1EGQA

Enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 a resolution
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
279
structure length
279
Chain Sequence
AAQTNAPWGLARISSTSPGTSTYYYDESAGQGSCVYVIDTGIEASHPEFEGRAQMVKTYYYSSRDGNGHGTHCAGTVGSRTYGVAKKTQLFGVKVLDDNGSGQYSTIIAGMDFVASDKNNRNCPKGVVASLSLGGGYSSSVNSAAARLQSSGVMVAVAAGNNNADARNYSPASEPSVCTVGASDRYDRRSSFSNYGSVLDIFGPGTSILSTWIGGSTRSISGTSMATPHVAGLAAYLMTLGKTTAASACRYIADTANKGDLSNIPFGTVNLLAYNNYQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEINASE K
publication title Enhancement of enzyme activity through three-phase partitioning: crystal structure of a modified serine proteinase at 1.5 A resolution.
pubmed doi rcsb
molecule tags Hydrolase
total genus 101
structure length 279
sequence length 279
ec nomenclature ec 3.4.21.64: Peptidase K.
pdb deposition date 2000-02-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1egqA00
1YJAA 2IY9A 4OMDA 1TM1E 2B6NA 5ARCA 3D43A 1YU6A 4GI3A 2SICE 3DVQX 3QFHA 1KDYA 3I2YX 1R6VA 3OSZA 1GA1A 1Y33E 1SBCA 2XTJA 1BE6A 1NDQA 1TM3E 3AFGA 4RYDA 1SCAA 3TI9A 1P8JA 5JXGA 3WIVA 3WIUA 4KG7A 1T1IA 2W2PA 1KE1A 3D9QX 3DE2X 3DE4X 5B1DA 2DUJA 5SICE 4C3VA 1C9NA 5JXJA 1T1EA 2DP4E 1Y1KE 5FBZA 1GNSA 1PEKE 1WVMA 1GCIA 3T41A 4HVLA 1CSEE 1TO1E 1SUEA 4DWWA 4K8RB 1Y3DE 1HT3A 2E1PA 2X8JB 2W2OA 3A3OA 1Q5PA 4NMXB 3CO0S 1SCJA 1SIBE 2HPZA 1ST3A 1OYVA 1S02A 1Y3CE 2ZWOA 3AJ8A 3BGOS 3EDYA 4OV6B 5K7SA 1R0RE 3EIFA 1MEEA 2ZRQA 5JMOA 2QTWB 3DVSX 3WQBA 1SBHA 2PWAA 3VYVA 2GKOA 1YJCA 4DJ5X 1SELA 1SUPA 1UBNA 1DUIA 3DW3X 1Y3BE 4M1ZA 5CW1A 1SN7A 1SBNE 1XF1A 2V8BA 2Z58A 4WOCA 1KDVA 5JXIA 3UNXA 3WHIA 4B5LA 4Z2AA 4NE7A 2Z30A 1GTL1 1ST2A 3GT4A 3DYBA 1LW6E 1NDUA 3I37X 4J94A 4ZARA 1S01A 3GT3A 3F7MA 1GA4A 1SBTA 1Y4DE 2G4VA 4ZOQI 1EA7A 1WMFA 1SIOA 4OMCA 3DDZX 3VTAA 5B1EA 3SICE 3DE0X 4YN3A 2X8JA 3ZXYA 3F49S 5AVJA 4I0WB 5AVKA 5AMXA 2XRMA 5JXHA 2WUVA 1SPBS 1PTKA 5FAXA 1SUCA 1SUBA 1BFKA 3VV3A 4NE9A 1GA6A 2IXTA 2SECE 4KPGA 4MZDA 3ZXXA 1WMEA 1AK9A 2ST1A 1P7WA 3VV2A 2PRKA 2SNIE 4AKSA 1C9MA 2Z2YA 3DE5X 1R64A 1TECE 4H6XA 2W2MA 1SH7A 1AF4A 3AJ9A 3LPDA 4AKTA 1BH6A 1DBIA 1OYOA 1JEAA 2Z57A 3Q5GA 3H42B 3L1KA 1A2QA 4CFZA 1AV7A 1V6CA 1Y48E 3VHQA 2P4EA 2W2QA 2HD4A 3GCXA 2PQ2A 3DWEX 3SQOA 1GNVA 1BJRE 2DQKA 1SUAA 1IC6A 1SCBA 1SUDA 1Y9ZA 2ID8A 3GCWA 4H6WA 1TM7E 3I34X 1EGQA 5ARDA 1GTJ1 3DE1X 3CNQS 1GTG1 2PYZA 1ZVJA 3LPCA 3VSBA 4CFYA 2W2NA 2Z56A 1TO2E 3A3PA 1NLUA 3DW1X 2PWBA 5FFNA 3TECE 2WUWE 2ID4A 1TMGE 1AQNA 4WOBA 1SCNE 1BFUA 3A3NA 1AU9A 1WSDA 5ARBA 1GT91 3PTLA 1THMA 1AVTA 2ZWPA 4CG0A 1TM5E 2SBTA 1CNMA 2WV7A 1YJBA 3Q40A 2WWTA 1C9JA 3PRKE 1SCDA 3BX1A 4LVOA 1C3LA 3EE6A 3LXUX 1AH2A 2Z2XA 3QTLA 1P7VA 4KB5A 2Z2ZA 1MPTA 1KE2A 1TK2A 1SBIA 4LVNA 3BPSA 3QMPA 4HX2A 1PFGA 1WMDA 1Y34E 2PMWB 2TECE 4H6VA 4JP8A 3TI7A 4BWGA 4DZTA 1PJ8A 1T1GA 1ZVKA 3DE6X 3P5BA 5I9SA 5AQEA 1S2NA 3LPAA 3HJRA 1SIUA 1SVNA 4C3UA 4FONA 3F7OA 1TM4E 3DE7X 1Y4AE 1VSBA 1V5IA 1Y3FE 3I30X 1KDZA 1IAVA 1OT5A 3DE3X 3DVRX 2PKCA 1BE8A
chains in the Genus database with same CATH superfamily
1WHTA 1A1SA 4UZFA 4B2PA 3HKCA 3QA9A 4QARA 2NZUG 2XPCA 3RVBA 2ZBUA 3ZKAA 3G5LA 2LXNA 121PA 1L7XA 2IGTA 2Q0SA 2P2DA 4MW5A 4Q4DA 1XPUA 1EWQA 1SXIA 3UUEA 2PX0A 4CM9D 3S2GA 1J8MF 4IZIA 3B6JA 5EE5B 5TGDA 4E2FA 2VDNB 1ZBDA 1M1YB 1QJ4A 5H82A 4BE4A 1W6UA 2AUTA 2CK3A 5KYWB 1K8RA 1K8XB 5CG1A 3ES9A 4JY7A 4GXTA 4JJFA 1HKHA 1XA0A 4RVUA 3FLMA 1JG3A 1AZWA 3ROTA 4E5KA 3E7FA 4MVJD 4XGIA 2O8EB 3TZBA 1D2HA 4AWBA 1P1CA 3EJ6A 4WMLA 2E1PA 1GTRA 1CUIA 2HPZA 2L19A 3BMNA 3IV9A 3JQAD 2Z8YM 2HDOA 3OTWA 4O5AA 1US8B 3T1HB 1GADO 1QIFA 3MYRA 5ALYA 4AY4A 3RU2A 2P77A 1EK0A 2PU5A 1L5YA 2YTZA 3HL0A 3LQRA 3FNEA 2WMNB 3VYTB 4A2QA 4B40A 4GKJB 4PCAA 2D1YA 4DCPA 1ECFA 2HDHA 2W4QA 5FOWA 2QYOA 2Y9MB 3KL4A 1RLIA 1SHZA 3AKEA 2X5KO 3DS8A 4TKZA 4HMPA 1OLSB 3UJDA 1VA5A 2PV0A 2HN9A 3HA2A 3UHAA 4EFNA 3N5KA 2F3PA 2AFRA 3FPJA 4YP1A 1QPZA 5FDFA 5E1DA 1Z0AA 1NP7A 2PCLA 4QBTA 2ZP1A 4OHRA 4C0LA 1NJ8A 4ND5A 1IM8A 4LV8B 4R2LA 4LF5B 2QRMA 1EVIA 3AUYA 3LHFA 3ABRB 3ABIA 5IK2D 1DC4A 3ISTA 2MDTA 5FBHA 3A8TA 1U2RA 2ENUA 2DERA 4MZDA 2HTFA 1W29A 1N6HA 3E3OA 3AZOA 4ODIA 2AR9A 5ED4A 2BGGA 1JE1A 1F0NA 2X0IA 3MQFA 4LDQA 3JZMA 2DCMA 1DJMA 3LYLA 1JVNA 3NM4A 3R6GA 1D1SA 3SSOA 2C9OA 4C0AC 1KQFA 4QG7A 3IP1A 1ISFA 3VR4A 1H2XA 2I29A 2YN2A 3KDPA 1UXKA 1QP0A 2GBLA 2Q5IA 4RPLA 4YWHA 4IMPA 5LOVF 1O94C 1UBHS 2EF0A 4ZCSA 4DWJA 2BGJA 4O0MA 4XDHA 4DZZA 4MV9A 2HWKA 5E2IA 2C8LA 2XXBA 3NMUF 4WKNA 4BKQA 2G4LA 3OBIA 2BFDB 2PBLA 1BS1A 1T3ZA 2PXXA 2PBFA 3H3XA 3I01M 4E5MA 3L06A 2VYND 2VWGA 2VWPA 3W5VA 1OQAA 2FPPB 2WM2A 4L7QA 4Q7EA 3WP1B 5IJ0B 5I7OA 3ETNA 4XUGB 4XQCA 4J1TC 1EDBA 3J7TA 4D4HA 3LUCA 3RWMB 4BV3A 3E3AA 4ZVQA 4YDQA 3TE6A 4E2WA 4TSFA 3WK4A 1UT6A 4MI9A 4CTNA 2ZSIA 4M9RA 3N2NA 3OF2A 1GZ5A 2PQMA 2RHMA 4LK3A 1YS9A 3DDNA 3FPEA 4R5MA 1UWCA 2JJ2D 1JUDA 1JN0A 1HMPA 2JS7A 3FUWA 2OMEA 5EUMA 1O96A 4X6UA 1R5BA 4F4JA 2HCFA 3U7QB 2XQJA 3TDKA 5HVNA 4H7FA 1G0NA 5LC1A 1RLMA 3QXXA 1KQNA 4D9JA 1LFAA 4G85A 1KY3A 2HJHA 3SZLA 1E9DA 4PC6A 4X92A 3VR5A 3I62A 5HMLA 3CYFA 4C0BA 1Z6GA 1OGIA 3GH1A 4NX2A 1XU9A 2AF4C 3D43A 4IVPA 