5I8PA 2C7BA 5K3CA 3QITA 2XQJA 4ITVA 4UBOA 1IMJA 4Z49A 1U2EA 3IUNA 1IVYA 3VJMA 2XI4A 2ZVDA 3I6MA 4X3CA 1LBTA 4C87A 5JD5A 4RGYA 1MNQA 3H2JA 5AIBA 4GHWA 5K3BA 1CFJA 2OXEA 4EY8A 3DS8A 5ESRA 2ZJFA 5ALGA 2XT0A 4DM7A 5JAOA 4B84A 1RYYA 4X85A 1CIJA 1Y7HA 4LXHA 4B6GA 4B7ZA 4X7BA 5J3JA 1EA5A 3QBJA 5H3HA 1G42A 3C8HA 1DT5A 4UHBA 5IVKA 3BWXA 4BAZA 3BJRA 3VVMA 2DHDA 4AMYA 2ZSHA 2ECFA 2BUBA 3EBLA 2DR0A 5IVDA 5FUMA 4RPCA 2IX9A 2BCEA 1ZD5A 1XZKA 3GA7A 2HFJA 1WHSA 4UUQA 3WWPA 2JF0A 4X97A 4C4YA 4BAUA 3V1LA 2ZJ7A 5FOQA 4LHEA 3AIKA 1PJAA 1U65A 4UBLA 4WDQA 5LZ5A 2JGEA 3G7NA 3KWFA 4S0XA 4DMKA 1MAAA 4N8SA 1VJ5A 3ESBA 2CEKA 4G4GA 1LPSA 5AM5A 5K5EA 2PSHA 3WK5A 4FWBA 4CG2A 4MWSA 4JYPA 4FMPA 1QIDA 2CB9A 4IHAA 2QMQA 4Q82A 2XUIA 3HI4A 5AM0A 2OGTA 1ZD2P 2HDWA 1JJIA 4PSUA 2PU5A 2HFKA 4H77A 1VA5A 4W63A 2G63A 3MUNA 3QH4A 5CXUA 5JIBA 1XRQA 2J4CA 2XLCA 4YX9A 1NU6A 3YASA 5DNWA 2CKMA 3HRHA 1CUEA 3KXPA 4DNPA 2WUFA 3ZV7A 1LZKA 5K3FB 3ANSA 3AJAA 1ACLA 4BP8A 4G4JA 5EHNA 1MNAA 1EH5A 4KE7A 5FPPA 2J3DA 3R40A 4TPKA 4B81A 4B0PA 4QDTA 1W6RA 6YASA 1CR6A 3QMVA 2WQZA 3F9CA 5JD6A 1R3DA 3OC0A 4Y2JA 3WWOA 1XROA 1IZ8A 3DYVA 4QDXA 3R3UA 1H23A 2PM8A 1QTIA 5AHXA 3GFFA 1L7RA 2WHRA 2ONCA 4A5SA 1JT2A 5I9IA 2VF2A 1CEXA 2XQGA 4J0CA 3H2IA 5ALSA 4OSEA 1XRMA 2H7CA 5CTAA 1XRRA 4UHEA 3GROA 1FFBA 5AKLA 3WK7A 2VEOA 4C89A 4WJLA 1GT6A 2HRRA 1A8UA 1OCEA 2D5LA 1CUGA 3WYDA 2XUGA 4OB6A 3ZWQA 2WFLA 5A62A 4H7HA 3WKCA 2C0PA 3AZOA 3E3AA 1XZAA 4K2AA 4B9EA 4NS4A 1QIKA 4U2GA 4GW3A 3I28A 5BOVA 1FJ2A 4PQEA 1BEEA 2ACEA 3OG9A 3DKRA 1TIBA 2QR5A 2WHQA 1QFSA 4D9JA 1DWQA 1XQXA 1CUDA 2WIJA 5AI0A 2OQIA 5CXXA 3AIOA 5E2IA 3BL8A 3R41A 3A2LA 4BDSA 3STVA 5F4ZA 2AJDA 2D0DA 3FYUA 5CT8A 3FLBA 3A2MA 5AKXA 3NUZA 5ALJA 1XZHA 5AKIA 2G4LA 5ALPA 5A7HA 3BIXA 2C58A 2ZYIA 3E4DA 4Q3LA 2OCGA 4N8DA 3A70A 1H2ZA 1XLUA 1ZGCA 1GQSA 3RKSA 3FCYA 4PSCA 3WL8A 2QUBA 1Z68A 3G0CA 1TRHA 2RONA 2RHWA 4AB1A 1K4YA 5ISMA 2PVSA 1EX9A 4KEAA 1DWOA 5HQ3A 5YASA 3ICVA 3WJ2A 1LLFA 5AK4A 2WUGA 4BTLA 3C70A 1GPKA 3VJKA 1ZICA 3RLIA 4EUSA 2W6CX 4GBGA 5C8ZA 3WLAA 4B9AA 1TAHA 2JGMA 2WG2A 2XQKA 2O2HA 1TCAA 1EVQA 4FNGA 5AM2A 1TQHA 4WCVA 3JWEA 4GLBA 2XMZA 2WG1A 1AKNA 3CCCA 5T4EA 3D7RA 5AKGA 2IITA 2K2QB 4BE4A 1Q0ZA 5HFAA 2I78A 2B20A 5LZ9A 5AKJA 4L3WA 3AUKA 1WHTA 1SCKA 1MT3A 4CFSA 1J07A 4G4IA 3FNBA 4CG1A 3H1AA 1VKHA 4BC0A 5DYWA 1T2NA 5DYTA 1FFDA 4AZ0A 1VXOA 4LXGA 4B0OA 3O0DA 4Q1VA 3W9BA 2XMGA 5CMLA 2WM2A 5C8XA 1CV2A 3BJMA 3LIPA 4C88A 1QTRA 2WFMA 4Y2XA 1D07A 3WWCA 1AC5A 4DNOA 4WFIA 3Q0TA 5C8VA 3O4GA 2OAEA 2DQYA 4KYVA 3PI6A 1GPLA 2Y6VA 3WQHA 5HQ3B 1ZGBA 3L1JA 3C5WP 5JAPA 1CUUA 4QZVA 4WDRA 3PE6A 2HA4A 3MUOA 2WIFA 1CUHA 4DGQA 4Q34A 1VOTA 2Z8XA 4YASA 2B4KA 1SFRA 4JNCA 3C5VA 4HXEB 3HSSA 5AKKA 1BN6A 4FTWA 2VJDA 4XJVA 4CIBA 2OAGA 1UT6A 4E46A 4GXNA 1W52X 4AZ3A 2BGRA 4FLFA 4K6KA 4N5HX 5CURA 5AM3A 4BCBA 3STYA 5ALUA 4O08A 2RI6A 2DHCA 4H35A 2Z3ZA 2XMRA 4G9GA 1M33A 3GBSA 3D2CA 3M81A 1ORWA 1MAHA 4BVJA 5EFZA 3G0BA 3EIOA 1DX6A 3BE8A 4EY5A 3WA6A 5AI4A 4HS9A 3WWDA 1ZI6A 1A7UA 3TJMA 5JALA 3UUFA 2CUTA 3ICWA 4INZA 2CBGA 3PUIA 1FFAA 1YSCA 2PUHA 3G0IA 1U8EA 1QO7A 2QXTA 5JASA 4ARAA 4X95A 3VJLA 4HAIA 4EHBA 3VDXA 2VQ6A 3Q8WA 3PUHA 2CMFA 2B9VA 3I2GA 5LKRA 2VJAA 3DD5A 3DNMA 1UXOA 5CT9A 4MQMA 5HF8A 4B83A 1QJ4A 2ZYRA 1GQRA 1LZLA 3LS2A 5FKJA 1B6GA 1HL7A 4E14A 1AX9A 4UHHA 1JMKC 3AINA 4G5XA 1W76A 2DFPA 2WU3A 4H18A 5ALHA 1GXSA 1LBSA 4DNQA 2QTBA 1PFQA 5ALTA 1UFOA 4P08A 1LNSA 1QZ3A 3DQZA 3F97A 3C6XA 4EY6A 4J0DA 2HADA 4BCDA 5DTJA 2Z5GA 4H7KA 2JGKA 1T4MA 3IIIA 4ZREA 3N2ZB 5HF6A 2OQVA 4CCYA 1NU8A 2OCLA 2ES4A 5CW2A 1K6EA 1MU0A 1EK1A 2VJBA 1F0NA 5EHZA 1R9MA 1H2XA 1GKLA 4L9AA 5EIAA 1AZWA 3G0GA 3AFIA 5EHQA 1XLVA 1XLWA 2WU4A 2XQFA 1QO9A 1X2EA 3SK0A 2JIDA 4NVRA 2PU7A 4AX4A 3WA7A 5IVIA 2GYVA 3QYJA 4H7FA 4FLMA 2HM7A 4CI9A 3EQ9A 2H9YA 2JEYA 1OXMA 3C87A 3ANTA 4L0CA 2JEZA 5A7FA 4PF1A 1XQVA 3ESCA 4H7JA 4JH0A 4P92A 3S2ZA 3IBTA 1WCYA 1J2EA 1ZJ4A 3G0DA 1P0MA 2PBLA 2JBWA 1YAHA 5EIEA 1KEZA 1HDEA 2YYSA 3C45A 1EDDA 3ZLTA 1CUZA 2HA3A 2PX6A 5JZSA 2H1IA 3HJUA 3U0VA 1LPBB 1OILA 4XIIA 1MN6A 1G5FA 1XQWA 4UBKA 2WTNA 1DT3A 4Q3OA 4C4ZA 5T4BA 5AK5A 4BBZA 4AO8A 1EB9A 2VT7A 4WFJA 1DINA 3BF7A 2R8BA 4Y7DA 4E15A 2C5FA 2WJ3A 3FSGD 4X94A 5HK9A 2NW6A 1KU0A 3PFBA 2PUJA 5KWIA 2QZPA 1BS9A 5AKHA 4QEKA 1XZIA 3QM1A 3WJ1A 3GELA 2VTVA 1N1MA 4KE8A 1JKMA 5ALZA 2QM0A 1GZ7A 4Y2VA 1YB6A 4ZXFA 1EXWA 2OLEA 3IB3A 1THGA 2XMQA 5ALQA 3QVMA 1XZEA 5SYMA 1QIFA 2FUKA 3IUQA 3AZQA 4UHDA 5HK8A 2P8SA 1R1DA 1XKLA 2FJPA 5ALVA 2PSDA 3ZPXA 1ACJA 5JAHA 1R4ZA 5FP0A 2DHEA 3D4LA 1UK9A 4F60A 1SOMA 3D2AA 4WY5A 4H7EA 1VLQA 1K63A 1AUOA 1R88A 3AILA 3FYUC 3T4UA 3VXKA 2X76A 4MEAA 3OPMA 3SX4A 