1P0PA 2QI9C 2GRAA 3IE0A 3LQQA 4KHZA 4XPIA 3H1FA 5EVCA 1N34B 3VU8A 1WNFA 2QPTA 4G1CA 1JEYB 4JI6B 1MO4A 2OR3A 5KUTA 1MZVA 5KTTA 2VDWB 3PKJA 3RIHA 3WIUA 2C1EA 5AVTA 1UJMA 2FE4A 1L5MA 2FI1A 2FLWA 2JVIA 1T1IA 3A25A 3FCSB 1BOOA 1MAVA 2ZGVA 4EF4A 2IS2A 2WKSA 4MYSA 1XDWA 3KB6A 2DUJA 3O9VA 1G8YA 1NU6A 4KSCA 2V9CA 1BQ4A 1Y1KE 1XI2A 1WVMA 5ECYA 2FSHA 5K0GA 4LQDA 1N2JA 4HFNA 1U5AA 1CQZA 2PJZA 2AVDA 4FEAA 4K8RB 4ND2A 4RVNA 3NOXA 4DV0B 1SQ0A 1QIJA 1TKAA 5IMSA 1SCJA 4C2UA 3OY7A 1UJCA 2AN3A 1P61B 2YZ7A 4GE0A 5J4YA 2QG4A 2KW5A 4KPUB 4NHEA 2IS1A 1SXJD 3NASA 4PZAA 3MHPA 2V7VA 1AGPA 3G1UA 2WUEA 5KTNA 4MUEA 2B36A 3X0DA 1NVGA 2JIRA 2J5KA 4NMHA 4NE7A 3IEPA 5FR1A 3EYWA 3KKNA 4JLMA 1A76A 4MA4A 4QWWA 1XDBA 2VDQB 2WHYA 1XZ8A 2PS1A 4ZOBA 1GSOA 4EUEA 4HNGA 2Q7OE 4YCNA 1C29B 1YV9A 3TLYA 2FWIA 3DCIA 1H1TA 4MRVA 3IMGA 5AVJA 1KZ9A 1OFUX 1RKUA 2A84A 4H08A 2PZ8A 4ZOLF 3KB1A 4RM2A 4OHPA 3WLJA 1WTAA 1PJ4A 2V74B 1BFKA 2GXAA 4KH1A 1VCMA 3EC1A 2Q1YA 3TXXA 5A9SB 3LYUA 4YB8A 2A0WA 3OCWA 2XMCA 1IZ7A 3I2GA 1N3YA 1GAEO 4IILA 3NUZA 3ANTA 6ADHA 2WU3A 2BHSA 3RFFA 3NS7A 3FUCA 3COVA 2JL1A 4J0EA 4KBYA 5DTRA 1U63A 2C1ZA 4MAMA 5KWIA 4OHWA 1B7GO 4WRRA 4I55B 4WXHA 3KR1A 1J6UA 1JHXA 1S3GA 2EBFX 2AHOA 2A0YA 2YFQA 1J0CA 2Z08A 3GDHA 3W3AD 2F59A 4CCYA 2L0XA 2H52A 3IP9A 4B83A 2VBCA 2VJBA 1BNCA 2G36A 2ACEA 3BXZA 5I01A 4LKOA 3OPXA 4NCXA 1IXSB 1M0EA 1QHIA 5G53C 2WVAA 3G13A 3SKYA 3DOHA 1QFSA 2G72A 3Q7IA 3LQFA 4MZXA 4LXXA 4P6VF 3SOZA 3M1IA 1R9MA 1ZCBA 4NZYA 4N5LA 4ZC1A 1KMCA 3RC8A 5E7JA 3UTCA 5KBYA 5FEMA 3PR2B 1QWSA 1V1MB 1L4UA 5DM2A 4XLTA 5KNCD 3U80A 1BDBA 1LVGA 2BTQA 3CW9A 1DRUA 3G2JA 3N28A 4B71A 4HNUA 1GPWB 4FEEA 4IHQA 1S3FA 3QLUA 3L0DA 2FSUA 4KLRA 4C1BA 5K0BA 2PEZA 4N0EA 5J23A 4Z4GA 2EHJA 2BDTA 4O3MA 3V48A 1OXSC 4CV2A 3CEJA 3LQYA 2RCNA 4EKYA 4DLYA 2PKQO 1IHXA 4IQ8A 2PSJA 1K7FB 2BUBA 3FSGA 1YJAA 2HMTA 3PCTA 4PHCA 4RSRA 5FOUA 4QBFA 3ST7A 4GBJA 3UN1A 3CNEA 5J2UA 3WGGA 3M6UA 4AN4A 2F1OA 3DF9A 3E61A 3TZCA 3TLZA 1V5WA 1JDTA 1FXWA 4J0DA 1RD4A 3T9AA 4Z4IA 2AOTA 1FLAA 1XNGA 2CUTA 4KG7A 4M6WB 4EKIA 1DO0A 4IPTA 1HDIA 1RM5A 2H5IA 4ETNA 3D6HA 3R5XA 4C0KA 2B9VA 2ERCA 2GFQA 4XVCA 1W0CA 3RANA 1XCBA 2CD7A 4Z3KA 1TEXA 2JGDA 1I2BA 1J8FA 2FK7A 2HPHA 1A82A 1D0VA 3CWZA 4FWIB 4PPYA 4PW0A 4EYGA 2DVMA 5AJHA 2QRVA 4BWGA 2OV8A 2QE7D 3K20A 1JFFA 3MGKA 5EE0A 1RZVA 5I7FA 4NVRA 2BFEB 3JY6A 1U8ZA 2IH5A 4ENRA 2QD3A 3K6KA 5L7YA 1HV8A 4D6XA 4DQKA 1R5OA 4RELA 5DCWA 2FEPA 5G0TA 1CG6A 4BFCA 3ZHBA 4QTYA 2I99A 5EKUA 4H77A 3RSGA 2AIRA 2I2WA 4KQEA 1S01A 2JCBA 4PCLA 4IDOA 4IM7A 3UW3A 3H86A 3COZA 3L8GA 4Y0AA 3OM1A 2WQZA 3BWCA 1XE3A 4WY8A 3HP4A 1R8YA 4XGRA 2HRRA 3NYWA 2HSDA 1GXSA 1XOIA 4X91A 1J56A 3WO0A 1ODJA 1TXGA 4BNVA 3PF8A 3B1FA 1ZM9A 2CVHA 4XEHA 5AHKA 1PCXA 2PH5A 3GPCA 5K6AC 4AX8A 3SJZA 1ORRA 1R64A 1XRMA 1PTJA 1VYVA 2RGGA 3RS7A 3C6QA 3L02A 1RZRA 1SGWA 1JDSA 4JC5A 5LB4A 3VZBA 1E6CA 3K8QA 2QTRA 4KK3A 4L2IB 4MMYB 2VRCA 2MR5A 2NPOA 3ZWOA 3ASZA 2P3SA 1BJRE 2BUCA 2PQ0A 3A3KA 4BL5A 1PBTA 3NTLA 3AFHA 2O54A 5LD2C 4W7HA 1KBZA 3NHYA 3M3HA 5KTOA 3CTMA 1DZ3A 3Q87B 5A6SB 4PNZA 1AV6A 3CLUC 1I7LA 1SKUA 1ENZA 5TC4A 4E5UA 2HMYB 1AQNA 1QYIA 1XZBA 2QW8A 1VP3A 1WXEA 2PKRA 3KUXA 4MRNA 4KK4A 4RULA 3D6JA 3W1EA 3CMCO 2VCHA 2PVSA 3G2LA 1QGED 4YMSA 3VC1A 1REQB 4EGQA 2SBTA 4PQFA 2QUHA 2DPLA 1AUQA 5CVEA 1TZJA 2WC1A 3U3XA 1C7JA 4CM6A 2PUBA 1PS0A 1E1YA 1MOPA 2ZQ5A 3Q7QA 2Z8ZA 4B5KA 4C08A 1RBQA 1KJIA 3RE1A 2FDRA 5B57C 4M9QA 3QBTA 3REGA 4YFVA 4TUYB 1FUYB 1OROA 4TVBA 3TINA 4BZZA 1WG8A 2AI3A 1KEVA 1RADA 2VNKA 5AQEA 4GU5A 4KXNA 2MCFA 2C2ZA 4BO7A 2O7RA 1P2TA 2FUKA 3M2PA 4GXRA 4G23A 4IIYA 1RC1A 4IUYA 2UXCB 3LT2A 4PINA 1IK4A 4OMDA 3RVNA 3KV1A 2ZI6A 1BYIA 1YZUA 4X1KA 4QSHA 4PWZA 1B6SA 3ZLTA 4RW0A 1A4IA 1B6TA 3SC6A 4D0RA 2MHCA 1SA0B 4M1QA 3PL5A 4ER6A 5JRJA 1E9FA 1Q7CA 3AFGA 4JNKA 5I4IA 4P80A 4FZ3A 2ZK7A 4R0VA 1ZQ1A 2QTAA 5ILQA 3ZE9A 1U8YA 3FFTA 4WD3A 3WIVA 2W48A 4HTAA 3RYCA 1GD1O 1Y4ZA 2ON6A 4B2LA 2NPIA 4BNIA 1L7RA 4OFZA 4Y1RA 2GDZA 1G7RA 1KAHA 3GPIA 3TQFA 3WLPA 3E48A 4XE5A 4DDTA 4Z7NB 1PT7A 1RPAA 2VJDA 4C7XA 1JDPA 2NQTA 3CX7A 3R5JA 1MTOA 2P69A 3B1VA 3QPDA 4F5ZA 1W4BA 2PL3A 3LKBA 2Y27A 4RACA 3V4OA 3MIIA 1GRRA 2GPBA 1FDWA 4J9VA 4DLVA 1S1MA 1DKLA 3ZY6A 3ANMA 4JL5A 5KHOC 2DG2A 3C48A 1H3EA 1DCFA 1L7NA 3U39A 2FZVA 1PSZA 3CNHA 4GC5A 2VXBA 2C31A 2P6MA 4J2OA 4QQ8A 5FAKA 1NDHA 3IMFA 3TPCA 1OBFO 1A2BA 2HMWA 2JLXA 1OLOA 1V95A 1U9CA 1NSFA 3HDTA 3QBDA 1IN6A 2A30A 5IBCA 2O8EA 3CVXA 3EEYA 4Z9BA 2OECA 5BSKA 1XQ9A 3K9FC 1SXJE 3O7WA 4Q15A 5ITWA 2FG6C 3AYXB 3HGMA 3AF6A 3DUFA 1R00A 4MQUA 5JEDA 1EP2B 3AEQB 3SKXA 4RV5A 1L3CA 4KUHA 4PZ9A 1DMRA 1LPPA 3UMCA 5E9QA 4ZU3A 4EKGA 5JFOA 1IQPA 1EQ2A 5JCOC 5LP6B 3H1PA 6ABPA 2ZBDA 1AKEA 1B0PA 4YQYA 3D2AA 4DCVA 1QIMA 4YHHB 2G09A 4NBRA 3T9FA 4JLPA 1P7PA 1Q0UA 1W75A 3GOQA 3HB9A 3GCXA 3OMLA 4P0TA 5DHRA 4PBTA 1CKEA 2XMPA 1QFJA 4X3CA 3MT7A 4WFQA 2VQFB 4Q3EA 3ZZTA 2QY6A 1Q0TA 2I2CA 1UZAA 3W8RA 4EW6A 5IKEA 2C88A 2FQYA 1LLUA 1P74A 3U4GA 2OZLA 1QF9A 2RARA 4KC0A 2YJ5A 2ZYIA 5I5GA 3WGZA 4IH4A 1L5QA 2GZHA 4RGYA 1D8AA 2R84A 5CFQA 5TGZA 2O6LA 2VJNA 3U0BA 1CC1S 2N1BA 1QH1A 4A82A 1KL7A 1GSHA 1CS0B 2GBGA 2JJMA 4OOEA 1VE7A 2P4QA 3MBOA 3RUCA 2ZKIA 4LI3X 2BR4A 4BKOA 2JLSA 1DELA 1NVFA 3N6RA 3GF4A 4O4IB 1PZXA 1Q15A 5FB3A 1L7DA 4TS1A 1O97D 2GK3A 2XA9A 3LFUA 3N0XA 4FOOA 4HUQB 3FZYA 5DNAA 2X23A 3SF8B 5H8WA 3FFWA 3N8GA 4C21A 4NV3A 5AESA 3CX8A 1RQLA 3IPRA 2AF3C 1V1RA 3DB1A 5CB4A 3WK5A 4F1WA 4YMHA 1NI3A 4K03A 5COAA 3V4FA 3H5WA 2XBUA 1KQPA 2JEZA 2WSIA 2Z8XA 2FUEA 2Q7XA 3L40A 4GSLA 1A4XA 4JYMA 4WVLA 3QHAA 4FX5A 3SDBA 4E31A 5L53A 1X92A 3BDVA 1GU7A 2C3MA 3M6LA 1A50B 2IPLA 4U7PB 2Q49A 4KQKA 3ZWXA 4D4IA 4GI1A 3F5SA 3QX7A 4UDNA 3UQYS 1VLHA 1JQ5A 1NUSA 2GZAA 2Y66A 4G6ZA 4HX5A 4C87A 1W73A 2Y71A 3H2ZA 5FEUA 4PFQA 1AMUA 3VSDA 3KYCA 1TVKA 3AESA 4OH7A 4BIIA 1WM1A 1E60A 3CKLA 1M73E 4QELA 1DBWA 1PO7A 1PI3A 1P1RA 4HGQA 4M7RA 5EYPA 4HXYA 4JT2A 4D9CA 4KCGA 2DJIA 1TCUA 4K6HA 2BSQA 5E2AA 3GARA 1CEEA 1QIIA 1GCGA 4AECA 4DB2A 3AU9A 4TV9B 3UK0A 4XB1A 1N2BA 1WE2A 3WQBA 1JEYA 2GF2A 3R7FA 2FR8A 4HHEA 4WFKA 4DG5A 1KI3A 4B5LA 1MBZA 4A92A 2R2AA 2R7NA 4MS3A 5KCMA 4HV4A 1UC5B 1CY2A 1NDUA 3AUJB 3BFVA 4QTZA 1OTHA 4B48A 3W04A 2J07A 2Q8QA 3ZYZA 1UFOA 4RZQA 5GJCA 2YASA 1ENPA 2IRWA 3EMBA 3BXXA 2W22A 2R7AA 1NC1A 3CM0A 4L5IA 4TL6A 3PEWA 2WVGA 3N39C 5H9WA 2CYBA 5BSTA 2VSFA 4B73A 3I58A 4HDCA 3SR0A 2NV0A 3D6VA 4OJTA 2FWPA 2DQYA 2X2EA 3PQCA 5EEGA 2GSWA 2H92A 4YIHA 1QDEA 3OLWA 4KTVE 4FEGA 3KSBC 1XEFA 5DM70 3AQ4A 2ID8A 3PLAE 3VO8A 2HKIA 5C8YA 3BE6A 3I2JA 2QBYA 2C5EA 2GVNA 2C00A 4Y67A 1DRJA 3OJLA 2OHIA 2WWHA 3QXJA 1EFLA 4PZYA 1P29A 2ONYA 4HI0E 5LYJF 2M6SA 3DOJA 1AN9A 2Y1KA 5J59A 4J0IA 3TZLA 1VG0B 3GUZA 4PYJA 5JZBA 1RLJA 3IAS6 2HQRA 4MGEA 2ZIWB 1N3IA 4GKAA 3SBOA 1NJSA 5HS4A 4L72A 4XSGA 5GJBA 1K89A 2GVZC 3KR0A 4I55F 2X15A 3S2EA 4LWPA 1MX5A 1H22A 4WCFB 1JR2A 1M1NA 1YUMA 3QOXA 4ZDIA 3H4VA 3E9YA 2XW6A 2Q4TA 3JVDA 1L4BA 1P4JA 1WOMA 3EXEA 1B0ZA 2EKPA 5FX2A 4H35A 5F4BA 3OQIB 1KMHA 2XTNA 1C4KA 3CPEA 4WLEA 1IZ9A 1SRRA 1VLJA 2WIKA 3IEIA 4WT7A 5P8WA 4ENWA 5G1OA 1N5MA 3PGJA 1UP4A 5AKYA 4AULA 5EKTA 1VBMA 2JGNA 4HTFA 2GBLC 4XVUA 1TIKA 4RAQA 2BGKA 4YRJA 1EP1B 1F2UA 1GQOA 4Q4JB 3PFGA 2EW1A 2RG7A 2Y1FA 1HDXA 2IXGA 2INGX 1PR9A 2IZ6A 1E0SA 2GK7A 1HDEA 4O6VA 1FSSA 1W581 3OFVA 3NR2A 1GV1A 3VZCA 1OI2A 2VP0A 2NO1A 4N54A 4U3JA 3SQNA 5B2ZA 4EG8A 3U9SA 4ESOA 1PV4A 5AI9A 1KGDA 3WLNA 1RRKA 5ALNA 3OC6A 5ENVA 4GMGA 3UAYA 1JNYA 1H9AA 1K9SA 1T2UA 3GAMA 1P1KA 1PNVA 3G0IA 2DKOA 1BKYA 2P1ZA 4IZOA 5B1DA 3TD6A 5EJ6A 2J0VA 1J9EA 4F9GA 3A2MA 3OE1A 4OIFA 2GTIA 3IBGA 4ECAA 4KDCA 2FW0A 3FOEC 2ECKA 1UH5A 3P2EA 2X13A 2R4TA 5KOJA 3QBJA 2HK7A 4EB6B 2EFCB 3ZDEA 1E20A 5MGBA 1A7UA 3P5SA 1CB0A 5G2OA 3WLIA 5HZKA 3EGWA 4HMQA 2QTCA 1VKOA 1AJEA 2ODQA 4B6SA 3WYAA 2J09A 3ZJYA 5IF3A 2LUOA 1I9CA 1TRKA 3GNQA 1PR5A 4ZRDA 3V2HA 1MB3A 3O84A 5C2JB 1G41A 2BOVA 2ORIA 2QMQA 2GM5A 1CQJB 1T25A 1M6VB 2BKAA 1WPGA 2EFHB 2JAOA 1UANA 1MC5A 4NG5A 4CMJA 2Z3WA 1SVWA 2JGDB 4PQGA 3TGLA 1OE0A 3SYLA 2HXYA 3CLRD 3KTAB 3DDZX 3DMYA 1H0HA 3EOAI 5EIXA 2POQX 5H59A 4BFSA 3AC0A 2DSTA 3HQ4O 1QNLA 3DHNA 1ZNXA 3ME5A 3MWFA 4XFDA 1ZH6A 3H2SA 1DXHA 4IGAA 5EN4A 2ORYA 5ILGA 2WA2A 2JG3A 5AVOA 1EH5A 3BBPA 4ER7A 4V1CB 1TUBA 4PBSA 4MKFA 4O5OA 4PLFA 2EG9A 3U16A 1MRSA 1VA4A 4YJ2A 4DA7A 1JHDA 3DEYX 2GJ4A 4BBAA 2AZXA 4A8JA 2P4EA 1PQ4A 4TYWA 3PGA1 3DH0A 3CZAA 2AL7A 4JWTA 2XE8A 1E9EA 5IBPA 1C7EA 1OWNA 2V4MA 3EUWA 3ZKWA 2C4HA 2DB3A 1GO2A 2YIVX 2KBFA 1BSVA 4NMMA 2FN3A 3WMRA 3BF7A 4D9MA 4JC0A 1FLDA 2B6HA 1FNDA 4CQMA 1XX6A 1MH1A 5BSGA 5K8UA 3C1TA 2FWAA 4MR7B 3FHTA 1QF6A 1XCOA 3ILXA 4YAKA 4E7OA 2H7CA 2LCFA 3A6EA 1CUYA 1ZMTA 1KAOA 4TX1A 2R79A 2JBWA 2NTYC 4IRUB 4JFAA 4WK6A 4BKUA 4BLSA 1J21A 2H7VA 2WV7A 5AI6A 4DHEA 5BQ5A 5KYKA 2A9OA 2J3HA 4GEKA 3KVYA 4RIGA 1JDNA 2RJOA 4B3DA 4NKRA 1M67A 1MQAA 1TCAA 2V0CA 4EENA 3KXIA 5JMTA 4CEJB 1JKFA 1LC0A 1R9JA 3C6MA 5IEBA 3PD1A 4B34A 3SZUA 4P54A 5KNDH 1QGUB 2I1WA 1JG4A 4FYKA 5JAHA 4ZOAA 4Y9SA 2VQEB 5CTJA 1ZVKA 1ADJA 4V0KA 2WJ3A 1Q21A 3SZ3A 1FMTA 4GGMX 2LD4A 5ALIA 5BT9A 2EKBA 1XD9A 2IPAB 3I6MA 5CHEA 4BQNA 5HGXA 4IZ6A 5GM2A 3WSWA 3N7AA 3R1IA 3TOVA 1BHO1 3ELBA 5JCPA 2ZCVA 1NMEA 1REQA 1DOAA 4U7GA 1Z4OA 5I9BA 4N47A 4D3ZA 2F3QA 3SEFA 2W98A 3EVTA 2RGWA 1NYLA 3D3JA 1GA1A 1TF5A 2OVFA 1P91A 2GPJA 4ZHSA 1JR6A 2F1HA 3MGGA 1KAMA 4TUYA 5INTA 4ILKA 4KX3A 2DHDA 4Y2XA 2NP7A 1ZCZA 4NMWA 5F33A 2VQDA 2HGSA 2ATIA 4ZJUA 1ANKA 1R1DA 3E82A 1TDJA 3GEMA 5FI1B 4TTTS 3DL0A 1W5SA 3X1ZA 4AG3A 1B93A 2F62A 4KZPA 1KS9A 4R7ZA 4CMBA 3NGLA 1TVMA 1K5HA 4GM1A 1JTVA 2GEFA 4EOGA 4FQ7A 2XYGA 2Z0MA 3L8MA 3QLUC 1KOFA 2B1IA 1AGXA 4TS4A 2XKKA 4G5FA 4UBLA 1SA0A 3FUVA 1BW9B 4DBLC 3L7DA 3L43A 4JN6B 2PWYA 5E0KB 1O0CA 3HJHA 4MYRA 3E9MA 4HYQA 3DOFA 4MLCA 3L4BC 3NHWA 2WM8A 1DG9A 5CLIA 3SFTA 4K6GA 5FWXA 3LL7A 3UMMA 4FCWA 4NULA 2GPSA 3P9KA 2I1QA 3HXQA 3F2IA 3T5GA 1ZAKA 2IUYA 1II8A 5C52B 1FYEA 3FVWA 1VYTA 5JMPA 5BO5A 2CY0A 4F21A 5C1OA 5JALA 4IYRA 4FWBA 2WUDA 3KXKA 4DRYA 2ECPA 4WQMA 2IYZA 3T7CA 3W6NA 5A4IS 1SBQA 3ZH2A 1UP6A 2HZ7A 3UWPA 4E12A 2YS7A 3EUEA 4CKCB 1AC5A 1GA6A 3H1GA 4FFPA 4PO9A 4F92B 4NY1A 4C5BA 3VV2A 2IYOA 5CVJA 3WC4A 1QFMA 4WBSA 5CA0A 5B37A 1WZ2A 1UPBA 2VZEA 4RY0A 1NVVQ 3TQRA 1VJ1A 4YK7A 3JWEA 2QD2A 3EXIA 2GHRA 4K9PA 1L1FA 1CFJA 1EP3B 4NABA 4XYGA 2FYTA 1V11B 3U5TA 