4CCWA 3MGAA 1P0QA 4C01A 1J06A 4LYDA 2XUKA 2GBIA 1LPOA 4UBMA 4ZV7A 4B82A 3M3DA 1TK3A 2HU7A 3WMRA 2RIPA 4NZZA 1E8NA 1YA8A 3FYUB 1K8QA 5DLPA 4HXGA 4KE6A 2FJ0A 5JAUA 4U2DA 4CIAA 4EBBA 1Q84A 3B3QA 5A2GA 2PSFA 1XRNA 5JARA 3I2KA 2EEPA 5HKAA 1H2YA 2C4HA 5LP1A 4MJ3A 2WFZA 2HU8A 4ZGBA 5E4JA 4DMHA 3IURA 2UZ0A 5LKAA 1ZOIA 4QDUA 5CT4A 4L72A 1F8UA 5KBYA 2BFNA 3BIWA 2HA0A 1XRLA 5K3DA 3O4IA 5AH0A 4DLNA 4RNCA 5AP9A 5AICA 4H7DA 4FFWA 3WK9A 1HQDA 1EDEA 4ARBA 5A7GA 2GYWA 4PSDA 3WIOA 2VAXA 5FXMA 1E5TA 2AJ8A 3M83A 3BF8A 3WK4A 1ZI8A 4BP9A 1CVLA 4LIPD 3D5EA 5DWDA 4KR0A 3L1IA 1UZAA 2WUEA 3FBWA 2ZYHA 3I6YA 3FVRA 3STXA 1LGYA 1P0IA 3SC2A 4TVKA 2AXEA 3SWWA 2WJ4A 4RE5A 3S8YA 4JEIA 4Q3KA 2QUAA 2W22A 1XZCA 5FPQA 3O9VA 1BCSA 2H7YA 1Q83A 1AGYA 1G66A 4QWWA 3V1KA 1QFMA 1BU8A 4DNFA 1DWPA 4QE3A 2YH2A 3KSRA 1N5RA 2QVBA 1LPAB 4F0JA 2XUJA 4A16A 4UBNA 4F5ZA 3WKAA 2PKYX 3H0CA 5K3EA 2JGLA 3V1MA 4HVTA 4U2CA 1FFCA 5CRIA 5DJ5A 2E3JA 1MX1A 4FBMA 3TEJA 4C4XA 3R3XA 4G9EA 4GDMA 1XRPA 1EB8A 1DX4A 1XKTA 2PSEA 3WZLA 2XDWA 5CBKA 4WY8A 3H2HA 4BZWA 1P0PA 1YS2X 4X6YA 4P9NA 3IULA 4TGLA 5ALXA 4UBIA 4GEGA 4Y2YA 1VZ3A 3FVTA 4Q05A 3WL7A 4BRZA 4X6XA 3W06A 2O2IA 2Z3WA 4EY7A 3RARA 2HA2A 2JGIA 4H0CA 3NWOA 4MWTA 1Y7IA 5JD4A 5AKEA 5CH8A 4Y9SA 3O95A 1ODSA 5IH7A 2ORYA 2QJRA 1BROA 4OB8A 1CUVA 5AKYA 5D7BA 3DOHA 1ZJ5A 3R3ZA 4I19A 4BDTA 4HXFB 4LKOA 5AOAA 3WIBA 1CUIA 4MYSA 2WFLB 1UWCA 1WB6A 1USWA 4X6UA 3IVMA 3EQ8A 5KREA 3CCBA 4AMZA 4I4CA 1DQYA 3BXPA 1C7JA 4QDZA 5A6VA 2QJWA 2V98A 2OPHA 4AQDA 2GBFA 2C5GA 5HFNA 3GZJA 4OU5A 4DSZA 1IUNA 1ODTC 1YB7A 5BWBA 1QIHA 3FAKA 4J0IA 4J0JA 5EGNA 4N8EA 3FLAA 2WIGA 3ILSA 3ZI7A 5AKZA 4OD0A 4G8CA 1LPPA 4PW0A 3C43A 3A6ZA 4BC1A 4MYDA 3FYTA 1VE6A 1CUAA 5LIPA 2BKLA 1GPNA 2XUFA 2WLSA 5IVHA 1AQLA 1AMNA 4M0MA 1VZ2A 2PSJA 3HC7A 1G4HA 5I7UA 3WYNA 4UHFA 3G8YA 3W2TA 7YASA 1B41A 1QIIA 1MO2A 5LYYA 2HRQA 1L7QA 2V96A 4AO6A 1NX9A 4P93A 1WB5A 2HHAA 4JUIA 1X70A 5CH3A 3K6KA 5BWCA 3PF9A 1TKRA 1CUFA 3QPDA 4UPDA 1N8SA 4J0KA 3M82A 4OUKX 2QKYA 1UOPA 3T52A 5LZ4A 5AI8A 3W9UA 5ALIA 4DTCA 2VT6A 4J0GA 4XVCA 5JATA 1A8SA 1E66A 1E89A 2BAGA 5AM1A 3UMJA 3I2FA 3R0VA 4LXIA 3VVLA 4DIUA 2Y2UA 2QT9A 3DYIA 5C81A 3HXKA 3DL7A 1SC9A 2YASA 3RK4A 4ZV9A 4FFVA 5FDFA 5CT5A 3OM8A 2GYUA 4IQ4A 1VA4A 3EQ7A 5DNUA 3L1HA 1W75A 1EDBA 3KDAA 1HLGA 1UOQA 3W04A 2HIHA 1THTA 1YR2A 4W9RA 2ROQA 3K2IA 3NGMA 3O4JA 2G5PA 1MPXA 4G8DA 1PV1A 4GWLA 1XZFA 1K5PA 2G5TA 3FSGA 2WUDA 4XX1A 4UFNA 1AURA 2J4FA 2Y6UA 2GBGA 4K5QA 2QS9A 2XB6A 5AIAA 4G1FA 3WKEA 5HF9A 1QOZA 3WL6A 3KWJA 1GGVA 1IUOA 3JW8A 3V1NA 3P2MA 3FWHA 5DNVA 4H7IA 4FBLA 4ZWNA 4IO0A 5ALNA 4MEBA 4PNZA 1BN7A 2HA7A 5A71A 4FHZA 3B12A 3D2BA 4NMWA 1UK6A 2WJ6A 3GUUA 2B61A 2PL5A 4OYYA 4XWGA 5FLKA 1HBJA 2WHPA 4M0EA 3C6BA 2XUDA 5DYYA 2XQIA 4AXBA 2OCKA 3HABA 2BUAA 2H7XA 5IKXA 3JYHA 4Y2PA 3PF8A 5HKBA 4BAGA 3STTA 4QLOA 2OGZA 2WKWA 1QIJA 3DCNA 2AJCA 1YCDA 1CUYA 3G02A 5D3KA 1XZMA 5LZ8A 1LPMA 3LLCA 2Z8ZA 3VISA 3TRDA 5HF5A 3H18A 3DKKA 4X93A 3BDVA
chains in the Genus database with same CATH superfamily
1IFXA 3JRNA 4DBZA 3K0FB 3L6BA 3HTXA 4PIVA 5HUQA 5CIWA 3MBIA 1ENZA 1L5MA 4ZOEA 3TD6A 3IOCA 3ZWCA 4X92A 3HLKA 4WGFA 3N8KA 2H1LA 2XMSA 4U4AA 3TPZA 3QPCA 3GEEA 3R6LA 1W5SA 2A88A 1Y42X 4IDAA 1JR2A 3LP6A 3E1GA 3NTRA 4A0RA 4ZQBA 3KTFA 4ER3A 4FB4A 4LSGA 4ZI2A 1W94A 1NXVA 2A9KA 3L0IB 3CX7A 4RFSA 1YK1A 4OJNA 5DGIA 3SAJA 2RGUA 1WS6A 4EP1A 1CZHA 1U3UA 2GZRA 2CXHA 3PENA 1OU4A 1C8LA 1U8YA 2J6BA 3V7YA 3DJYA 3M33A 4FKMA 3WY9A 2XXAB 1D6SA 3NOOA 4LDZA 3F6BX 2ZWVA 5ALYA 2PUBA 1P74A 2FPXA 3OI7A 2G70A 5LFAA 1YA4A 2H1HA 1KE1A 4DLBA 1E2IA 3I2IA 1UMBB 2XHZA 1X1EA 4JR1A 2JFUA 3ROQA 2XMDA 4MRMA 2FWIA 1QG0A 2RBEA 2J41A 1PNRA 5LLTA 1OB5A 5JPCA 2KSQA 1UJMA 2F3QA 1S8OA 1W87A 2BBTA 4EG7A 2H1CA 1T29A 1PZHA 4OM8A 2J0QA 3QFHA 1NKSA 1BU5A 2ZWIA 3FNEA 1EGAA 2WF9A 3LLVA 1OU0A 4EKDA 5BV7A 4UTNA 1Q15A 1SXJE 4RULA 2PLNA 2RHCA 4XX0B 4UHCA 3REFA 1UP6A 2JA1A 3RK1A 2O8CB 3LOUA 2FP4B 5K0BA 2BGLA 2C78A 4BVLA 2JGAA 4GAEA 3GJ4A 2ZI6A 4MR9A 2ZJ2A 4HN4B 1SCDA 5LMCA 1A77A 2RHBA 1JQDA 2FF7A 1X3SA 3LHDA 4CV3A 3EQ6A 5B6JA 4LZJA 3H9BA 4CM7A 1U8CB 3AJDA 1N5DA 1TEXA 3FCEA 2BTQA 2Z6VA 5ALOA 4CLHA 4ZCLA 1B74A 3QFSA 4QNMA 4LXYA 2FQ1A 4ZKDA 3QE3A 2OSVA 3ELUA 3ZDDA 1CQZA 4UTVA 4ZYXA 4L07A 5KVQA 4LNAA 1UAAA 1R0LA 4OFBA 2QSYA 4KYIB 3PWZA 4NBLA 3SQOA 4CLOA 3EXFB 4DUGA 5I7FA 1C7IA 3C5EA 4PC7A 4HDNB 4EATA 1LSJA 4F38A 3F6SA 4H1TA 3KUXA 4MV3A 4MARA 3ZE0B 2QRVA 4EI8A 5IMSA 5GJWC 3HJNA 1NT4A 4HDRA 4IXDA 3V97A 2HQSA 4NEGA 4YP5A 1JJFA 2DH6A 1K7EB 2JLBA 3IILA 4OQLA 1L5GB 2EQAA 3DMPA 4WZAB 4DSOA 1XL1A 4BX8A 4GI7A 2WHXA 5GAJA 5DTIA 5L3ZA 2UDPA 3E27A 5DRYA 3UATA 1NVVQ 1YMQA 3EF3A 2VJNA 1GU1A 2W6OA 1JMVA 4L02A 5K51A 2K2WA 2DUWA 1PK9A 1SIUA 4DWJA 2B69A 5CB0A 2BJHA 1FDOA 1IQUA 2Z2KA 5AHKA 5JO9A 1OSNA 4DA4A 5AW1A 2PQ6A 2VHCA 4YRZA 5TIIA 3PXBA 1O0BA 4D02A 3MJVA 4D3SA 3ZHSA 2BH2A 5ARBA 5IBRA 1KBOA 5AR1A 1TJPB 4JEHA 2AH5A 3DLHA 1W4LA 3HKBA 4I0WB 5ITZA 2QBYB 3EEIA 3FBTA 4KMMA 4HB0A 4EJ6A 4TYYA 5DNDA 1F4VA 5HRAA 2EZ8A 4XDYA 3KFVA 1W46A 3T99A 4QJ3A 3Q4GA 3PRYA 1EUZA 2ZDQA 2ZR7A 1PQ4A 1XO1A 3GEGA 3SZOA 1E3MA 4Z0PA 4B48A 1W0JD 4WNAA 4OGKA 1IRIA 4POOA 3RASA 2QU8A 2B1GA 1KPIA 2GQ0A 3TZEA 1C29B 1JJBA 3SF8B 3UK0A 3ZDQA 2YW9A 5HEKA 5C8YB 3FHLA 3TTSA 3VC2A 2PA3A 1NUTA 1RIFA 1ZIOA 2QUIA 4KXLA 3WWEA 3ONFA 4CU2A 5L3QA 5T64A 4O5AA 4FMBB 2EJUA 2R1ZA 3K5WA 4RPIA 2X5KO 1OX6A 5HA5A 5FL7D 2RGYA 1DMRA 1X1QA 3C74A 1CD5A 5REQA 2DBVO 1XYVA 1MC1A 4IHJF 3CN7A 4HP8A 4AKSA 3GT4A 4DZRA 5EMKA 2VVTA 2GCOB 3T12A 2X2OA 3G9TA 1NIPA 3PNKA 1SUCA 3KBOA 1ZOLA 4MGEA 4GG1A 4NXNB 4IDEA 1JTFA 3SK0A 3LVBA 3ZZ1A 1LFAA 5MFPA 4BB5A 4B6QA 1V7ZA 1VCIA 1Z17A 3I2JA 3U4QB 3HB7A 1Q22A 2DSTA 5KYUA 4C04A 4M9CA 1ZO8A 4W1QA 1BYUA 1OGJA 4LDJA 2A0YA 1E5DA 4C0QC 5JNSA 2XMBA 1GEGA 5KOYA 2R44A 1T0IA 2HSJA 2O4CA 3WZ2A 1PWYE 3OX3A 2C20A 1FLAA 3P26A 2E6UX 5G0SA 2IZ7A 1DQPA 1BRTA 2WYOA 3UH1A 5IG2A 2W2MA 2HL6A 3AGQA 4Z9FA 2CLFB 3F96A 3G9UA 3D81A 4ZQFA 1GUZA 1OI3A 3ZQUA 3KUCA 3SY8A 2XCOA 3G6KA 3A3KA 3OOSA 3D2LA 2RBKA 2R8XA 1TADA 1B0AA 2CVOA 1MB0A 3R7FA 1I1HA 1TUEA 3MHPA 4R1MA 2YTZA 1JKXA 2NU6A 3MSCA 1X7ZB 1OJLA 1NR7A 1N6KA 2IJGX 4X24A 3D0KA 3FNIA 4YXFA 3G8DA 2F1IA 3JVDA 2W2OA 3K4PA 4DSAA 5KOHA 1GPYA 3KD2A 4GS5A 4JLJA 5JC1A 1KIAA 4UM9D 4Y0VA 1Z07A 2QVYX 1TYDE 3HVJA 1GZ6A 3V8RA 1AQ6A 2FWPA 3HV0A 2W8ZA 1F2TB 1BC5A 3DDUA 4A91A 1WTCA 1ISPA 4I1OA 3KR0A 3AEUB 4N6OA 4C22A 4GXQA 5LVAA 2JG3A 3ZDFA 4YK7A 5LUAA 1QP7A 2WUWE 4H1UA 1N6NA 4MUYA 1G8GA 3OURA 5AI9A 4E11A 4EHKA 4M55A 1JHXA 3ESQA 1YJBA 2PRIA 4UQPA 4WE3A 4AP6A 1ZM4A 2ID8A 4PO9A 4C7XA 4XD2A 3H11A 5JISA 2O7VA 1FQOA 4MV0A 4LGVA 3VR2A 1HQCA 3ZDRA 1UCFA 4C4SA 4EG5A 2W43A 4IWXA 3UJ3X 2I91A 1MB9A 1T0JB 2JRCA 1DE0A 1XWWA 1FFXB 4OHBA 3RANA 1T3HA 2ZSUA 3IP6A 1E2GA 1SIWA 2WVJA 1SURA 4HR7A 5KCZA 3GGJA 5JQGF 3QSYA 1C80A 4DYHA 3HP7A 1Z0UA 2P6UA 3T15A 2AI2A 4V02A 3D8TA 5KKNB 1TLTA 1NNLA 2XF8A 3PNQA 4N0PA 3H1BA 2BEUA 1I4DD 1HG1A 3PFCA 5LC1A 3ZWMA 4KWCA 4BY9E 3KKOA 3L1VA 1ONNA 3EGDB 2JGNA 2H1WA 4BJ6A 1TK9A 3DL2A 3KPYA 1GGHA 1DXYA 1ADJA 2WTXA 3KVVA 3P9XA 1DLIA 2MINA 2HJRA 3OP1A 1YS1X 4PR3A 3HM9A 3LDAA 3OQJA 3CPHA 3FYHA 3UXHA 3LBFA 4RADA 3P0JA 4KAFA 3RWMB 1QIEA 1CE8A 2FMKA 5FLEX 4Y1RB 3ZTTA 4WUVA 5GIOE 3HYRA 3UUWA 1WW3A 1UPAA 3VPGA 1JQ5A 1K5GA 1PJ3A 2X19A 4ZK2A 4CEIA 3AVQA 1SCQA 1YE8A 4HWTA 3A27A 4Y2QA 3KJIA 2WIDA 1S6YA 4GEKA 2A9OA 5FO1A 2ZT6A 1W36C 2XNJA 3FPHA 1I2ZA 1JV2B 2FTKE 2C54A 1FNCA 3A1SA 4FLEA 4N5NA 5T8KC 2QAIA 1LC3A 4BB0A 3PGJA 1IU9A 2EEZA 4GE3A 3HUFA 2ZETA 3I64A 2YJ3A 3ODGA 2RG7A 3K32A 1QK4A 3DDZX 5JCOC 1U2ZA 1D4AA 1Z73A 2P78A 1ADFA 3H9EO 4X90A 1R4NB 2WEKA 2JS7A 2X2FA 3F1LA 3IR6A 3REGA 3NRBA 2DKFA 4IYJA 4AMUA 1UKCA 2QUZA 4BQEA 4ENSA 1E32A 3RUFA 4M0FA 2ZSJA 5KOIA 1AKUA 4J0QA 3UXYA 3B1ZA 4HVAA 4DMMA 1HKUA 2RBGA 1T5IA 5EJ2A 4E5PA 4QL3A 3HKBB 3G2HA 4H3HB 1LPNA 2AFIE 2QBYA 2ZVPX 4IDCA 5GV8A 1W9MA 1ONPA 4QWMA 1XG5A 4WVFA 4CEHA 3PGXA 1SB8A 3PVCA 1MX9A 1O4VA 1XOIA 1MPTA 1HYHA 1TQ8A 1B43A 1R5NA 2ZYWX 3GFPA 1AZTA 3H4VA 4JT2A 5ENDA 1VDZA 4HPJB 3BBLA 1FZQA 3DMNA 1K3TA 2EP5A 2ZU6A 2REOA 4NEHB 4R8SA 2FFQA 4V1CI 5I7EA 1GZSA 3KJNA 2FW9A 4KPYA 4XEHA 2DUUA 2AI1A 5CDYA 1Y7TA 2V7TA 3HB1A 1N6HA 1I6MA 3CMMA 3G85A 3IQEA 1EFPB 2VYFA 3UCEA 2V59A 5LOVF 1LRLA 1QRTA 3DMYA 1VJGA 2AOXA 4ZJUA 2O7QA 4V39A 2M6KA 4GI1A 3KSBC 3TLMA 2ECQA 3PJEA 4GSYA 4RVNA 4AWXA 4M49A 2JFFA 2JHFA 3AEQA 3BXZA 2VF4X 4J9UE 3CUTA 3DEHA 1PJ4A 1EFAA 4G5HA 2NUPA 2HRCA 3E8SA 2B21A 1AUVA 3HHEA 4MGKR 5KMGA 2ACWA 1VM6A 1I32A 2N3ZA 3B9QA 4G26A 3IBSA 1L7EA 1R6VA 4DR3B 1SXJB 4Q1EA 1XMIA 2F9LA 4UASA 3T5DA 5HW0A 1RXIA 10MHA 3OE7A 2BGJA 1BD4A 3ZI0A 1I0ZA 3RVLA 4LCBA 3ZWPA 5J2UF 4MPDA 3HKEA 4FYPA 4MQ4A 2C61A 4MITA 1J5XA 2P3LA 3M5DA 3PPIA 4KJXA 2AN5A 4NEQA 3QEOA 5EWMB 2WSSD 2VAWA 1IZ7A 2XTJA 3EJ6A 1VMDA 4UAGA 2OORA 4XWTA 3E1SA 3IDAA 4G8JA 5HIIA 5KDDA 1Y0BA 1NONA 3U5TA 3HUUA 4F86A 1BE0A 1F6DA 1M1ZA 1R2QA 2Q5HA 3IRVA 5GONA 4OQXA 5E9QA 5EUBA 4WFKA 2IRWA 3LF2A 4BGVA 5A4DA 1CX9B 4RZUA 1T9BA 1U3VA 2YUTA 1T6BY 2ZIXA 3GRAA 4QBTA 3WV4A 2OUKA 5JZ9A 1EZZA 4ZCMA 1TM5E 3B48A 4KRXA 1TQ2A 2ZJ6A 3L6OO 3NDPA 4HRXA 3ZHBA 1T0BA 3D1JA 4KKVA 1KYWA 2IYWA 1JG1A 3I52A 5CM8B 3VPHA 4Q4HB 2XUHA 3C41J 1RZ3A 3GCXA 5F35A 2Y2VA 4S1TA 3SBOA 3K6JA 4A27A 2QNBA 2E82A 1EDZA 2A9PA 2GLXA 4G0PA 4ZARA 1MGPA 4EA9A 4Y2TA 3LFHA 4L50A 4O0LA 4L28A 4GD3Q 