2PWZA 1AY0A 2R3SA 2AEMA 1SKBA 2IK8A 1MC4A 3DULA 1YQQA 4HGRA 1HYHA 4JMPA 1W1IA 3I9FA 3RRFA 1DPFA 5BV0A 1YIDA 1S8AA 4RANA 4D8YA 4PONA 3KUUA 4F46A 2CFOA 5HIMA 4Q24A 4CJXA 1PWZA 1U7OA 3UCFA 2X5OA 3KU1A 3PRJA 4GOND 1JT9A 3CR8A 3PNYA 3B3AA 1VPWA 1YB4A 2PT7A 2X9LA 3RU9A 1PK8A 3JQBC 1Z37A 3SSMA 1QAOA 3PA6A 4OJMX 3SVZA 3JD4A 1QGZA 1THMA 4MIKA 5F9FA 4A36A 4BLUA 4GGOA 3CH7A 4DUYB 1MNQA 3QLJA 4CQLB 1QLWA 1BCRB 4QJ5A 5JAOA 1I7SB 5TARA 4Y1EA 3V32A 4L5BA 1KR2A 1SCDA 4E7PA 3N2KA 1AUXA 1CHNA 4DLRA 4ZREA 1SKQA 3H1EA 4QXAA 2FUG6 3F0TA 1LRKA 2BBTA 1PEAA 4EK9A 4R8VA 1V48A 4LOLA 3BK1A 3Q3CA 4CLRB 3I09A 4PQEA 3KYJB 5JXWA 5L3SA 1XP8A 2EBUA 1Y8RA 4BO4A 1G6KA 1TI7A 4YA6A 3CH4B 3TGWA 3ELUA 4G63A 4RZIA 1F7UA 4RMNA 1BX1A 2RHWA 3K1AB 3U3RA 4BRZA 5DK6A 1OXUA 1WLSA 4M83A 1XNJA 3DWGA 3IUBA 2NYAA 4DIEA 2LIVA 3L79A 1SXJC 1V1RB 1G5TA 1Y5RA 2ZIGA 4XLLA 4WKOA 2EFGA 1VHTA 1YDGA 1R0BA 4UD6A 2CXRA 3W5AA 1Z7GA 1NMZA 1ZJ5A 3DSRA 3P0HA 4K9OA 4L51A 4MKRA 4M0MA 4XDYA 5LJLA 1HDYA 4R51A 1E5XA 4JB0A 3CN9A 1QVVA 3PFWO 4EPYA 5KVSA 4UTRA 5K0TA 4NL4H 2PMBA 1U9YA 2YJZA 4JB8A 4QGGA 1N5DA 2IOFK 1S02A 4C14A 4LWZA 1MEEA 2C58A 2E1RA 4BVEA 1J97A 3DL7A 3GVXA 3O8DA 4CG1A 4JXXA 2J1LA 5EJ4A 3BD6A 3UB2A 1XDGA 3ET5A 1LQ2A 5ALHA 4G0YA 4LYAA 3K09A 4H4CA 2YIMA 3JSXA 1KAEA 3N8IA 1LSJA 3EFEA 1NVMB 2LE0A 1X38A 5EGNA 2IY7A 1C8BA 2QUKA 2VK4A 2Y67A 4N12A 3WBBA 1X0VA 4A9AA 3EVCA 4U0KA 5JARA 5JAPA 1Q3TA 5DO9A 2EHDA 2DPHA 5HCIA 2EKDA 4LRYA 3TF5A 2GK4A 2C3OA 5JD4A 2O8BB 1VIMA 2PBZA 3FUXA 2ZYVX 3OHMA 4FFWA 4TV9A 4RF2A 4WJKB 4XUCA 3W2GA 4V0OA 1YZTA 3ZWKA 5F2NA 2EC5A 5JNSA 2E5LB 1CVIA 1ZGCA 1WMEA 2NUPA 2GHIA 3VDNB 3R7AA 1LJUA 3ANLA 1KY4A 3GCDA 1IBSA 3IODA 3VUEA 5EHZA 3RFVA 2BE9A 2NYUA 4JUIA 5COBA 1MIHA 1N0UA 3I0ZA 4GVXA 2C1XA 1T5DX 2P35A 3TEMA 5ADWA 1HF3A 3SFVA 3JVIA 4YP9A 2C7PA 1UDAA 1PP4A 2AFVA 3Q7PA 4PICA 2QAGC 3QITA 4GBGA 5CX1B 1RVV1 4FXPA 4JVOA 1RQXA 4GOKA 3ADPA 3F97A 4IV0A 2ODWA 1JHPA 2AGVA 3O03A 2QX4A 4WDQA 4E6PA 1UBEA 2C96A 3SM9A 1X80A 1A9ZA 1I3OA 5FWYA 3F46A 2JA1A 4WK4B 5JHGB 2GN2A 2ZSBA 4C30A 4UU7A 2A1UB 1I1QB 2WJGA 1KDRA 1AVTA 1QR2A 4DSZA 1Y6RA 1EGMB 2MWMA 4XH9B 2VPXA 4LHEA 3UWMA 2VSOA 1CJMA 4IRXA 5JJ5A 3IIEA 1NRXA 1FJGB 3MBKA 1MPTA 1U9JA 2XDQA 1TF7A 3M6IA 2YZMA 5IT9A 3UJNA 2G83A 3O93A 1PJ8A 1SVOA 3LUKA 4Y6SA 4FMCF 4OSEA 4D9IA 3ONDA 2YX1A 1MX3A 1ZGHA 3VR6H 1LBQA 4URWR 4UMVA 3KEFA 4Q7MB 5T4BA 1H8EA 1IFXA 1O9BA 2PZLA 2C57A 4BMNA 5LOVA 4UULA 2ZYSA 2OD2A 3M6VA 3ZVNA 4R84A 5FR2A 1GN9A 1SQGA 1R3DA 3OIGA 2A92A 1QK3A 3LCCA 3O2QB 4BNGA 3EVGA 5KINB 1QDUA 3PIDA 2DFPA 4HDMB 4XTCS 5AXBA 4F85A 5C8VA 4TT3A 5LWHA 3GUUA 3OQIA 1KMHB 4ZVOA 3H97A 3GUCA 1S4QA 1BGXT 1R37A 3WFZA 5B58C 2BWJA 4GAEA 2TYSB 1N6IA 4HEA1 2RG1A 3H7IA 1TA0A 2I8LA 4WL0A 4ZO9A 4K9KA 5K2OA 1HSOA 3HR7A 4KWIA 3V1YA 4Q01A 2UVDA 3DEZA 4LX0A 4FGWA 4PZZA 4C22A 3GLGA 1G20A 3KKQA 3MWDA 4NDAA 5JSZA 3D8RA 5DX1A 5B6JA 5ALSA 2GQ0A 1XAJA 4RTNA 1D2NA 3AVYA 1P7YA 4NONA 3FPCA 2P0EA 2YZNA 3IUQA 4FDAA 1K4MA 4YCJA 1M54A 5ELLA 1X8XA 5GINE 1KSJA 4OHZA 1F17A 1C0EA 1UKZA 2BDEA 1TC1A 2OT3B 5EXDA 5CVDA 3HJFA 1U4SA 3KJQA 2QTGA 3LF2A 3T54A 4LY9A 3ZHCA 4EA6A 2QDKA 1KDVA 2PRZA 3CC8A 4QREA 2FJUA 4B17A 4KFTA 2ROQA 2ZROA 5T8KA 2BEKA 1FFGA 2P4SA 3KDAA 4Y2UA 2ZS9A 4QRIA 7ABPA 2XA2A 4DR7B 2Q1XA 4J3JA 1SIOA 2H8KA 3LY8A 4P7GA 3UENA 2Q4BA 4M0LA 3NOOA 1X7ZA 1M8FA 1CY1A 1WZCA 3JQ8A 1P5JA 2XE6A 1EEHA 1IVYA 1FE8A 1IAQA 1V8DA 2VRBA 4O1HA 2DUUA 4W7IA 3VV3A 4OHFA 2ZETA 3VDQA 4J1SA 1NBEA 1E79A 2FWNA 1MQ8B 2XV1A 2ZYWX 5AVUA 1V71A 5JIBA 2Z2YA 5MN6A 2SKCA 3AV0B 4B9AA 2VHUA 3L46A 4D79A 2PGOA 3IAFA 1BH6A 1DBIA 1QRUA 1NNLA 1CW2B 1VRCA 5JMWA 1G8JA 3T5AA 1MEJA 4I1SA 4LE2A 2QY9A 1I8TA 4LZPA 4MUBA 1I0ZA 4KE7A 13PKA 4W8GA 4S1WA 3L0BA 1IY8A 2QU8A 4G1MB 2FV8A 4BN5A 1QLHA 3OQOA 1MTZA 1PV2A 1DBRA 1NBMA 1QMGA 3F3YA 4RF3A 7YASA 2IYPA 3IMKA 4YH1A 3AVPA 1Y1RA 5F1KA 1G7SA 1I2CA 1L9XA 2R6CA 1OAOA 2XMDA 1KZGB 421PA 2O1XA 1TUBB 2I4OA 1VP9A 3JPWA 2IT1A 1GT91 3LE8A 4FHFA 5B36A 3I61A 2R6R1 2WWIA 3PXCX 3OE5A 1H8ED 3PDJA 1PQUA 4JJKA 1LV8A 1DPGA 1O6CA 1KDPA 2RKBA 5CRIA 5DE3A 5FLKA 2PGXA 1LB1B 1ESCA 4F2HA 3FNFA 4G8BA 2YRWA 2OYRA 1QIEA 1G18A 4UPDA 1SUSA 4TV8B 4YCDA 2ZYAA 2CYAA 3T7DA 1X15A 4DTIA 2VH1A 10MHA 3OLVA 2PMEA 5JD6A 2KLHA 2FZ5A 2J33A 1PR4A 2MSCB 2VN8A 3AM3A 3O83A 2XYQA 3OP1A 2Q45A 4M1OA 4R8KA 4AG6A 3VH4A 3EUFA 3FDZA 4FINA 4GX5A 4JI4B 5ESWA 2XZLA 1OREA 3X43A 1U1GA 4HEHA 3WYCA 3HYTA 3UHOA 4BMZA 1KZHA 1MC8A 4QFBA 2IF0A 2EYQA 3L04A 3V8BA 1C8LA 1I2DA 1YONA 1Z75A 2JATA 1J33A 2CJXA 3BDIA 4RGBA 2PTHA 3AR2A 3NEPX 2ONJA 1ZSYA 2EBWA 1Y81A 3C8UA 4RZ3A 5E6RA 4Z7JA 1DBSA 1NR7A 3BFXA 3DMPA 3IA7A 1SC4A 2X4IA 1MHPA 1N2ZA 3VXKA 3BORA 4DARA 3CUWA 4KLZA 4XVRA 1CQIB 1AM4D 3PTZA 4RJTA 4OQEA 4IOKA 2MYPA 5J5CA 1EX7A 3L3BA 3C5EA 2NT4A 2RAPA 4MARA 3NH9A 3N2YA 4D9NA 4IIBA 9ABPA 4MUKA 2ZI4A 4Q82A 3B1XA 1KNQA 3RT9A 4L78A 2VAVA 3QEAZ 2NAPA 1K7SN 3W5HA 2DBZA 4AIIA 2J41A 5K99A 4DR4B 1WDTA 3EBLA 2QMEA 2RGNA 3I73A 3LC2O 1UMCA 1R4AA 2AMLA 5AM4A 3K4QA 1JQLB 3W8FA 4F9EA 2FZKA 3C97A 1S9DA 2O2YA 1QYXA 2V6FA 3LSTA 2PMKA 2QORA 2QU7A 1K3FA 2BF7A 3SBDA 3N07A 1JDUA 3OT5A 2P5UA 4ZXPA 4Q05A 4ABYA 1U6IA 