3VYVA 2Q9UA 4JOSA 2RC6A 2X9NA 1M6HA 3P7MA 3IB6A 4E3WA 2Q6TA 2PGLA 5DEIA 1RI2A 2ZJAA 2P4SA 3IV6A 4OLHA 4U7JA 4XCQA 2HLHA 1MQ8B 3EPHA 4Q3EA 4GQIA 3TZ6A 2F1RA 2O48X 3F5MA 1J9GA 1RE1A 2RAVA 3RFXA 5FBVB 2O8DA 2NZVG 1PSDA 1Q3KA 2D7DA 2BUCA 4M8LA 4ZVSA 1IJEA 4CM5A 2J0SA 3JV7A 1HSZA 5ALKA 1XNHA 3AR3A 3I37X 4JL8A 5JUWA 1XZBA 2EDAA 2H11A 3LE8A 4Y6GB 1G2PA 3IMGA 4KJZA 3VRHA 4D42A 3ZD6A 2NZUG 1UM9B 3BC1A 3NG1A 1XJQA 3QKSA 4FYXA 1OYVA 1SQFA 3TMYA 4J0EA 4XM2A 2J3QA 4HWGA 5EIFA 4Q5IA 4E5MA 1XNRB 3O8BA 2D2VA 2G28A 1EHCA 5ADVA 5GQSA 4IX1A 3IAUA 1MA3A 3UMFA 4F11A 2I8AA 4RHEA 5FHRA 3TZHA 3WJAA 1HC7A 1NLUA 4N54A 2H1FA 4XVQA 2R68A 4E1BA 5J4KA 4BMOB 3FDXA 4L15A 4MQEB 1N1EA 2I7CA 4BFXA 4MLPA 5BV8A 5EIHA 1R6TA 2VNIA 5KWEA 1V8OA 2X5XA 1JLSA 5WRFA 4Q4AA 3L7BA 1VKNA 2Q07A 2WI8A 1KK1A 3PGA1 4GECA 4Q16A 1TO6A 4L0DA 2PX4A 3OIYA 4Z2AA 4FCTA 5CHEA 1WPXA 4UJ5A 1JPNA 1VSBA 2ZQYA 1OWPA 4DY6A 2PD6A 5LQKA 1RRPA 4IWYA 4JKIA 4MKHA 4ON9A 1G8MA 5K3AA 3RIEA 4KMRA 2WWGA 3OA0A 4YCCA 1KFKB 1TLFA 4DDUA 4Z7JA 4JEUA 1SCIA 2GPAA 3HO8A 3ZCQA 3R2JA 4EARA 4Y2SA 4DIOA 1PSZA 5K0CA 2F9FA 3TB6A 1YWGO 2O0HA 1ZI9A 5H80A 4PLCA 4DYVA 2PPLA 1NBIA 4EJSA 5L40A 3K8OE 5EEHA 4R6XA 3ONNA 3F67A 3N7AA 5IT9A 1TQDA 2EFJA 2XMCA 4RBNA 3AUTA 4V2IA 1YOBA 4Y9TA 4HJXA 2PD3A 1MW8X 1R6UA 2P68A 4OCZA 3P96A 3BJEA 5KTOA 2JZNA 1VSUA 2DE0X 2MR5A 3A36A 4F3KA 3GWZA 2O5VA 3HDYA 4ZO8A 4BNWA 3RE1A 2QE7A 3UICA 3GLHA 1GZ3A 5IW8A 3FJ1A 3JPWA 3R0XA 3R3VA 4L1KA 4Y2RA 1DEOA 1XEXA 5E0OA 1J99A 4AP9A 1WP9A 3ND5A 4E4RA 1Y48E 2XGOA 4JJ4A 4XDGA 3DC2A 1NMYA 2RJ3A 4D6XA 1OWOA 2GK3A 2VEDA 5JYCA 3CF4G 2BTQB 2IODA 1YGYA 1B8PA 1N2ZA 3RKUA 2EHJA 5FTJA 1J90A 5ALMA 1OWMA 4L5IA 4WK0B 4M4SA 5BRNA 3T7EA 3VNSA 3W05A 4FINA 4F21A 4F3NA 5ICGA 5F12A 3CH6A 1C3XA 5T3YA 1WMDA 4P3NA 4QLAA 3NORA 4JLNA 5JXIA 3X1MA 4HNRA 2OZEA 3QK7A 4MRPA 1MC5A 1O96B 2BEWA 4NNPA 1KZGB 2D5IA 5EXSA 2C4WA 5BYBA 3SC3A 5LZ2A 3INYA 3ADOA 5FI3A 5LQJA 5CNKA 1IZ0A 2LDBA 3HZOA 3F47A 1JQAA 3LP5A 3LQQA 4R83A 2Y67A 3PDUA 2AFHA 3BM5A 4BECA 4NY1A 2A4KA 3EZ9A 1T34A 3G9ZA 5EE9A 3SXUA 1NVKA 2J3JA 3KU1A 4RE6A 3CNLA 1FYEA 4TYNA 2WABA 5EIWA 2VJCA 1V41E 5AWFC 4YRRA 3EPLA 3OZXA 1E9SA 3V2HA 4OH7A 3N7TA 4N5DA 1BQ3A 2ILTA 2FUNB 3CUVA 4JC5A 1NVEA 1LWOA 3WBKA 5I8PA 3CX3A 3U4MA 2BE7A 2VYVA 5E7JA 3AVXA 3DE7X 4DZTA 3GXOA 4PVCA 4UE6A 4FILA 1ACMA 3MCZA 4AMGA 3WGUA 2XCTB 4ITVA 4RD4A 1VL2A 1TW2A 5CA0B 1JILA 5JLJA 1IMJA 2CGEA 1O5IA 2OCPA 2IZ0A 4PY2A 3ZHOA 4EUNA 4CMEC 5BNTA 4OK5A 3W5JA 4DQ0A 2BGWA 1O95A 3CEMA 1JQ3A 1FDIA 1P9RA 3DWEX 4GBED 4LE1A 1HURA 4H6PA 1LQUA 2W2QA 3GPLA 1V1MA 4X8OA 5ITZB 4GC5A 5BSTA 3W4JA 4D9MA 3WHIA 3LHSA 3TW8A 1IN8A 3CNQS 4X3CA 4QEZA 1EE2A 1X1BA 2W2XA 2O8FB 1YE5A 2NSYA 1K6JA 3WIUA 2DWQA 1FMFA 3QEKA 3T41A 2OTCA 3ZE9A 3QPWA 4RGYA 4ND8B 1PDOA 5E3JA 3QX3A 3FRIA 3H2JA 4O2LA 1PHRA 3KS9A 2Y0EA 3ZHXA 5K3BA 5C8YA 1M67A 2W6JA 3DO8A 4RD2A 1SBIA 1W48A 4F1KA 4Z4FA 3DS8A 1K4KA 3KJGA 4I5IA 1U0OC 4G56A 4ZI7B 5EE5B 3NKVA 1SKMA 1GL3A 2IXDA 4O0MA 1A7KA 1MCZA 1I0IA 1KJNA 1SMKA 4MQFB 4ZT2A 4DM7A 3CG0A 2D8AA 4M98A 4A0HA 3EF0A 4B84A 4QATA 1VTKA 2AYZA 3K1YA 1C2YA 3C98A 1JYFA 3OJLA 1E1CB 4YJDA 4KLCA 3LG2A 2C5HA 3I4LA 1NIJA 4LXHA 2Z2YA 2B3DA 4KN9S 4ZVUA 3ZZTA 3RU9A 4X7BA 2RFLA 2XNDA 4OHWA 3K5IA 2ZB8A 4BQRA 1E9EA 1LQTA 1G42A 1MEOA 2XE8A 3C8HA 2DQ4A 3O84A 3R5XA 4M9QA 1PGQA 4UHBA 3BWXA 4NOMA 2R8RA 1N4AA 2DHDA 1FP7A 3ROZA 3L8HA 2TRSB 1SA0A 4PQRA 2YOGA 2HEGA 4M36A 5BQFA 5C18A 3C3JA 3C8UA 4QOSA 5CB6A 1NYLA 3Q7QA 4G4SO 1FLDA 1OX4A 1USGA 2JBAB 3LO8A 3LY5A 1FXWA 1CIVA 2QQ5A 1ZOSA 1GADO 1WXGA 3DHEA 4AQ7A 1JPUA 2IA5A 2RGCA 4TTSA 4YROA 3F5SA 2AE1A 3EAQA 1NATA 3EIEA 1SGWA 3FZQA 3N0VA 2ZUDA 3RTBA 4I8IA 4O4JF 2K5UA 2IEDA 3BWEA 5CX1B 2GK7A 2HFJA 5HILA 4P86A 4II2A 4Z1OA 1RFGE 5G0TA 4ZVQA 2DJIA 4N0DA 4DLKA 3UWSA 2DFVA 1T24A 1TJ3A 2C96A 2WICA 3PVSA 1YBVA 3BD8A 5TJHA 2D2IA 3TZQA 4C4YA 2ZZMA 1DIHA 2ALJA 2VHUA 3EG9B 3V1LA 3MB5A 2HBRA 2VDLB 2ZITA 3PEWA 1P2TA 1Y8CA 2NM0A 3F5DA 5JS2A 4JA0A 4GM4A 4E1VA 1P4GA 5FOQA 1AG9A 1YI0A 2UZ1A 3Q2OA 2AC4A 1I7NA 1KK3A 2P3QA 3TSAA 5LJLA 2W0SA 1DX9A 5DCYA 3F8WA 4N82A 5BNFA 3TI7A 4PZZA 1EKXA 2FMXA 4CPDA 1A9OA 1Q17A 2YVUA 4JI8B 1ZBQA 3TFWA 3P2YA 4XQCA 3KSAC 4R7ZA 3GA5A 2I4TA 5JY6A 4U8HA 2PE5A 1J23A 1MAAA 1YV9A 3G3EA 1VJ5A 3GN1A 3ESBA 2HSDA 2H5JA 1NT2A 2X9LA 2CEKA 1DJLA 2HXYA 3FN4A 3M6UA 3NT5A 4UNRA 1R4MB 2NZWA 4XD7D 2GBLC 5K5EA 1DOAA 3GOHA 4YJFB 3WK5A 4FWBA 4US0R 2D5BA 1AS0A 1P4RA 2D62A 3GR6A 4XSHA 4FMPA 3PKJA 1JEQB 3F3YA 3H05A 1X9HA 3C14C 4UCXA 3THRA 5I6DA 3BMCB 3KTDA 3QENA 2VHZA 4EH1A 2Q8PA 2HO4A 4IHAA 4KH1A 1B14A 2JLVA 3KZCA 5CHYA 1NHWA 2WAYA 1OLSB 2NP7A 1NBAA 3QFTA 4B2PA 1EZ4A 2QX8A 2F55A 