2JCVA 2AD1A 16PKA 3TOZA 5EP3A 2HNAA 3P97A 1W6RA 3BGWA 5CDTA 5CK5A 2DF8A 2IOHA 3LWZA 2HLHA 3NGMA 1UK9A 2A5YB 4AJKA 1PNOA 3WA7A 1NY6A 1U6JA 1UBOS 3SWWA 1SXHA 4UAUA 1W96A 3UGJA 1UMDB 1YRLA 1DEXA 2QRPA 3FBWA 1OKKA 1ZS9A 2J9XB 1GTMA 3CWCA 1YOVB 4TRRA 1BW9A 1V7CA 4WNCA 3OQNA 2BHLA 4OHXA 2VG8A 1XK6A 4E46A 4ZOEA 2QJFA 2E4WA 2XI4A 5HUJA 3DLPX 2FU5C 3E9DA 1H0SA 3U7JA 1SU4A 3I04M 1URPA 2WTXA 3PVSA 2F3RA 4C04A 1EA5A 3L1KA 3AYZB 4UM5A 3ZHXA 3COJA 2Q46A 1RQNA 1U28C 1II8B 1OD6A 3SHFA 1KVTA 2C2BA 5IHXA 1ZR4A 4EUKA 1T4DA 4GRDA 4H1VA 4D92A 1F8GA 3D4NA 1ZM2A 3V80A 1U0OC 3ZHQA 3C2QA 2JJ1D 2RSLA 2QGZA 1CJSA 4Y6RA 3WJAA 4B31A 4EHBA 4MDFA 2VJCA 2O0KA 1C3JA 1W7AA 1A9TA 4UFOA 3I6ZA 1FS5A 4MWCA 5YASA 3E1KA 4QYWA 5LBUA 2I62A 1GILA 3EEIA 2B2NA 2Q6KA 1J4AA 1EIZA 3CJTA 3COSA 3HU2A 4MW1A 2ZVPX 3AR6A 3TNJA 3EXIB 4C3ZA 5J4KA 1W36D 2YN4A 1KSHA 3NUQA 1WCIA 2XHEA 1QG6A 4GIBA 2J4CA 5AO9A 5IW8A 4DCUA 1XPJA 4IIHA 3ZCRA 3DXFA 3LO5A 3M1AA 3NUGA 4AJOA 5JO0A 1P7VA 5I4BA 1WEHA 2OM2A 3I1JA 5JS2A 4C6RA 1VHJA 1U0GA 2JJ2A 1R10A 1JJBA 2L69A 2O19A 1RXIA 4K9SA 3WKDA 2G5TA 1CFZA 2QRNA 4Y2TA 1SUFA 3NWPA 4DQDA 2PYIA 1A9PA 4OQPA 5E0OA 4MS1B 4KQFA 4AMBA 4ZC8A 1E0JA 2G8LA 3N86A 5L6MB 1M2VB 2G17A 2P41A 3CEHA 3GNTA 4JFRA 4JK3A 5DU2A 4DJDC 4DZRA 5CXQA 2WPNA 1D4OA 3NVKI 4EBBA 3HNRA 3CS3A 4FHZA 1UJBA 4MNTA 5DGIA 1XL0A 4D3XA 1SXPA 3QVGA 4C1NA 4D6YA 1NV8A 3VOBA 4FFBA 4UUOA 4JOCA 2QDXA 1Z9BA 2CDRA 1Q19A 3G17A 1Y8ZA 1GAXA 4GR4A 2Y6VA 4TWJA 2QZPA 9ATCA 5E7MA 3SSAA 3CF6R 4OX9Y 3ROPA 4DA8A 5ERYA 3WL3A 3TM4A 3VR6A 3JX9A 2JRCA 2J3KA 1ZH0A 3K96A 5AI0A 2FETA 1PVVA 4RGVA 1RM4A 5EUQB 5JS6A 3CXRA 2CVZA 4LF4B 1ODLA 2E2WA 2I3AA 2R47A 1IWBB 3MAAC 1HGXA 1JXMA 4G5YA 4G4GA 3EOZA 3GJTA 3G1WA 4EHFA 3K1AA 4RZ2A 4HWGA 4QVKA 5MGNA 3J81A 1GPDG 1ADYA 4M37A 4AO6A 4D44A 1A98A 5C1DA 3O8BA 2UXBB 5EWMA 3RUHA 1G59A 3OCJA 2XYPA 1H66A 4WLOA 5CJ2A 4JI7B 3C39A 3QRWA 3EMKA 3NHUA 4LSGA 3UUGA 4M36A 2Q9AA 1JE0A 2PZGA 4QULA 3CGGA 4MK4A 4TVOA 3C3BA 1RJGA 4L8LA 821PA 2QAJA 4JJ4A 3BKWA 2HA2A 4OHYA 2CVPA 2GN9A 2MIIA 3U7GA 3IMCA 3HBNA 1NR5A 2C3YA 3KJFA 3UATA 3UWSA 3F6YA 1NFRA 4BTLA 2UAGA 1D9XA 1OUMA 2HXSA 3B1JA 1XRQA 4II7A 1YC2A 1JHOA 4PQYA 4BX8A 1V7QA 5LM3A 5KYYA 1NGSA 3PHIA 1PZGA 4OM8A 3SS9X 1YMQA 1YL5A 2HQ1A 1T2NA 5ECWA 1DFIA 4YMUA 1PJSA 5K8JB 1NLYA 2JRLA 3FTFA 2QOEA 3OUUA 4NE9A 2BH9A 5LP6C 3WISA 1YR7A 4DRXA 1E62A 1H2ZA 4YRMA 2NTNA 3BMXA 1TA4A 3WA6A 5MDHA 5F1YA 1H2FA 3LBAA 3QX9A 1XHLA 2M6RA 1TAUA 2R86A 1BEZA 3T9BA 4LRWA 2X7JA 2ES4A 4D56A 5JS1A 1ZJ4A 3GJSA 3D8BA 3KJEA 3KL2A 5BRAA 4KYVA 2I78A 3ROXA 5JI3E 2C7OA 3VNVA 3UJ3X 1D4FA 1NQOA 4NC9A 2FMFA 3B52X 5JEEA 4QECA 2XJ4A 4JITA 4OU5A 5GY7A 1LWNA 5ADHA 5ALDA 2W6OA 3KTOA 1I6LA 4M0UA 4EFLA 5F4ZA 1H42A 2D3WA 1R0WA 3CVWA 4NNPA 4ICIA 2E89A 5IC5A 1AU9A 1J0BA 2Q0XA 1IJFA 3C85A 3FPSA 4NAUA 4TTPA 2XDAA 1N6PA 1YA8A 1EDZA 1M2OB 4V0RA 2ECFA 3LC7O 4YJGA 3W05A 5HXAA 5EIFA 4EELA 1M2WA 4MJXA 3HBLA 3R3XA 4Y2SA 5EQFA 1L5VA 4MRRA 4KRGA 1CRLA 1SXJA 1SQSA 2FOLA 2JFBA 3IRUA 4ZVMA 4KQIA 1UAAA 1E4OA 1NW3A 1ODCA 2EZUA 2AX3A 1O7JA 1Y5LA 3R9XB 1P0IA 2D4AA 4A7PA 1X80B 5F23A 5ICFA 4LW8A 3UMBA 1ATZA 3BUSA 2J3JA 1Q0PA 1L3BA 4RMJA 4IFEA 4PZEA 1ES9A 4WSOA 4TOIA 3K9BA 1WO8A 3DG9A 5B12A 2JFYA 3OM8A 4IS3A 3RYFA 1GITA 4S1OA 5B2EA 4IY1A 4RIHA 2UUBB 3R0XA 1E6UA 3C3CA 3CKMA 2BEVA 3GCZA 5C8XA 4GMFA 4NOLA 4FU0A 2FKNA 3UK7A 3EDOA 1M0WA 1NJ1A 4I4CA 2VCEA 3RTDA 1W93A 5DHPA 1W49A 2FWRA 2V7XA 1XPRA 1HE4A 3RSCA 4GXNA 5HM8A 1PVOA 3T1QA 2XKBA 4PXSA 1JXAA 3VX3A 3HLYA 5AVZA 1Y9DA 4MSUA 3C7KA 4WESB 1SPXA 2BN4A 2Q5JA 5AP9A 5JQGB 5JS8A 4BZXA 5DGHA 5JYCA 4YNBA 1PG5A 1NWCA 4G5QA 4R2HA 3FHJA 3B9PA 1WUJS 2EXXA 1LK5A 4FD2A 3VU3A 4HDMA 2WYWA 3LX8A 2RGDA 5TF0A 4ZMSA 2B5VA 2UYYA 4JLNA 2WM9B 4GQAA 1VZ3A 1KP9A 1P8AA 1UBRS 2ATVA 1A9SA 1CIJA 1X9GA 2M98A 3EIXA 4I19A 2FP3A 1H2AS 4PC1A 4UQOA 1JXQA 1QO0A 2WINI 4XWAA 3DPIA 1TCVA 5AW8A 2ISSD 2IEAA 3K30A 1SK9A 4N5IX 4RSMA 2IUUA 3JYNA 3KQTA 4M9UA 3EPRA 2VHCA 3PNKA 2NU9B 3R5TA 4BB9A 1ZCAA 5EJ8A 1BQ3A 2HF7A 2Q2WA 4HS4A 3KT3A 4BQQA 5B30A 3AV3A 5JXHA 2YOFA 1MQSA 1JXOA 5KDLA 5BYBA 1VMIA 3LS2A 4KE9A 4KSBA 2L82A 1A8QA 4XOIA 4BZPA 5HQTA 5K8TA 3K7EA 2JKZA 2V7PA 4RZUA 3QIVA 1H6AA 3Q72A 2WI8A 2FK8A 3WMEA 3TIXB 5LQAA 5AW1A 3ZDBA 2BFWA 2OP1A 2VKQA 1KYZA 4NAHA 4P4UA 2OHFA 2XIQA 3R7DA 3DPSA 3ZTWA 1O89A 1GTVA 4ZZ2A 1U8FO 4TL9A 1JMKC 1E1RA 3TH5A 1Z08A 1NOJA 5D1HA 2W8BB 1WBJB 5CFMA 3ZLJA 3KPYA 1IRXA 1E3QA 2YCBA 4UW9A 3RCBA 2O0JA 5D51S 5KNBH 2WWXA 5F12A 4ISCA 1RLUA 2ZTUA 4FCVA 3B38A 4KOAA 2VOJA 4TMZA 4MGHA 5HPYB 3N58A 3EFHA 2N47A 1E64A 4FGZA 4HYEA 2NU8B 2A9RA 2DFDA 5TS3A 2XITA 4QEKA 2GI4A 5ITVA 3HWX1 1PQYA 2ZW9A 4FLEA 3BA1A 3K5WA 2B1JA 5BN1A 1QR6A 4IW3B 4Y9DA 2WWTA 4K81B 1PWXA 5EJMA 4RZXA 1V96A 2EJUA 4P4NA 1NX9A 3IBFA 5BVHB 5KOHB 3JD2A 1CR4A 4NK5A 3K53A 1FB5A 3PE4A 3GRRA 4RY2A 2QVBA 3SHTA 3C8ZA 2J4FA 4YJFB 1GAJA 1W85A 4OYHA 2O20A 5TGTA 5AVSA 2O2EA 3RC3A 4CQJA 4MV8A 3OZGA 4KSYA 3TIGA 3D8TA 4Z9YA 3IP5A 2JCXA 3TKLA 1BHQ1 1ZFNA 3MSXA 1SR8A 3PYMA 4XUEA 1D2RA 4CKWB 5FTLA 3UGTA 2YDXA 2OFXA 3JQ7B 3TSOA 5JNWA 3B12A 5B64A 4H7IA 4EKEA 1UKCA 1TUIA 2GJ8A 4ITVA 1H23A 3MQ2A 3QWFA 1NTRA 4ZO4A 