2BI4A 2BRUA 3HU5A 1K7SN 2OFWA 4I50A 1JSZA 3D6HA 3C7CB 4HLQB 4Q24A 4UZEA 5IMBA 3WO0A 3ZCPA 1RI4A 3H0EA 4B31A 3TGPA 1NN1A 1S8NA 4FE3A 3MWJA 4RTOA 3V6MA 3K0EA 1JJIA 4PSUA 5EJGA 3OIFA 3H9UA 2WB2A 4M1OA 1N0HA 3K5PA 2AZ4A 2J9FB 2ZI5A 2Q4RA 4BNXA 4W63A 4B3MB 1JZTA 3ET5A 5K09A 2HJWA 3MUNA 4EMUA 4F4FA 1WCXA 3CRZA 1NGSA 4EABA 2AW3A 1LNQA 1T3SA 3ENZA 3RYTC 3L0DA 5CXUA 1SEVA 2IEGA 2OHOA 3BA6A 5A5FA 3LYAA 1AJEA 4AY4A 1Z7WA 4TM7A 3T7SA 1PW5A 3W4IA 2P9YA 4YX9A 3TLKA 4LJ7A 3SZRA 2GI4A 4F92B 1L4BA 2HZBA 5DW0A 4IIGA 3CLRC 2A3RA 2HCFA 3GXBA 2C9YA 3OM9A 3QSGA 4IM7A 4JY7A 2P6RA 2VDUE 3K35A 4TN1A 3TJRA 2Z3VA 2RAFA 2WVHA 5G0VA 3SBEA 4PRLA 3HRHA 1NR1A 1CEYA 2OG2A 3KXPA 3SJAA 1T8RA 5EQTA 3O8NA 5DCLA 2SKEA 5COQA 3FMOB 1O03A 1T6XA 4MA4A 1ACLA 3ENWA 4LRQA 5EG5A 4ZU6X 3GVPA 4BZQA 1QRSA 3RHSA 2QE6A 4KR7A 2C3PA 3QVUA 5FL7A 1L7PA 2DUMA 5EHNA 4AZVA 1XF9A 5U9CA 1DAOA 3K94A 1OT3A 5CDFE 4QVKA 2HLNA 3BE5A 1EH5A 2ISCA 4KE7A 3LYUA 2Y0PA 2AIRA 1SVUA 1YUBA 2J3DA 3RDPA 3TAUA 5I7WA 1OAOA 1Z83A 1N5LA 2GD2A 4O4JA 5HZHA 3GLVA 4B81A 5JXWA 4PS1A 4CODB 1KNQA 3TW8B 3I5AA 5DXJA 2ODAA 1XDGA 2CJFA 4TKUA 3DWIA 4QGSA 1IBRA 4JLBA 3UPUA 1W88B 3V34A 3WRWA 2XRZA 5A9RA 5DI3B 3L7KA 2WKRA 1JBKA 1AN9A 3H5NA 1U3FA 4A5OA 1KI8A 4YQYA 1CR6A 4N3CA 1O6ZA 1WMBA 1N2OA 4QXOA 3FOAA 2AQ8A 3GC6A 6ADHA 1OFTA 4DLYA 5JD6A 2FHPA 4E94A 3ESYA 1KQFA 1SU7A 3OC0A 3UWDA 3HCDA 3A1TA 2J31A 1D4FA 2R4TA 3MINA 4ZU1X 3RTGA 1IZ8A 2C9ZA 1NI4B 3K30A 1APBA 4YDSA 2MYNA 1QTIA 4PYMA 5E38A 5GMOA 5JMWA 1FBNA 2QNIA 2HDNB 3QYAA 2IUSA 2YJ6A 1U5BA 3KXKA 2AHRA 4DLRA 2PXXA 3RROA 1ADCA 1SAYA 2HUNA 3TTXA 1Y1LA 3KLBA 4JC8A 3KT3A 3GF4A 1OYYA 2G9UA 3KV3O 4E2XA 4YCBA 4JT8A 2CLLB 2VAMA 1RJFA 2PX0A 2XKJE 1TE2A 4OHOA 4ZEXA 2YFQA 4HEHA 4KQKA 3EYAA 1E9VA 4CQLA 1R0RE 3H2IA 5CBPB 1IONA 3HPRA 2H7CA 2IF0A 3NB0A 3VKVA 4NCAA 3ZU3A 2CT8A 2G9ZA 3HP1A 3K09C 1PR1A 2JFVA 3O8LA 3ZWBA 2AUMA 1KDVA 5JMOA 4DQDA 5LDDC 2XAUA 4LW8A 3RVKA 2ZTVA 3DTYA 3WK7A 4UXIA 4WJLA 4HPWA 1KH3A 1V6AA 3K6RA 5IULC 2JCSA 4BU1A 2JKZA 3LX8A 4WN9B 5CM9C 3MD0A 4QU5A 5BV1A 3HN6A 5B1HA 3DVAA 1FDSA 2BM8A 2QN1A 4NPCA 2D5LA 3KAJA 4Z5XA 1OZ0A 5IBQA 4MLCA 5TF0A 4W5TA 3WHPA 3JQBA 5F2OA 1VYHA 2WFLA 4TTVA 1PLJA 1IPHA 2XRMA 2O8EA 1HA3A 2B7BA 3WKCA 2C0PA 2CMHA 3E7FA 3AZOA 3ZWYA 2HJVA 3LT0A 3OJFA 3FPSA 4JP8A 3RAPR 3VHXA 1N3IA 6LDHA 4ZYTA 3L5KA 4J2OA 2HQRA 3ZQJA 3ZHYA 4HAZA 4AY5A 4BQSA 4JI6B 4MVJF 5BOVA 3I28A 3UT5B 1C0IA 3IMEA 3KD3A 4HRAA 4PQEA 4IDNA 1EP3B 1BEEA 1MW9X 3PV0A 4UUNA 2L0XA 5DHFA 3H7AA 5IWAB 4QOEA 4DR4B 3VOAA 3MIIA 4DDMA 2ZRKA 3HZHA 4BMYA 2B94A 2FRXA 4Z51A 2XWQA 2EG9A 3EAFA 3OJ0A 5D5PA 1IWBB 2P2ZA 1SU6A 1KP2A 4DXAA 3GEBA 5KU1A 1IQRA 2HMWA 4DWWA 4NR0A 1WD5A 3LHFA 1CUDA 2WIJA 3RYIB 5E2IA 2OQIA 4EMSA 1POWA 4PLWA 4Z3DA 1M8JA 2F4NA 4QOJA 5FR1A 4MW0A 1WAMA 3MOGA 4DIDA 5GZ3A 2G77B 4NHEA 3FYUA 5F4ZA 1ZHHA 2QZJA 1VG1A 1XD8A 2XSZA 1U7DA 1SUDA 1CC1S 2LNDA 4HTFB 3NUZA 1E4OA 2A1IA 3O8RA 1DTWB 4RJ2A 1T8UA 1XXHB 1U3WA 1XZHA 2PWYA 3BXXA 3TNYA 2PS0A 2Z4SA 3HE3A 3K9WA 3QE2A 2AMYA 3RSOA 3W8RA 5KTPA 5FLXA 3JWHA 2UUAB 1J7KA 1R8YA 5ALPA 3AL3A 2OKGA 2GHTA 5JO0A 1II8B 4DV6B 1WY7A 2DBQA 1VGRA 2IXGA 4RKRA 5T41A 2EZ4A 821PA 3FRJA 5GJVC 1EJ2A 4DIBA 5EN4A 3PEEA 4N8DA 3AXSA 5KS2A 1QLJA 2XUZA 2VBGA 1G7CA 2Z5LA 3IT0A 1U31A 1GQSA 3QXXA 1ZP6A 2I2WA 4N3BA 2YQ4A 4Q4CA 3RKSA 3FCYA 4OL9A 3A28A 4Q1AA 1NVAA 1Z0IA 3WL8A 2OHFA 1WVMA 4CIDA 1HK7A 3COSA 3V46A 4ZDIA 1USIA 2WT8A 4FOTA 1Z68A 3LUAA 4LQLA 1MB3A 2ONYA 2VHEA 4P7JA 1FTGA 1TRHA 2RONA 4G01B 2ZTMA 5HYVA 2GN1A 4AB1A 1M6YA 5ELMA 1K4YA 5ISMA 1X1SA 4DRXB 2WAMA 4LYJA 1LCIA 1J9EA 3ZXIA 1E3DA 3GJ6A 5L6LB 5CP8A 3CJTA 4NAUA 4FONA 4NBWA 1LLDA 1ZH8A 4FR5A 3ZQ4A 3FHJA 2O5EA 2EBUA 1H65A 4CM8A 3UJAA 4MUBA 5K4HA 3ISJA 3EXHA 1LLQA 1G2OA 1BQ4A 1Z62A 2R25B 3FFAA 5TVKA 1OXVA 4RTSA 1WXQA 2DMRA 4Q7KA 2W2NA 2JFXA 1SHLA 3VJKA 5BXYA 3RLIA 3AKYA 3E22B 2FR1A 4N48A 1VJRA 3OE4A 3FH0A 1KY3A 4R2HA 4YJ2A 2I6TA 5C8ZA 4Y30A 5HIKA 1JB1A 3IS3A 1I3MA 2O2HA 1RYBA 3ETGA 1U2TA 1M83A 1N9ZA 4EO7A 1ZN9A 4GMXA 2CF6A 3WNCA 3C5CA 2BR4A 1S8FA 1E2BA 4UU1A 3Q1LA 2XB8A 4D5EA 4X44A 5IAGA 3D7MA 2X1HA 3MTDA 3MCWA 3QUAA 4GLBA 4RGQA 2XMZA 2FOXA 4O4HF 1WSBA 5EZYB 2WG1A 4A4DA 5G3ZA 3TK1A 1NMSA 3VHQA 2II6A 1MAVA 3N2GB 4G84A 4B32A 3BRWA 2AZXA 3AOGA 2Z4TA 3IQFA 4M0UA 5DK4A 3ZV3A 1OH8A 2VHYA 4HZIA 5CK5A 3HJBA 3ZBTA 3S40A 1M0TA 4QTZA 1AH2A 1ZKMA 1DAMA 2IITA 3L6CA 5BUCA 1X7GA 2JI8A 4Z7NB 5KOHB 3JZMA 3SYLA 1Q0ZA 4JFAA 3OY7A 2VNSA 4V3BA 2I8CA 2XNCA 3T3EA 4L3WA 3ELWA 3G8CA 5B57C 1PUIA 5JTTA 1YI8A 1CY2A 3NVKI 1MQSA 1KYVA 3LZCA 5E6SB 2BFPA 2MSNA 2RK6A 1XGKA 3DDHA 5D1NA 1XKXA 3NNNA 5JVDB 3A9UA 5F1OA 2C98A 3TIFA 2JANA 5EJ8A 2IS4A 1BVYF 2R6GA 4G4IA 4MINA 2NO4A 3FNBA 3H1AA 2HF7A 4GWKA 2RGWA 1C1XB 1OYWA 2FLVA 1SBHA 1OI7A 2NUTB 2VDJA 4BC0A 3HVRA 4JUAA 1EA7A 1G291 3FPEA 2J0UA 1U80A 2YV2A 5AJXA 2VF8A 4EW3A 2BHSA 4Y6SA 5AK0A 2AQKA 5HNKA 3TQIA 1FFDA 4D44A 1VXOA 4KVFA 1GKIA 2HDOA 2P0AA 4LXGA 2AEFA 3O0DA 3LTNC 2OXIA 2CLIB 3NBAA 1L5SA 2O2YA 1H6DA 4DA6A 2GEUA 1SOUA 1WVGA 2SECE 3FOEC 4G67A 1RQRA 4EB6A 1HE8B 1CV2A 1A7JA 1I4LD 3H2ZA 1D2RA 4RK5A 1X7YB 3LX5A 3ER6A 4YBRA 2POCA 4HZUA 5JV5A 5IAKA 5MF6A 5CNMA 4YP7A 3MN1A 2E4UA 3UJ6A 2QL5A 2DXIA 3OCVA 4C88A 2Z43A 2H29A 3TBFA 4JBXA 2WFMA 3AFGA 2VI5A 4CQJA 1YBAA 4P38A 2BL4A 3B9PA 3N0XA 4ENVA 4D74A 3BFXA 1AC5A 3P2IA 4MKRA 2MSKA 1J0AA 3P45A 1O95D 5AQ1A 4MS1B 5EJ6A 4PSKA 4ZEMA 4CF3A 4OKSA 1JH9A 3U7GA 3D8UA 3IHTA 3Q7RA 3VDMA 1JLLA 3INRA 1PW7A 4GOJA 2ZS8A 2JI6A 1PU2A 3B3FA 4HY3A 4XB1A 5CDTA 4LNUB 3B2NA 1LVGA 5J43A 1VE3A 5HQ3B 1CFZA 2AFHE 2I2AA 2JI7A 3GFQA 3IV9A 2JD2A 1HQKA 3H3FA 2AF3C 1Y8RB 3FPAA 3CVUA 5JAPA 3KEGA 5ERYA 4DSUA 5KQMA 3QF7A 4G5GA 2VRCA 3QKUA 4WDRA 3LLSA 4JD5A 2WIBA 4EGAA 5A4FS 2YHIA 1VBNA 3ZGOA 2O2EA 1OY1A 3SVLA 4CV0A 2XE7A 4TMZA 1KPGA 3UBTA 5I5GA 1GZ5A 2VPIA 4FMDB 5EJ7A 3CPEA 1D0SA 1D2GA 1HGXA 4G24A 3ZBUA 2CV2A 4DAEA 3UAWA 4FD2A 1ORHA 3LRTA 3PQEA 3GLKA 3TLCA 1Q16A 3GK3A 3M5PA 4URFA 3VR6H 3D54D 2Q2QA 4QRDA 3U4DA 4W6QA 3WTBA 1WXFA 1P7WA 5CEJA 3R5TA 2JJMA 2XYHA 4XB6B 4J7CA 3Q10A 1SD2A 3TMAA 1IN4A 1NNSA 2FUEA 2VJDA 3C3AA 3FPFA 4GPBA 4LVOA 4CMKA 4F3RA 5AVVA 4JS0A 1ISSA 2IWHA 1X74A 4EO4A 3NW9A 2OAGA 3N5KA 1R0XA 2RGNC 4MDEA 3SNHA 4EW2A 2VJOA 5H5JA 1XXHA 4GGMX 2DT8A 1C9EA 3GCGA 5AXDA 1PK7A 1MFPA 2XJ9A 3OO1A 4ND6A 3TIGA 2PO5A 3BUSA 3NWBA 3NM4A 3QUBA 2BGTA 4HX2A 2FEAA 1I2MA 4XWYA 5ALUA 4DABA 1DCTA 1GGFA 1E63A 3HXPA 2PPVA 1HDYA 2W9XA 4YJ2F 2Q5QA 3DZGA 5HCIA 3GN2A 3R76A 4MW6A 5DOVA 2XZLA 4X84A 1PGJA 1V7CA 3ITKA 4OJKA 5KDLA 2CLSA 2G88A 4L75A 4QBKA 5CJJA 5DHUA 2VPQA 4LJLA 1AGRA 4LZNA 3ME5A 4CLOB 4RZQA 3JQAD 3NIGB 3VBEA 4IX9A 2Z6UA 1AZLA 4HDNA 1A4RA 5BW4A 2ID7A 4QUBA 3NPMA 4QBIA 4LX0A 1MAHA 5EFZA 1L1RA 3G0BA 4C4PA 1NI3A 3ETLA 1RJ9B 4EY5A 5CLGA 3GH3A 4LDPA 4HDSA 4KQCA 4ZAXA 4HS9A 3T9BA 3VR5D 4GSKA 3TTUA 2XB4A 3EWIA 2UXBB 4PQGA 3I8SA 5KSWB 1A7UA 1EQ2A 5HPYB 4FYJA 4BKUA 2CUTA 3DT6A 3EXHB 5EXPA 4INZA 3RTAA 1A8PA 2Q4TA 1T8WA 2EZTA 4H6VA 4EF6A 2FFAA 3H6KA 3ND6A 4MI1A 1NYTA 3PUIA 3SIRA 2KBFA 1MDBA 3WGKA 5BQPA 3LPCA 1CZOA 5G02A 3AR8A 3D4NA 2B4RO 2OCBA 4Y0NA 4QPZA 1PRYA 4S1OA 1G20B 3BYZA 2MHCA 3H8VA 1GCUA 1RQXA 4X95A 4RPGA 3LX6A 3VJLA 3ECCA 3OJXA 4XTRA 2GTHA 1TTQB 5G0UA 3GU3A 4A8JB 4EHBA 3NHSA 4HX9A 3M2PA 5TF4A 3RV4A 1E6LA 3K1ZA 4QUJA 1N9KA 1ZGHA 1VJ0A 2PGNA 2YNMD 1F7UA 2BDEA 1J20A 1DJNA 1TEHA 4FS8A 1H3EA 3F4KA 4RKQA 5C32A 2ZJYA 3JZDA 4MCAA 4K6MA 3QP9A 4OVKA 5CFZA 3L04A 1FMTA 5BN4A 1JI0A 1OWLA 1U81A 2VHXA 5KOJB 1S0UA 1SKQA 4Z4HA 3B3JA 5LKRA 4NCBA 2YYAA 3L77A 5C53B 2VJAA 4PN3A 3DD5A 1SXGA 5CT9A 1PJZA 1V4BA 3B3AA 4MQMA 4RK7A 5HF8A 3BRSA 2P7HA 5L4LA 2IEIA 1F12A 4EB3A 4JBIA 2JFWA 4ZZ2A 3LS2A 4U7TB 3E3NA 3AJ8A 1B6GA 5JXGA 1HL7A 3NBQA 4E14A 3HWWA 1XVLA 4ROSA 4UHHA 2REQA 3R4CA 3T5MA 5BSKA 1JMKC 4X45A 3AINA 2UYHA 4G5XA 4PVDA 1W76A 3AFNA 4KXXA 4EA7A 4OHYA 1J00A 1VIDA 2ODQA 3K0BA 1E2NA 3IQWA 5G53C 2QL7A 4P8RA 3V33A 3VI3B 5F23A 4L8VA 1MHPA 1ZVMA 2RHGB 3B6MA 5F33A 3SZMA 4Q7MB 2UZAA 4X20A 1KSGA 1H69A 2ZDGA 1RXEA 3DTVD 1R0KA 2X15A 2NTNA 1YFKA 2VK8A 2YWBA 4QRHA 1GTSA 4WW0A 2GNPA 5LR6A 2XOKA 1DV2A 2ZM6B 1R9GA 3JWJA 2B9EA 1U11A 1Z37A 1FU8A 1R4AA 1NLMA 1J0BA 1TZ2A 4KXMA 2QW0X 2QM8A 3LQRA 2AA3A 3I0NA 5SV2A 5IYZB 4UU0A 3O92A 2CXRA 4LTNA 4OI1A 3DBLB 9ATCA 1XB2A 1GGJA 1I3CA 2Z5GA 1F9EA 2NZJA 4JCOA 3TZCA 1IEXA 3C85A 1LC0A 1SRRA 4WLOA 4ZTZB 1U8FO 5E8RA 5HF6A 4CCYA 8MHTA 1HDIA 2R87A 1FDRA 1V3TA 2OILA 1PKXA 2A1UA 4BB9A 5B30A 5AVJA 1XDBA 1RVV1 3IE2A 3PFNA 4UUAA 2LUOA 4FMCB 1J1UA 2ZRPA 1K6EA 3UCFA 4EVRA 3K1AB 3KSUA 3TW4A 3LT4A 3JYLA 1ODJA 3OEYA 5JH7A 3Q5DA 1DHTA 1DRJA 1I2BA 2C84A 1WLSA 3WGNA 2PKQO 3JQFC 3KJZA 1GY8A 3H5TA 1B1CA 1IOZA 5K8IA 2AWNA 3LBAA 4KTVE 5FOSA 3WGYA 2YWCA 4D5GA 4R3WA 4Q7EA 4L9AA 1S2OA 2YUIA 1W2HA 3BULA 1QG6A 2MYTA 2O5RA 3MPUA 3B6KA 3D4PA 3I62A 3LA8A 3L0OA 5I7RA 1XLVA 2Q3CA 3JQFA 3JXEA 1F9AA 1JIQA 1Z3IX 2XQFA 2X4GA 3CLUC 2OXRA 1AGNA 1KY5A 3OEEA 3GJQA 2YN2A 4NVRA 4YFVA 5G4LA 5TPWA 4FWTA 4QUGA 5DXFA 3V8PA 2FW1A 4YJHA 2J48A 2FMFA 1GR0A 1OPRA 4AZ0B 2GYVA 1F3LA 2P2NA 3RABA 5MHTA 2P3OA 4JBWA 2FEPA 4QGFA 2P11A 1K75A 1C8VB 2BFFA 1XA4A 1TTPB 1P9OA 4GR4A 2V4ZA 2IQ5A 2TSYB 1PQPA 1PGNA 3BIFA 4IIJA 4OFWA 4R98A 3EEYA 4RCYA 1OXMA 4A0QA 4BFLA 1HTBA 3HCWA 2JEZA 3ZHUA 2H3HA 1J8YF 2OV2A 4MJXA 1QBGA 4L8GA 1GNSA 1VE5A 3S6JA 1D2CA 3PFWO 3P32A 4PF1A 3ESCA 5LQSA 4PC2A 2PWZA 4P6VF 4P92A 