3KPJA 4HNHA 5LBTA 4YAUA 1F0YA 1WHSB 2ZUSA 3TTSA 1EFHA 4M0EA 4RPGA 1IY1A 2DH6A 4L9SA 4CCSA 2FPLA 1K86A 3A9TA 4JGGA 2R4UA 1I80A 1Q0LA 3WVNA 3E7DA 3QENA 4LRQA 1NMYA 5ECGC 1M6WA 1JECA 3C74A 3V4ZA 2IU0A 2UUAB 4JZYA 1VMKA 1WXDA 1F8UA 3RSLA 1AUOA 3ZGNA 2XUIA 2Q0HA 3MZ0A 3MVEA 2OL4A 1CJVC 3QFTA 2VAMA 3A1DA 4WUTA 4X44A 4KX5A 1EGHA 4GKVA 5HE8A 3J81k 3OPYB 4MEBA 3I5YA 3CZ9A 4POOA 3GBSA 5HFNA 4K40A 4QUAA 4CDGA 2PUAA 3OLZA 3H7AA 4XVQA 5AXAA 2QD5A 2ZPAA 4RMGA 4B79A 4DHWA 1OBVA 1H2WA 1B42A 1L2TA 3FVRA 4HEQA 2GXUA 3T9EA 3IDFA 2WIAA 3MGAA 2JD0A 3Q1LA 1T8WA 3DWIA 2FFRA 2OGTA 2AK3A 3TQSA 3E2IA 2ZRFA 4FR5A 2Q3HA 2NGRA 1DC7A 4ZYWA 1TMYA 1FQWA 4A4DA 1CULC 3A9VA 2R7MA 1R8QA 3VJKA 1Z5VA 1Y4UA 2H07A 4J1TA 4ENTA 2IUTA 3WGOA 2H2HA 5CPFA 1Y8QB 2Q5HA 1ONBA 2IOQA 7ADHA 4BU1A 3KFVA 5M29A 3R41A 2R65A 5B7GA 2VTVA 1QC5B 1NP6A 4N65A 4RJJA 1FTNA 5C4GB 4B3CA 4CM4B 3H8SA 4OSPA 4LXIA 2QZ4A 1YS2X 3OA0A 3V7NA 2YYSA 3LP6A 4E4YA 4F5DA 4ZVTA 1BTOA 3L6DA 2JFPA 4OL9A 3ZV6A 3M6WA 3ORYA 2D4HA 3ANNA 5IAOA 1FC0A 1JKJA 3C1OA 3JQ9C 4WDRA 1H0KA 2A1TS 3WLSA 4ER5A 1Z7WA 3CNNA 1XTTA 1YOVA 3DB2A 2I7CA 4UAJA 1HZZC 5BOSB 1A27A 4UUPA 3OFJA 2VHXA 3MC1A 2P2YA 1TAHA 1JQDA 2H1SA 3G3EA 3RT1A 4DLBA 2KE5A 4NF2A 4GDFA 3C1UA 2W9XA 2XCQA 3NHFA 3MD0A 4OEHA 4Y30A 1DXOA 1KH3A 3VDMA 5BQ3A 1N9KA 4GL4A 4XPZA 4DL9A 2GJKA 2DH5A 3SS7X 3BS4A 2DQSA 4C20A 4HQLA 4P0QB 2FJPA 1XQXA 2X40A 4IJUA 1D1TA 2HCTA 2RGBA 1N5LA 3PRKE 1UPCA 4M9ZA 4OGLA 4KB5A 2IV2X 2CMGA 2IEBA 2FFAA 5TXGA 2K6GA 3E3NA 5FP0A 2ZJ6A 3MJSA 3U4AA 5DSTA 3LKDA 3D3QA 4JLKA 1U0LA 2Z1NA 1ECGA 2C9BA 1FY2A 2IIVA 2QTVA 2JAPA 3B8EA 4KFUA 4JXJA 4ZVKA 4B81A 3IIIA 1CJCA 1BU5A 4XRRA 2K4MA 5BR7A 2VDUE 3WWOA 2WM3A 4CF5A 5C3MA 3AFMA 4GX0A 4F4CA 1WCIB 1BE8A 1ZRMA 2GWRA 3H5VA 3K4PA 3MF4A 1E4YA 1PGJA 2WTEA 3E84A 3L0ZA 2WAMA 5B4UA 2MYUA 2GKSA 2PUEA 1JSZA 2PKEA 1PS8A 1ZGBA 3KX2A 4ZYXA 2E37A 3PT5A 3R5HA 1F2VA 2FWMX 3GRVA 4N3NA 1Y5IA 2XQIA 2HA3A 3IDOA 2GAAA 5DTIA 1C1XA 1KXJA 1NM5A 1RXEA 4DABA 2QVCA 3DZHA 4RVFA 4ZT5A 4B85A 1EYZA 5K0EA 1YQGA 1XDDA 2C5HA 1YZQA 3AWIA 2FZ4A 4YRCA 3TRIA 2VBIA 2BGIA 3BJRA 1UBJS 1HK7A 1F20A 1ZOOA 3HMKA 3LWBA 4Y0NA 2JEOA 2CDCA 3N0RA 1ZR2A 4G5SA 1DAKA 3WYEA 4RLSA 3GAFA 1Z5NA 3PNOA 1TRHA 3OAAD 4ETWA 1EFRD 5I9LA 2ZJZA 4RHFA 1FIUA 2CV0A 5CA1F 1M6EX 4AJEA 4BJ3A 5BN3B 1N78A 1JIXA 1ZCFA 3BWDD 4V0MA 4TMVA 2LCQA 5KJ6A 1XYGA 2PGNA 4MLDA 3LP5A 2JFZA 2IY8A 4OAPA 2II6A 4L5JA 1TADA 4G09A 1KZYC 1W94A 2F67A 5JYEA 4J29A 1DG1G 4ZT6A 3AW8A 1U28A 2OV4A 4CKBB 4ZOCA 4PYKA 1ZWLA 2R87A 1GVNB 1JR3E 1V5EA 4CLDA 1E3TA 2PH3A 1QAMA 4IUBS 4PNHA 1KZ6A 2O3SA 4IIXA 3QE9Y 5IRCD 2FCAA 5ER6A 5CAEB 5TPWB 2ODTX 1Q77A 4DPLA 1WMBA 2ZRKA 4BLTA 4D8VA 2VPQA 3CBQA 2PUDA 5HA5A 1FW8A 4G89A 4TTIA 3L7KA 1XKQA 4MPPA 2YV1A 3GJ7A 3AOEC 1Q7EA 1SD1A 4EDFA 3CW8X 3AHDA 1O8CA 1V16B 3H2GA 4HJRA 3TFWA 2A58A 5EZQA 5FNVB 5DIFA 3UT5A 5ISMA 1Y48E 4K9DA 4CMIB 1Z0IA 3L0OA 4PZCA 2OO5A 2KI5A 2QQ0A 4K05A 4UXIA 4URYR 1Q84A 4I5IA 1JU3A 4I5EA 2G82A 5DHQA 3GLSA 4KEAA 3FPLA 5BW5A 1SVKA 5KJ1A 3ELYA 2NIPA 1P0CA 1MOZA 1XJ5A 2JIOA 3BB4A 2JCGA 3P9CA 4FIDA 3P9SA 2GCGA 4FBMA 4XUDA 1MEOA 3KV3O 2X86A 2FE1A 4IDEA 5FFNA 3DAFA 3E9QA 4QM7A 2Z6AA 2VJPA 4RCYA 1R0CA 1TW3A 1XL1A 5JLAA 1LNSA 3KXLA 3WRYA 5K03A 2ILVA 1FFCA 2JIQA 3ELDA 4HFJA 2DWQA 1TAQA 2K7ZA 1SK8A 4IJMA 4KV9A 4RAOA 3ZX4A 4KMMA 3CGWA 2QJRA 3CZCA 2HU7A 2E49A 3JQEA 1SQFA 2F1KA 3ORQA 3TB4A 2Z2ZA 5K3DA 3SI7A 1ONNA 1OYWA 3HEBA 1IMJA 4TS3A 3VX4A 1C8KA 2ZIUB 3OZDA 5KSOA 4RA6B 1X1AA 5DB4A 3AHEA 2WB2A 2PEYA 4D4JA 3FCYA 4ZI7B 1BAPA 1RKXA 3C7AA 4HRYA 4I6EA 2Y4NA 1UKVY 3G02A 4MDYA 4MV7A 4E3ZA 1YMVA 5JSFA 3HBJA 3IO5A 1AKMA 3G85A 5DJ5A 3HZRA 3M7IA 1QB8A 3ZBUA 3VR6D 3F4KA 3P0IA 1RYEA 4DXAA 2WD7A 3ZE8A 4EYOA 1A9XA 4FMDF 1SXJB 3ZIAA 2WR8A 3WSTA 1O77A 3AR8A 3U6KA 1TM3E 3IS3A 3A2LA 3PFNA 3ROKA 3NBKA 3N8KA 5DXJA 5B2FA 2IX9A 2PGLA 1NOIA 4MV3A 4GH5A 2XT6A 5GOZA 1QGAA 1KE1A 3Q2OA 3C7DB 2ORWA 1ZIYA 4LZOA 2VRWA 1ZC4A 1E6WA 2V7QD 1EE2A 1G4HA 1KK2A 2LP4Y 3JWHA 1KRHA 4G4SO 1C9NA 1T9AA 4DADA 1NVKA 1I24A 2IHVA 1O94A 2E7ZA 3TRHA 4BVFA 3QP9A 2X0RA 1H2HA 3A3OA 3DEIA 4UVDA 2ZUUA 3QLEA 4G1UC 3FN4A 5DM4A 4MQ5A 2WU8A 4HNSA 1AUVA 2AB0A 4KZKA 2WWFA 5HILA 4AW9A 2ZAIA 3CTPA 4ZOLA 2EW2A 3D6MA 4BQFA 3ZWYA 4KN6A 2PM8A 1T6YA 4KO8A 1C7QA 2C2KA 4AVYA 3MJDA 1VJ0A 2I2AA 4GP7A 5GVRA 1CUUA 4KQXA 3TG8A 2ADFA 5FPTA 4U7HA 2FMKA 5JNUA 5B6IA 1ZA2A 1EZZA 2IODA 2BFAA 2OPHA 4MR9A 3K9HA 1QZXA 5HF6A 1SVIA 5EHXA 2EZTA 3S1LA 3S68A 2OENG 5K0LA 4I1VA 1PJLA 2F17A 3KPVA 2IEGA 4GGPA 1T0IA 3CW2A 4WN3A 4X6YA 2RAVA 3E0QA 4KLCA 1DQNA 3NOVA 4TYPA 1E63A 1AMOA 1BRTA 3ZY2A 1J5PA 2CDNA 3OLYA 2BJWA 2C7VA 2Q2QA 4EVQA 1TLTA 1DJQA 1W1UA 1Y3AA 1Z22A 5LZ7A 3VAAA 3VPCA 2PRSA 4AKTA 3LOUA 5JNLA 4ZU1X 4HQKA 2JKYA 4UE2A 2QAGB 3NB0A 3AIKA 5A3RA 5IULC 3SY8A 2A57A 2WT8A 3MRSA 1Q1ZA 4IG4A 3RT7A 2ZSAA 1BMTA 1HURA 2BFMA 4R9VA 4INPA 4NH0A 4Q48A 1ZN9A 3RIEA 2Y0CA 4Z5XA 4HGPA 3EG9B 3W8NA 1T6ZA 4BS9A 1XN1A 3DQPA 3LPCA 2NN3C 4DCMA 1KEEB 4JI8B 1H1LA 3ZHOA 2ARKA 1D1PA 2NYRA 3V6MA 3AUUA 4PRYA 5EWJB 3ZPXA 3U60B 3BZUA 2BKUA 1GYPA 4CEHB 2RH4A 3PUYA 4QJIA 1D2GA 3DZ8A 3FB4A 3NNSA 2Q5QA 1HYEA 1W4CA 1KO1A 1T8RA 2V9PA 3LX5A 