2RCNA 3DBOB 4URVR 1LTKA 4IKOA 1U7WA 2JAOA 3DLPX 4RGVA 2P41A 4O4LF 3RBVA 1I30A 2PD4A 1CE8B 3OM1A 4N40A 1P0MA 2F6RA 1WXIA 2VDOB 2BGGA 1WEHA 4M60A 3TSYA 1ISJA 4C3UA 1D8AA 3QXCA 1JJ7A 5ANRB 3KAKA 4ALJA 3BGIA 4JP3A 3FHOA 5CM2Z 1XP5A 3AM4A 1ZA2A 4ECAA 2ZYUX 1NAIA 2HQOA 3NYRA 3PQ2A 3ZLTA 2NO6A 4LWZA 3H86A 4J7XA 4ZZ1A 2D1TA 1ATZA 3FUTA 3JWPA 4LV8B 3I5MA 2P1RA 3P9NA 3RVNA 4CCAA 1P1BA 5HKKA 2JDID 3RS9A 3PLRA 3MJEA 3TTYA 4ZALA 2RI0A 1YK0A 2D74A 1LPBB 2O0LA 1OILA 1AKMA 1HZZA 3CLSC 3QXSA 2XMPA 3T3HA 3ER9A 3GIWA 3N0RA 5LXTB 1XQWA 3QW4B 1IG3A 3NATA 4Q3OA 2W4IA 4DBLC 3P27A 4C4ZA 4K88A 5T4BA 1FCJA 3NBZC 1J39A 3QV1A 1UDXA 1EESA 2VH1A 2ENUA 3I05A 4JAVC 2AC7A 1TYAE 2YJZA 4FDAA 4MW7A 4MQ6A 1SB9A 1SRQA 1DINA 3R3JA 3ANYB 4IXTA 8OHMA 3S1LA 4I55B 3OIWA 4KOAA 1A5AB 4CTMA 2C5FA 1JDVA 1H8ED 1HTTA 1TF2A 3ORSA 4R31A 3R9XB 2XA1A 2FSPA 2Z0MA 2O8FA 1V4VA 3P9QA 3PE4A 3FSGD 4LJ6A 4OXKA 4YMGA 2WWFA 5HK9A 2B78A 3CVYA 2G4CA 3B8HA 1SULA 3PFBA 4XGNA 3TOCA 3WRYC 1DTSA 2XNSA 5DGHA 1SKYB 5KKAA 4EM6A 3PEUA 1I1OA 2CL6X 3QE4A 1Q14A 1QGOA 2F9MA 3A4TA 5JROA 2ATIA 1XZIA 4DLVA 1U8UA 2XW6A 1YU6A 3N2KA 3M6VA 3ASZA 1KY2A 1B73A 2MT9A 1FPQA 1LRKA 2YXDA 2HCTA 4MUGA 5DGXA 4IFTA 3TDKA 4Y9DA 4AMVA 4RABA 2F43A 1P9NA 5G1NA 3R7WB 2IOFA 3CUWA 5C3UA 1JDSA 3GELA 5DK6A 1Y6ZA 1RKVA 1TPZA 1HDZA 2VDWA 4NOLA 4A6DA 4P0QB 2ZXUA 1GFWA 2J85A 4M21A 1G5PA 3DM9B 3NBFA 1TPYA 1M1NB 1RRMA 1QAOA 2OLEA 3IAHA 4P3KA 4R9RA 1P1HA 1EBFA 5ALQA 5KMGB 1FXSA 2E85A 4XRRA 2EU8A 3DT9A 1QIFA 1AF7A 4QFBA 2NVUA 2GRAA 4HAWA 5AJYA 3X1DA 2H0QA 3MTIA 3QTLA 3NVDA 3U7FB 5EXXA 3KB1A 3GUVA 1KMHB 1N2BA 3O9ZA 4UHKA 4HC4A 5KVSA 4P2BA 4YJGB 3C39A 1R1DA 3KU4A 4Q37A 1R5BA 2FJPA 4D9IA 2PSDA 2CL5A 5H59A 5HBGA 1BE1A 3BSWA 4M1KA 1ML3A 1R4ZA 3FETA 2NAPA 5IYZA 3DMRA 1UK9A 3KQWA 3LDUA 1U0HC 4F60A 3B6JA 5A3RA 3NO4A 3KLOA 3DBLA 3ZV4A 2VH5R 2ZRAA 3KVRA 1E61A 2IE8A 2X0RA 2IZ5A 2JK1A 4MW1A 4RA6A 1I94B 1TYCA 2V6FA 4H4EA 3WNQA 4EPYA 1N1GA 1OROA 4HGZA 1FDVA 1NLZA 1KAHA 4RL4A 4PC6A 3VXKA 3I2YX 4YECA 3BGSA 3MGAA 3GARA 2HBZA 3BXHA 2NVBA 3WB2A 4PX3A 1YQTA 4RCVA 4AU1A 5JH7B 2GBIA 4D9HA 5FA8A 3DOEA 3PDHA 1V35A 2G1UA 2J67A 2ZJ0A 3DGEC 3L84A 4UMVA 3GMIA 4QNRA 1JE1A 3FMPB 1QYXA 1UQRA 5BN3A 4B82A 2R6R1 2Q1YA 4PNEA 2C1XA 3V4VB 4BFZA 1ULTA 2VS1A 5JVDF 4MB6A 1E8NA 3WQRA 3PTAA 4MB0A 2IP2A 5DDIP 4UEOA 5BV0A 2GMWA 2OZPA 3HB9A 2H00A 3QU7A 4CR8A 1T1SA 2DHQA 2JIBA 3FFWA 3RJ5A 4EZEA 3W6ZA 3AV3A 2ZAOA 4J1TA 4ZGWA 1F48A 1MF7A 1ZM3A 3EA5A 1CY0A 1NN5A 4Z9XA 5TPWB 3O31A 5CVCA 2Y1CA 1ZD1A 3EFEA 4IFEA 5CGQB 3KOXA 3I9V6 3WE7A 4EB6B 4DR2B 1H8HA 2MJLA 1NSFA 3AFMA 4IIJF 5A2GA 2GVNA 4MRSA 4U8GA 4YUZA 1XRNA 1YUNA 2OZLB 3KOZA 4FFDA 3N8HA 1QX4A 3GFBA 2LIVA 3KQNA 1DOZA 3EVDA 3NFYA 3RC7A 3V8NA 2C2YA 3CSDA 3LU1A 4LMBA 4NESA 4X1KB 1YT5A 4BNFA 3QTBA 5HKAA 1GUDA 4TS4A 1P0FA 2AV6A 1RQNA 1PJQA 4L6AA 3RS5A 5LP1A 1A9SA 2WFZA 1AKYA 2E18A 1CR1A 3NAMA 4WK6A 1CY4A 2L82A 4HQOA 4NE7A 2B8JA 2XWPA 3EZYA 1ZN7A 1DKQA 4QDUA 1VJ1A 2NOAA 2OV6A 3TIVA 4G65A 4HHEA 4F97A 1FU7A 3PZRA 1JDNA 2ONKA 5LCXA 3TD9A 4XD7A 4E4YA 3WSWA 1PWHA 1TT5A 3WGZA 1Y3CE 2ANCA 3L6UA 1SXHA 2C59A 4YRKA 1E5LA 1FNBA 2HA0A 1XRLA 4OYRA 1HOTA 5TC4A 4C5AA 4E2YA 4NBUA 2B34A 4Q3NA 4R0NA 4PYQA 3FB1A 1T9HA 2OORC 9MHTA 1W85B 1NHGA 2P69A 4FFWA 4H7DA 3DMDA 4LJKA 4WSOA 5ER9A 3HKCB 5JH7F 3RSLA 3ELYA 1EDEA 1J49A 1GGNA 2Y1EA 2OY0A 3VYSB 3DSRA 3O47A 4ZTUB 1TD1A 1RXUA 4NULA 3A3PA 3VH1A 1E20A 3WIOA 5FULA 3E9EA 5GVRA 5GPBA 1G60A 1WB9A 1CJMA 2IUUA 2OD7A 4JKOA 3T7JA 1ZI8A 1MJNA 1CVLA 2R7MA 3R77A 2GUWA 5KWSA 1YIAA 1DS6A 1UJCA 1ETUA 4P7GA 4BUCA 1KZ6A 4ZV4A 3I12A 2MR6A 1FYWA 4QSHA 4LYFA 2ADOA 1UL1X 2ZUSA 1LGYA 3STXA 3TW6A 4TVKA 3VFDA 2B8NA 1SXPA 1JPJA 1XVAA 2WT4A 2DJ5A 3GLHB 3WLRA 1HZJA 5H81A 2WJ4A 4PSAA 4UAVA 3NBUA 5HTKA 3GA0A 1DRUA 4H17A 3ZWDA 2KHZA 3S8YA 3B9RA 2Q3MA 2MIIA 4Q3KA 1W88A 4D8XA 3DVRX 3E9MA 1QQ5A 3S2YA 3CRW1 2VWGA 4PG8A 1CERA 3B1XA 3O9VA 4O3FA 4PIPA 2QX4A 2VNHA 1UMCB 1C1DB 5LMZA 4M1WA 1Q83A 1AGYA 4O29A 1VB3A 3DE2X 1QSGA 2QLTA 2X6RA 3EFBA 4QWWA 1KQ3A 3V1KA 2Y4NA 3RSGA 4DDWA 1QFMA 4DNFA 1A4UA 3OKFA 3OLYA 1L3BA 3DEIA 4KRGA 2YRWA 4TM8A 3EQZA 2QM3A 2H2GA 2JFPA 2CFTA 2XZPA 4QKQA 3AXTA 4X1YA 2JKVA 2I2BA 3I73A 1MUUA 1RYEA 3M1YA 3QU9A 1U5BB 1IEQA 1ZUNB 2WKPA 3UJBA 3AI1A 1AKVA 3LFUA 3RU3A 2FP4A 3C4JA 4XYMA 3WKAA 4AYTA 3H0CA 3I9OA 4UNNA 3JWIA 5K3EA 5BR8B 1V5FA 4Q3BA 1IJBA 3LQFA 4HVTA 2IYFA 3OEHA 2M1ZA 4YGXB 1MO6A 4KLRA 1KZ7B 3WYEA 3MPOA 5CRIA 1E9RA 3OD1A 1P6UA 2A0UA 3AW9A 4EPVA 3PZBA 5L9AA 4LCEA 4N49A 1EPUA 2YHAA 5EYPA 3T4EA 1GFZA 1ZISA 3EIQA 4DEXA 4F85A 5CFLA 3GGGA 1KF0A 3BAFA 3HDTA 2Z58A 3K6SB 4F8JA 3LPLA 2WNSA 2BFDB 4LQ4A 1FVXA 5IYZF 1EP9A 1FFSA 5LJIA 4G9EA 1EVYA 2QUHA 1F2DA 4G36A 3AVVA 3A1NA 4G1VA 4UDYX 3C6QA 3LLUA 5HQTA 1XKTA 4JB2A 1XTVA 4PPQA 4ZAWA 5B2FA 3RBAA 4C29A 3I6IA 3GQVA 1L9KA 4CL2A 1MLDA 1UEJA 3EG5A 1PBNA 4WY8A 4I5FA 1GP2A 4QXAA 5FWNA 1C0PA 3AF5A 3UQYS 1Z8HA 2NPIA 2PH7A 4BZWA 2D1FA 2PX2A 3X2FA 1PK8A 4TL7A 2PRYA 2IYOA 4Q3CA 1P0PA 5EMLA 1U0RA 1G7TA 4U7WA 4X6YA 5F3DA 4BRWA 5T67A 2H8KA 3JYPA 4TGLA 1KO8A 1H3NA 2BCJQ 2ATVA 3HVUA 3AR2A 3THXA 3PHGA 2QRJA 2O6LA 4F46A 5MN4A 2ZB4A 3RHZA 4QDJA 3LNCA 4EGQA 3WL7A 4ZI7A 5K4GA 2GHIA 3PFIA 3Q8MA 1YL7A 2FG7C 5HRCA 5FFMA 1X1TA 2W2PA 1P3DA 1WKCA 3N76A 2CD7A 1ATIA 3D4OA 3O3MB 3P9KA 4KIFA 4NOKA 3ED5A 3NWOA 1U9CA 4UMDA 1DSSG 3ZH2A 3VV3A 5J4HA 2CE2X 1MVNA 5A5GA 4HADA 2YDYA 4PZEA 4CM3A 2QTCA 2PWAA 4F3CA 1U2RA 3OA2A 3PEFA 5AKEA 5E7QA 2C9OA 3TWOA 3ZHZA 4BX2A 2ZWAA 1EK0A 4GYYA 4BVEA 2I99A 4HB2A 4PLPA 3U6KA 1QP8A 1GN9A 3K73O 2MYUA 2QJRA 2Q46A 2W2KA 3H83A 1L4KA 3O2QB 5J58A 1PFWA 2YS7A 5JWOA 2ISQA 3HL0A 4GI2A 3G2MA 1KVSA 3GLTA 4LZZA 2BF4A 4WNAB 1AHHA 1JHPA 3BCHA 4OB8A 3NXKA 3O6VA 2O7NA 1N5OX 1O57A 4GI3A 4LGMA 1BWSA 1WUKS 1H0SA 2EWMA 3DOHA 1JQBA 1NQAO 3F74A 2QTTA 4HFRA 1BNCA 4XUDA 3Q6IA 3PD7A 1ZLYA 3WJ7A 3EBOA 2W6MA 2EWVA 1CUIA 3NHRA 1EQUA 5BWMA 2DU8A 3G13A 5DYIA 2F8LA 2AFVA 3URKA 3HGTA 1X8KA 2I3AA 5DASA 1T4BA 3A6HA 4INOA 1A5ZA 3IVMA 1VPDA 4X6UA 5KREA 1SPXA 1L5NA 4I4CA 4O3MA 1MX3A 3ZY3A 1DQYA 2E4ZA 1HEIA 5I7SA 2PS3A 3H6HA 3S1SA 3QYFA 5TY0A 4EFKA 3DE1X 2G0AA 1Z18A 1NPDA 2XCUA 3DOUA 3MELA 3U4QA 1AIPA 1VL5A 4DBVO 2OPHA 1SIOA 1T1IA 1USKA 2C5GA 2GBFA 2QL9A 3RV3A 3W1VA 3WNDA 1DAGA 4C03A 1IUNA 1YB7A 3HU1A 2CKDA 2AEJA 1QVWA 1YIDA 3FAKA 4J0IA 4E03A 1PWXA 4N8EA 1UMKA 4IHJA 2BR3A 4FOSA 1JHMA 3CZPA 5DGDA 1G3IA 1SOVA 1DKOA 2R7KA 2WIGA 3ILSA 3BFKA 3OOWA 1XMQB 1VGVA 1GKUB 2CZCA 1RR6A 4OD0A 2WYHA 1G98A 3IQHX 3L7JA 4Q39A 1PJBA 1Y9AA 4Z99A 5HM6A 2NXEA 1MQ9A 1N6PA 4KPUB 4PLGA 1YNOA 5AUQA 1YO6A 3C43A 3WGMA 2CLDX 3Q12A 1OLSA 4J43A 3SE7A 2JFNA 1ZINA 4BC1A 5K05A 2OT3B 5BR4A 2GCGA 1AA9A 2XEXA 4MYCA 1K1EA 1QU3A 1KP3A 4O2RA 2GF0A 5J47A 3CEJA 2YDXA 3A9SA 4IIHA 4KXWA 1EUYA 3SHTA 1EG7A 2V7PA 2GPTA 1PVVA 2PV0A 3TW0A 1F1BA 1TECE 2IF2A 2X4LA 2E9SA 1YQ9A 1E2MA 5DHSA 1AMNA 4OY3A 3LWBA 1HLFA 3EAGA 2PYIA 2BCGY 4M0MA 3QEAZ 3E2IA 2H4JA 1Y1RA 3ILXA 4KLAA 1EHIA 3QLUC 1KAOA 1SHJA 1TUBA 1N9GA 1NBMD 3RAFC 1S5PA 2ERYA 2QZ4A 3O3NB 3PD0A 4FN5A 2Y1WA 3BEOA 2EFEB 2ZKIA 4UHFA 4BX0A 3G8YA 4K9OA 2NQ2C 4DOMA 3EDRA 3LQ1A 1SBYA 2DBRA 7YASA 1QIIA 3ZWWA 2XT6A 1L4UA 1XCBA 1L7QA 3ABSB 2V96A 4HNGA 4TV8F 5TJ9A 4ZK6A 1LLCA 2NXWA 3C1UA 5C7IO 2HHAA 3AJRA 4MTLA 5C46F 3U7JA 4O2BB 4JP5A 5AJUA 3K16A 3A9RA 1X70A 4HSGA 1W2WB 4ODIA 5KI6A 2VDMB 4NZNA 1L4EA 3K6KA 3R9KA 4NP6A 2FN3A 1L4YA 1Y1QA 3JQGB 4NE9A 3EISA 5AVKA 1FQKA 1MJHA 4CMBA 3A9CA 1N0VC 4BU0A 3QVWA 3B1FA 3U61B 2XITA 1N8SA 4J0KA 1FJHA 2VCEA 3WGOA 3N28A 2ZI3A 1ORIA 2FZ5A 3FCCA 3M82A 3NHKA 1XCGB 2QKYA 1UOPA 4R68A 4QU9A 1AMOA 3ZXXA 4RVCA 2ZW9A 4UVGA 4WX2B 3T52A 4ES6A 1GU7A 4F5WA 1F20A 1U63A 1CR4A 1MC8A 1PVOA 3IELA 4UARA 3L49A 1MR3F 1VI5A 2GN2A 4ZYYA 2V6GA 2YWDA 4J0GA 2IX3A 3D7NA 4HGOA 4BO6A 1MOQA 3HR7A 2QR2A 3ILHA 3BJIC 4ID3A 4RORA 4F91B 1IEVA 1E89A 3TTVA 1XF1A 3JYQA 4U6NA 1G64A 1NTOA 2NQ8A 2C5EA 3JD1A 2IHJA 1K0FA 4UQLA 2PLRA 4G3XA 4D98A 4B4UA 1NW9B 5IX8A 4L9SA 4TLEA 1JXOA 1NBOA 5FL3A 1CJCA 2VWQA 1ECBA 3HADA 5JBQA 3L7IA 3HXKA 4IMPA 4L57A 4IP0A 1ELOA 4X3PA 4WLNA 3W77A 1JFSA 5CEEA 4F9FA 3UYKA 4HGQA 1BWQA 2Y92A 4KL8S 4FFVA 4I2NA 5F76A 4LFBB 1GPBA 5LDHA 1HXHA 4ZMBA 2XCQA 4HN9A 2JAHA 4NFLA 3OM8A 1KOLA 1FNNA 2BRUC 1I3KA 3T3GA 1RRFA 1ZK2A 3U6BA 3FTPA 5HE8A 3C6MA 2RI1A 5DF1A 3RR2A 2ERCA 1GLNA 2O1SA 1VA4A 2MTBA 5FD8A 1L8LA 5JDCC 1KOJA 1NM5C 4GMGA 4W5JA 3GX1A 3V8QA 2YC4C 2Y0CA 3DV2A 4L5AA 3WLOA 2GM4A 3R8FA 3OHSX 5CG1A 1EEHA 1M2FA 2O23A 2SNIE 4FGLA 1X19A 4BL5A 8LDHA 1KFEB 4CM9D 1R5OA 1THTA 2XCIA 4C20A 4W9RA 1PUJA 2ROQA 3RYCB 1MG0A 1GIAA 3CZ4A 4AJIA 2X7JA 3E48A 4BNNA 1OI4A 2IYNA 3CM0A 3ZZ0A 5C5CA 2QAJA 3LCVB 4TZKA 1GRNA 3DP7A 3IJPA 4G8DA 4WVLA 4X61A 3ZY2A 2EP7A 3PXCX 4YHHB 4ZU3A 2VP9A 2G5TA 3W9YA 2ZBRA 1M75A 3EN0A 1JIVA 2WUDA 2JCYA 1VPEA 3U3OA 4GLFA 1AURA 4ZVPA 4L6IA 4DUYB 3ICOA 2ZUUA 2JRLA 3WMFA 3V42A 4UXHA 1QRAA 2ZROA 3FTCA 2JFOA 1AXGA 3EDCA 1QGUB 3GJTA 4K0RA 5LBUA 4S04A 3E0QA 1OLXB 2AT1A 3AHGA 5DISB 3RRJA 4YLEA 3KZXA 1W5EA 1NMZA 3O8DA 1W581 3QQPA 4JOCA 4K5QA 4NYIR 4RIFA 3HNOA 4JDPA 5ER6A 2GNAA 2FGJA 4DKXA 5HKKD 1QAMA 2NADA 2O3SA 3KFLA 1JQKA 4IJMA 4RXUA 2Y4OA 1OLUB 1Q7CA 1GGVA 3EASA 4EHLA 1IUOA 4LXTA 3H1TA 1F51E 2VK1A 4WOBA 1ZH4A 3C1TA 1IPEA 2ECOA 2IEYA 3MNFA 3E7WA 3P2MA 4KBFA 1I0LA 4QAJA 2NGRA 4WCFC 3WGTA 1SG0A 4Z4EA 4HB3A 3JVVA 1HNXB 2VC2B 1QS0B 3KETA 3EXIB 3GG2A 2ZGVA