4JJ7A 3BF8A 5M3BA 2IKQA 4GF5A 3FKSD 4KXWA 4EP1A 3TEFA 2VQSA 4UHFA 1ECPA 4OHVA 3BL8A 4D43A 4CUJA 3PPWA 1AKWA 5CYOA 4Z1OA 1NHWA 2I9PA 4YBZA 1PFYA 4EJFA 4MRMA 1WXIA 2CYCA 4RH3A 3R8XA 1YJ8A 4P84A 4WGFA 4LVCA 1V26A 3DE6X 2XX3A 2AG6A 1E1QA 1K0UA 2QD4A 3AB7A 3G7NA 1T0UA 1XN4A 2XVAA 3GFPA 1KTIA 1N36B 4P7JA 4A2WA 4DC9A 3DE3X 4NU6A 4YROA 2Z5GA 2WFZA 1BXGA 2VSXA 4DA0A 2RDMA 1W2GA 2SICE 3AF4A 2W6QA 3FUTA 4XLZA 3IQGX 3T0FA 1ABBA 1HTBA 4JGIA 5DCUA 4BQRA 5DSZA 3R8FA 1ULUA 5CT6A 4ACAA 1SU7A 4GPD1 3W9UA 3CCCA 3W3AA 5DTMA 1NW8A 5CH8A 4A0SA 1W8IA 3KETA 1UMBB 4HAVA 1CZNA 5FQNA 5LQUA 2KM1A 2OXCA 1GIAA 3MQ4A 1O5OA 2AC7A 3NIGB 4P83A 3EH2A 3B5JA 2XUJA 2OXEA 4NENB 5FKJA 4KITB 5J1TB 2IH2A 1T5SA 2DOKA 3HDGA 1YFKA 3F6BX 1W5TA 1L7PA 3T41A 3K92A 2D2EA 2CXOA 1FVXA 2VTEA 5CA0F 3VMFA 3FPHA 1E77A 2WNHA 4JXKA 3N7TA 2JI7A 4B45A 4CMAA 3FHLA 3GW8A 1IN1A 4R40A 3IIMA 3FROA 2J87A 4TM7A 4B2YA 4YMGA 2WFLA 3CLSC 3AI1A 1H5NA 3MM4A 4G4SP 1E5VA 4PGGA 3RC9A 4BZQA 2WQ6A 2P3LA 3LUJA 4E5NA 4YPFA 3IEMA 4XARA 2O59A 5HRUA 4IQFA 2OORA 1HT0A 3C3WA 1E7WA 4UM7A 3ESQA 4HATA 5D3ZA 5ESXA 4C03A 5F3WB 3F5MA 1YB5A 3SQLA 5GTDA 2BFOA 2CD9A 3QNWA 3QVMA 1E2FA 4CM5A 4LJ6A 1TYEB 3F98A 4QOSA 1TEZA 3LHIA 4F91B 4ZAGA 3EZ7A 4RA9B 1VE6A 5C53B 3PUIA 1S96A 4TN1A 1AQ6A 1UQTA 1HX7A 2KSQA 5IT5A 2WF5A 3WRVA 4RKQA 3CZRA 3RHFA 1IDOA 1ZK3A 1EFRA 5JTTA 5TLSA 4H17A 2ZJ8A 1K1EA 5H9VA 2GILA 1PL8A 2GM9A 3QVVA 4WY5A 5EKDA 1F5SA 4DBZA 1PDWA 4LOAA 5BSUA 4WBNA 3QU4A 3WY9A 4EZBA 3FY4A 1WUIS 3PU6A 4B43A 4OTZA 2W6ZA 2BFPA 1J07A 3FPKA 4WLNA 2DKFA 1QZTA 1ZIDA 4FI3C 2O2JA 3U2QA 1YHYA 2W2NA 2A0UA 1XTBA 4L0DA 2CEAA 3QEJA 1HH4A 2E85A 1V4BA 1P2SA 1KQOA 2CVFA 5AVQA 1PGQA 2IU6A 4DR6B 2Y99A 1WULS 2G4CA 3LC1O 2Q4RA 4CM4A 5AUPB 3V3TA 5ARBA 4Y2GA 3JQ6A 4MQEA 1WX1A 2ZS8A 1RWPA 1VJGA 3OU2A 4EB3A 2D8AA 2NVWA 3H8JA 3RVRA 4PANA 2BMJA 4YRBA 4HQOA 1F3LA 1QB7A 1SVUA 1ZW1A 3QOYA 4FDVA 5ADVA 3KM0A 2IITA 5C46F 4FB4A 4N76A 1JLLB 2H0RA 3O90A 2WJJA 3D0RA 3HCDA 3HP1A 3OY2A 3TFQA 1E5LA 2FSFA 3NHBA 3O38A 4QBHA 4DEXA 2YWJA 3MTDA 3ZCXA 3CX6A 3V4SA 2HWXA 1E2HA 4I4TB 4GYJA 5HIAA 4FYHA 4CT4B 1IXRC 4IVRA 4YMVA 4HZUA 1V5IA 2BBSA 3KEMA 1A3CA 4X45A 5JY1A 3SX0A 5EHGA 3LXXA 1UKEA 1AXEA 3LY5A 1G9XA 2C2GA 2OGWA 1OVMA 4K28A 1CUSA 5EA2A 3RVPA 1RT9A 3PR1A 3E18A 2X0NA 2CVQA 2CSUA 2V7BA 4FW8A 4R0NA 1DEOA 3KC2A 4DR5B 1UFQA 1SU8A 4W9NA 4DA9A 5A4MS 1ISPA 1FL9A 1KFEB 5AKGA 4XAQA 3UQZA 5K0JA 4D8WA 1Q0HA 4B32A 4AJHA 1C41A 4YLYA 3M6FA 1U8EA 3DLAA 3K73O 3Q12A 3EGCA 2WFMA 1NJ5A 4URUR 3LSYA 3O2JA 1NLZA 3SGLA 2ZYGA 3MWKA 4D4GA 5JPCA 2PS3A 2YMLA 2OESA 2NVUB 4UPVA 1M34B 1TO1E 1Y98A 5B7NA 2ZI7A 3FGOA 4MDHA 4DVJA 1OAAA 1XEXA 3AZPA 4GZ3A 5LQRA 3D54D 2O5RA 4HDAA 1UJNA 4KYUA 5BT8A 4I3HA 1DKNA 4MQ6A 2OCDA 4UD2A 4IXDA 3X1WA 3DO5A 2YJ6A 3OJEA 1G42A 2PKWA 3GBVA 1IJBA 2XWPA 3DW3X 1AF7A 2AE1A 4HB4A 2P6PA 1NAHA 3RIMA 3PQ8A 1G2IA 3TW8B 4I99A 2ZZKA 3NAMA 2KQUA 3WI7A 3QEBZ 3FNIA 4OA5A 1ND6A 2DEUA 3V55A 1CEQA 3AXSA 2HIAA 3OF5A 2AXNA 2Z6QA 1HQKA 1TE2A 1U3VA 2J9YB 5B1EA 5CXSA 1E32A 4H3SA 2JGEA 2V7QA 5FTMA 1Z56C 3GRUA 3ZDRA 5E7IA 4N5NA 3SX4A 3NC0C 3HC7A 1ACJA 2XADA 1SUWA 4UHCA 3IC5A 2I2BA 3PITA 3W5BA 2GUWA 3FJOA 3JQAA 1N7JA 2RKOA 1M2HA 4MHOA 1IB0A 4QO7A 3WQRA 4E1BA 1Z0DA 3K16A 1BEEA 3MT0A 4ZYZA 2Q4EA 4MVJA 1HTWA 4OHMA 4I3GA 4XEUA 1VSQA 1W2HA 1ZMOA 5FWAA 2RHOA 3Q41A 1Q7GA 2CDBA 1L1RA 1OX4A 1AKNA 2J0SA 3S2UA 4ENUA 3I5MA 1G291 3WOVA 1NW9B 1Y1TA 4C6TB 5JTUA 4WA7A 1L5WA 2LZ0A 4HVCA 4UJ3A 1QYRA 3GCWA 1IBMB 3K0KA 5EHQA 4BO2A 5TPWA 2OCIA 2JLYA 2EVWX 2Q07A 2H9YA 2A9FA 4FX2A 3RI3A 5B1YA 5BSHA 5CB6A 3WAGA 2QN7A 3I42A 4UBIA 2W2VA 4FHDA 4RGQA 4UHEA 1K98A 2RHGB 4FCCA 1XGKA 3V1UA 3V1NA 1YQ9A 1MNAA 1YZGA 2C29D 3UM9A 5C7IO 2DPGA 2ENWA 2ZE8A 4U2KA 1DIRA 4FSDA 3SZOA 3LGAA 3BOSA 1DAFA 1K6XA 1GGMA 1NKSA 3QE4A 3GEPA 4R0MA 3VNRA 1K68A 1MD9A 3BRSA 4KAJA 5EKXA 3AK4A 5IM4A 1U0HC 2J08A 1E92A 2JFXA 1C3LA 3AI7A 3GPBA 1MB4A 3KSZO 3LXUX 4KIGA 4MYUA 4Q9HA 4DV1B 2VWHA 4ZN6A 4NCIA 2MMCA 3WZ2A 1P0FA 5CA1A 4NBNA 1WEKA 3QKUA 4RIEA 3GI1A 2JD1A 3WQSB 3USCS 2J5RA 3WJ7A 1KEZA 2C4KA 5TQ0B 5TQ2A 4NDZA 2MU1A 3G2HA 5JASA 4L3WA 3EIUA 4C3UA 3HM9A 3AF3A 2WZDA 2OTCA 4Q3OA 1LD3A 1BHSA 1PKXA 1RS0A 2Y77A 3A1SA 3NT4A 4DSTA 1PFUA 1QQBA 2Q6OA 2NXEA 5BMVA 3DZKA 3A1WA 3ENZA 5EIBD 3KT0A 5BSVA 4B3IA 1SVMA 1LVHA 4TLAA 1GPYA 4NOJA 4JJGA 4K9LA 3M2TA 2D0PB 2OZEA 3UPTA 1Z88A 4MCIA 3K70D 1Q12A 4IS2A 4FUQA 5LYJB 1XD8A 4DC1A 2RGEA 3VR5H 1PJRA 2I33A 2A35A 3LUDA 3SM3A 3ZNQA 621PA 4XWWA 1IXZA 2VXYA 3FNGA 3KLNA 3MINB 4M88A 3OKFA 5BXYA 4CTOA 2NPFA 3QKTA 2J7KA 5FPYA 3I83A 4PRLA 1PL6A 5HJ2A 3T9DA 1X7WA 1E3EA 1Z6ZA 2QTMA 5HEKA 5DX8A 1V3UA 4JC8A 2QTNA 2FPIA 3QXSA 4LMRA 5AJYA 4DMCA 2QP9X 3WBJA 2JAQA 2J5XA 2WD7B 3AJ8A 4ETMA 5IG2A 2BP7B 4NPHA 4PC7A 2X58A 3KU4A 3EVAA 2JIPA 3C6KA 1E3LA 5TY0A 3UAZA 2BLNA 3C45A 1ZA1A 1LTHR 1SELA 4OI4A 5IKXA 1OPXA 1KO4A 2UUOA 2FP4B 1D7OA 4MPDA 1G2OA 2AWNA 3F3MA 1DRKA 5FV7A 1G5PA 4CMHA 4HD8A 5AM5A 5AK3A 4EG0A 2OQ2A 3FAZA 4DFDA 2PJRA 4RD6A 1X1RA 2GD1O 3A11A 4C0WA 2XT0A 2ILTA 3UMFA 2MMGA 1AGYA 1JAIA 1T15A 2VYNA 4KQJA 1KMNA 2Y1LA 1TO6A 1J7KA 4AJIA 4M1TA 2JFHA 4YT5A 5A5EA 5TEVA 1EKXA 1NX6A 4BXOB 3ITKA 3H9EO 1V7PC 4DV3B 2JLZA 2YZGA 2PD6A 4F1JA 3WRYC 1TLFA 1GRQA 2Y05A 3MS2A 4FKZA 1FFBA 2OXIA 2NYVA 4UVHA 3RNLA 3U3JA 4W1SA 3BULA 3QZUA 3VZDA 4YO8A 3AR5A 2PE5A 5DLQC 1KVSA 3V00A 4ZI7F 1C1YA 2OA0A 1F06A 2FHSA 4MR9B 2HHJA 2I8AA 3DLTA 2IPXA 2ZRLA 3T3DA 5FUYA 2QTFA 4BOYA 4CG2A 1SCBA 2ZVJA 4LCBA 1Q1EA 2LV8A 3OD1A 1EXMA 2WJYA 5CJJA 5FTJA 1ZM3A 3UPDA 4YASA 2HO4A 1GCAA 3DAHA 2CXQA 3FDXA 1PJ2A 2GO1A 1HWYA 1QSGA 2UYQA 2VUIB 3HKCB 5EXXA 5JYDA 1MCZA 2UDPA 3OO0A 1FQKA 4EW1A 3L7YA 1SKMA 5EIOA 1RP7A 2PXAA 4GX1A 2Q5EA 1F38A 4R9SA 3PIRA 4RPHA 5JE8A 3SDZA 4N48A 2VBFA 1JHVA 3A1TA 3CR7A 4NICA 4EWLA 3CFYA 5A62A 3KWLA 4JVMA 4NJEB 3TB6A 4KGZA 5G41A 5J43A 4NCAA 1R15A 3RTEA 1XSEA 1EQAA 3EWNA 2V5AA 3RRXA 1N0WA 1NBWB 3K0CA 2BM0A 2HF8A 2JC3A 3NIBA 3OQVA 2XNKA 3OZCA 4M8IA 2V97A 2P8JA 3FPGA 4GMXA 5FOTA 4EG6A 1VJCA 1EFVB 3NXSA 5H3HA 4F9FA 5KTYA 3OLXA 1TPZA 1YA6A 1EM8A 2X3UA 1G38A 1PGPA 3JZFA 5BW8A 3GRPA 1XMSA 2DPYA 3TMYA 4Q6WA 3HV2A 2V5UA 3HYCA 3NDPA 3ZBPA 4HN9A 5GZ3A 4E5SA 3HFRA 4JBXA 4QOEA 5L3VA 3HXOA 1PTJC 2G3YA 5AKXA 3MMZA 1USVA 1YK0A 2Z5FA 3FCAA 4ZPJA 1E5DA 3EG5A 3GMIA 5IARA 3SDSA 4AZ3A 2HXGA 3VR2A 4RHEA 4PZPA 4WNAA 5FNZA 3WGJA 3INRA 1SZJG 1J0EA 4XQ0A 3D6UA 3CZPA 2HNKA 5BXQC 3CF0A 3DR5A 2CXTA 4CM9A 3NATA 2RGAA 5DBGA 2COUA 3AIOA 3L7NA 3OIWA 5K1ZA 3TNYA 3U9TA 1P2GA 3QH4A 1QBKC 2TMGA 3SFZA 2VI5A 3C3KA 4F71A 2PSSA 4U7FA 1CJTC 3JQ9A 5F35A 3W6UA 3WYDA 1RWBA 1ZD1A 3HUUA 5BUSA 4M8NE 3H5RA 2ZVQX 3KHTA 4KQHA 4ZQGA 3KQSA 1OI7A 4HDKB 4HSEA 4KRXA 3QKRA 1E7SA 4XM0A 1I32A 3ZGOA 4YMLA 3EAGA 5FLEX 3KR2A 3FOWA 1WRBA 4PEVA 4AB1A 1U5BB 1Z2OX 5F9MA 2CJFA 4FZRA 3VJMA 4RESA 1Y9EA 4HJXA 2HRBA 3N87A 1PJQA 3ZV7A 1XVIA 1IIBA 1TEHA 5EQTA 5JU6A 4JV5B 3JASB 3PHBE 1JIKA 4DIKA 5KU1A 2PXHA 3GH3A 5C7LO 2FX3A 2V7WA 4WBXC 1J9GA 4UM9B 2XUZA 2ZYRA 1KRWA 2YOGA 1Z45A 1X8JA 2R66A 3ZTTA 4MPJA 2A9VA 1DARA 3M6MD 1SBTA 2I6XA 3GGGA 4AKHA 1MJFA 4F3RA 1B8UA 2TMKA 4R7TA 3K94A 2BHNA 2R2GA 5DCLA 1GLNA 4N9WA 3U49A 3I2KA 5F78A 1UJ2A 5JV5A 3HR4A 1ZUIA 3AEKB 3GRKA 2WFLB 1E1KA 2ZRJA 4WACA 1EUYA 1NC3A 4H0FA 4W7SA 3S1AB 1YHNA 2PPLA 4XM1A 2O3RA 4PNPA 5DCYA 3TZQA 1VLQA 3T06B 5K7SA 1MO5A 1FZTA 3ND7A 4YYZA 1Q6YA 1SG9A 4P34A 5HBRA 3VH1A 2VAPA 5E3IA 3KQLA 2P6RA 1N5IA 1V6CA 2XH8A 1CZRA 2RD2A 2RMKA 4JBWA 4RHTA 5KI6A 1O96B 1P39A 3QVWA 3EF3A 1EWTA 2QIPA 1SCKA 3LDGA 4R3WA 3CNBA 4INJA 1KJ9A 2DFNA 4I2VA 2OCBA 3DBHA 4E21A 4ALMA 4DSOA 4F3KA 5JH7F 3PXBA 2Q2NA 2ZPUA 2VLIA 5J2TB 1NULA 3GRZA 1YBVA 5IHPA 3CONA 2LGJA 3ESDA 4WBNB 2OOSA 1ZI8A 5AK0A 2VDWA 2YJGA 3OT1B 2PX3A 4BB6A 4EGSA 3ZK7A 1U0EA 4CUKA 4X95A 4BV8A 3BCHA 1RU3A 4R98A 3AVQA 3CPJB 1J2RA 2Q3DA 5DHSA 3G0HA 4K46A 1EBFA 4K3VA 2EATA 4EFMA 6AT1A 4O4LB 4B3GA 3Q9UA 1GG5A 1QCYA 1YR2A 1ZICA 3DFFA 4A3SA 1PWEA 3HHEA 1T5BA 3QX3A 5IKOA 1ZN8A 2GASA 3QF4A 4BKMA 2F43A 2KHZA 3ONFA 4UNRA 5ITSA 2W37A 4MWGA 1GEGA 2J6IA 4JLBA 4MQEB 4ARUA 1LBIA 4REMA 4BWYA 2CCGA 2I4RA 4GVLA 4TWRA 4Q4CA 4A27A 1P7ZA 1O3YA 4IAOA 4EHLA 1ZK4A 4IJQA 5ABPA 5HDQA 4TYNA 1IN7A 4LOJA 1KDYA 5JJCA 3B36A 3CU5A 2EZ4A 2AJTA 1NNEA 3BQ9A 2OVBA 5CT5A 2PIAA 4WFJA 3TJMA 5KSYA 3PUXA 1JLLA 3IKTA 2FB9A 4YRAA 1T6XA 3R3YA 4RYDA 1GDHA 4LY6A 2KS6A 3PGMA 1TM2A 2IPMA 4A8JC 1GRNA 5JOQA 4QD3A 2ZUVA 3TR6A 1T91A 2QX9A 4ZV9A 1QH9A 1IUPA 4J1NA 1ISIA 2GSDA 5T41A 2Q62A 5HK9A 1T36B 3EEBA 3M89A 2OV1A 1ORDA 2B2XA 1YS7A 4DWWA 3DJFA 3GAAA 1JFSA 2E5FA 4GC9A 2PX8A 1Y3CE 3OECA 4UEKA 4QJBA 3AL2A 3CUSA 4HFMA 5KTKA 4DA4A 3EIFA 1PR6A 1U8UA 3G0BA 1D1QA 4DEYA 5SV2A 2I1LA 1L5NA 4DSNA 1KKLA 4C6HA 1PKEA 1EHCA 1M9NA 2EAUA 4HGZA 2Z58A 4Y8VA 4XWKA 5FWNA 1FU7A 3KZVA 3O8OB 2HJRA 5EP4A 1NWHA 3D3NA 1ZD9A 1Y4SA 2GPAA 2X1MA 1WF3A 3BH6A 1Y4DE 3BSSA 2NVUA 4RVHA 1D07A 1EXWA 3EEQA 2DE0X 5LD2B 1L9KA 4RVDA 3NFRA 3O2NA 2X9QA 2D7CA 1XMQB 2B34A 1T4CB 1JI3A 1RPNA 1PHRA 1CUCA 1Y7IA 2IYSA 3Q85A 2P5SA 1FFEA 2ZIXA 3EF1A 4FHCA 4Y1FA 1DAPA 4EA9A 2UXDB 2JHAA 3PC8C 3A6GA 4BNDA 5CUQA 3WYBA 2VP6A 4N7JA 4HH1A 4S0XA 4GM0A 3OCCA 1V1MA 2O8CB 4OGFA 2K5UA 3PZBA 1P9OA 2X8BA 1FTWA 2W43A 1IK6A 5KOYA 5DMHA 3K0BA 3KBOA 5EJIA 3FNHA 4LHXA 2EERA 1DC6A 3Q7EA 1G6Q1 4ZWNA 2DQZA 2Z8YA 4DKJA 3KCNA 1GZHB 4FP9A 4QUBA 2AG0A 3DYVA 4D81A 5BVGA 4JKYA 1NY5A 1XCLA 4TWBA 2H1FA 3A10A 3SHOA 2XGJA 1I1HA 2GX6A 1WU8A 1YDWA 3CUVA 4FCTA 5KQPA 4S2UA 1G4AE 2V5VA 2J0EA 2CGEA 2CNOA 5FUVA 1AE1A 1IQ0A 5J2UB 4YWJA 3ENQA 3L82B 1N25A 1TU4A 1YTLA 1MRZA 2HMSA 2ZYDA 3IBYA 3ITEA 4BGUA 4CTKA 1FSPA 1A9RA 1K4KA 2OYCA 3NT5A 3JRWA 1WXWA 4C6TA 2ZB4A 2AOTB 2RAFA 3LX4A 5DEIA 4AJPA 4LYJA 2AFHA 1CP3A 3VAYA 5I45A 3U6BA 4Q3AA 1CIVA 2G71A 2AFIE 4I5FA 3I76A 3HO1A 2OXRA 1PT8A 2PMCA 3ZI4A 2VJLA 1NN0A 3QK7A 1XZGA 1FMJA 1V4NA 4X63A 3BA6A 1GGEA 3H04A 3H17A 3ZE6A 3HCCA 3GZTB 3HYRA 1JFFB 5DIZA 2OUKA 5HJ7A 4PLCA 3OOHA 1QX4A 1ZRSA 2KPOA 3RKUA 1LLCA 3O82A 1L7VC 5HTKA 7AT1A 5IAJA 2P0AA 5KDDA 4G37A 3A4YA 2XNDD 4MINA 2OFFA 3Q98A 4EPTA 5BSRA 2NUAA 3V6LA 3GGCA 1D2CA 3TLKA 3TI9A 2QRHA 3O8QA 3WYNA 5IU6A 2PSHA 3FDIA 2QLNA 3R0QA 3LW7A 4R3UC 1DC8A 3U7QA 4AZVA 2VJYA 1UBSB 3Q88A 3IO3A 4RHCA 3THWB 4QTTB 1GLVA 1HRKA 4ZQBA 5CH3A 3NVDA 3EGDA 3FMVA 3PNQA 1P9LA 1DIBA 3BJZA 3GMDA 3PPYA 3MK31 1GCIA 1U80A 2BC9A 2X6RA 3FJYA 3IPAA