1EI6A

Crystal structure of phosphonoacetate hydrolase complexed with phosphonoformate
Total Genus 126
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
126
Knots found
sequence length
406
structure length
404
Chain Sequence
TNLISVNSRSYRLSSAPTIVICVDGCEQEYINQAIQAGQAPFLAELTGFGTVLTGDCVVPSFTNPNNLSIVTGAPPSVHGICGNFFFDQETQEEVLMNDAKYLRAPTILAEMAKAGQLVAVVTAKDKLRNLLGHQLKGICFSAEKADQVNLEEHGVENILARVGMPVPSVYSADLSEFVFAAGLSLLTNERPDFMYLSTTDYVQHKHAPGTPEANAFYAMMDSYFKRYHEQGAIVAITADHGMNAKTDAIGRPNILFLQDLLDAQYGAQRTRVLLPITDPYVVHHGALGSYATVYLRDAVPQRDAIDFLAGIAGVEAVLTRSQACQRFELPEDRIGDLVVLGERLTVLGSAADKHDLSGLTVPLRSHGGVSEQKVPLIFNRKLVGLDGRLRNFDIIDLALNHLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHONOACETATE HYDROLASE
publication title Crystal structure of Phosphonoacetate Hydrolase complexed with phosphonoformate
rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 126
structure length 404
sequence length 406
chains with identical sequence B, C, D
other databases KnotProt 2.0: S +31
ec nomenclature ec 3.11.1.2: Phosphonoacetate hydrolase.
pdb deposition date 2000-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01663 Phosphodiest Type I phosphodiesterase / nucleotide pyrophosphatase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1360.110 Alpha Beta 2-Layer Sandwich Gyrase A; domain 2 Domain 2, Phosphonoacetate Hydrolase 1ei6A02
3.40.720.10 Alpha Beta 3-Layer(aba) Sandwich Alkaline Phosphatase, subunit A Alkaline Phosphatase, subunit A 1ei6A01
3UO0A 1EQJA 4GTXA 5LRNA 3IGZB 2GSUA 4CYSA 4FDIA 4LRCA 3NKMA 4ZG7A 3ED4A 3A52A 4CXUA 1SHQA 1ED9A 2W5QA 5K4PA 1KHJA 4NWJA 4YR1A 2GSOA 3UN3A 1AJBA 4LREA 4GTYA 1ALIA 5LQQA 3DYCA 4KJGA 1KH5A 1ELYA 1KH4A 2IFYA 4KAYA 1ANIA 1EI6A 5L0EA 3UN5A 3E2DA 3BDGB 4LR7A 2IUCA 1ALJA 3SZZA 1ED8A 1EJJA 1ALKA 1O98A 4QAXA 1URBA 3M8ZA 5EGEA 3NKRA 3WBHA 5L0KA 1Y6VA 5LRMA 2GSNA 1N2KA 2W8SA 5IJQA 1KHKA 1ELXA 4UOPA 5L0BA 2W5XA 4CXSA 1KH9A 4GTZA 1E1ZP 2RH6A 3T01A 4ZGAA 1ALHA 4MY4A 2QZUA 4LRDA 4UPKA 4MIVA 4NWXA 3M8YA 1P49A 3OT9A 5AJ9A 3WAWA 5LIAA 2ZKTA 5DLVA 1ZEFA 1ANJA 4UOOA 1EW2A 2IUCB 4MHXA 3UN2A 1ZEDA 3NKQA 1E3CP 2X98A 4KM4A 4TN0A 5DLWA 5DLTA 5TJ3A 3MK2A 4CYRA 1AJAA 2VQRA 1SHNA 3NKNA 2W5TA 1E2SP 4ZG9A 4GTWA 1AJCA 3KD8A 1HDHA 3TG0A 2W5RA 3UNYA 2XR9A 1K7HA 5GRRA 3SZYA 2W5VA 1ZEBA 3M8WA 3MK1A 1B8JA 1Y7AA 2XRGA 4LR8A 1KHLA 1KH7A 1EW9A 3IDDA 4LQYA 2ANHA 3BDGA 3TX0A 5C66A 1N2LA 4UPIA 3IGYB 4KAVA 4LRBA 3T00A 2W5WA 3BDHA 1O99A 4LRFA 3M7VA 3WAXA 5KXAA 3T02A 3MK0A 3BDFA 5IJSA 2GLQA 1AJDA 1AUKA 2GA3A 3WAYA 3NKOA 3LXQA 4UORA 4KJDA 5GOVA 3TWZA 2W8DA 1HQAA 1ELZA 3DPCA 1URAA 4B56A 4LR9A 5EGHA 4CXKA 3B5QA 1EW8A 4UPHA 4UPLA 4ZG6A 1FSUA 4LR2A 3WAVA 3CMRA 1KHNA 2W5SA 3NVLA 4N7TA 3Q3QA 5HRTA 1E33P 2D1GA 2G9YA 5INHA 4FDJA 1HJKA 3NKPA 4LRAA
chains in the Genus database with same CATH superfamily
3MMLB 2PPBA 4OINA 4A3BK 2E2IA 1EQJA 4GTXA 1O24A 2GSUA 4CYSA 4DDQA 3S1RK 4LRCA 4JK1A 2WB1L 3BUEA 4NWJA 1WCMC 3S2HK 1X31C 2FQTA 3AD7C 2PMZL 4LREA 4GTDA 2D6FC 1ALIA 1KH5A 1EI6A 1F9NA 1TWGC 1WQGA 1Y1VA 4A93C 4WJ3M 2IUCA 3M4OC 3SZZA 5IYCK 1URBA 5M3MK 3LPXA 3S16K 3L4KA 2VUMK 1KHKA 4UOPA 3GDZA 5IP7K 4GTLA 4LRDA 4KM8A 4GTFA 3RZDK 3BP8C 3TTGA 2VUMA 2E2HC 4KASA 5C3EK 1TWAA 1YX2A 1ZXOA 3GTMK 1VLOA 3NKQA 4OIQA 3S1MK 5DLWA 1SFOA 4GTAA 4GTCA 2JA6K 3PO3K 3S15K 2R7ZC 3JSTA 2NVQK 1AJAA 3NKNA 1XZQA 4BLBA 4AYBL 1AJCA 4P5AA 3H3VD 3TG0A 1DCPA 2W5RA 2NVYA 1TWFC 3HOYC 2JA7C 3FOEA 3FKIK 2EBBA 3ADAC 1K7HA 5GRRA 2VUMC 2GAHC 2W5VA 1WSRA 3GTLK 3A8KA 1B8JA 2XRGA 3WODA 5JFEA 1XXBA 3IDDA 2PA8D 3G4AA 1O25A 3AQPA 4LOWA 5D4DA 5M5WK 4C3HC 3GTPC 3S1RC 2PA8L 3M7VA 3WAXA 3T02A 3OPFA 3MK0A 4BY7K 5IJSA 4C2MK 2GLQA 3FKIA 3WAYA 4UORA 4KJDA 5GOVA 1BJTA 3H0GK 1ZQ1C 3H3VL 2JA7A 1ELZA 2NVYC 3TFHA 1TWGK 4CXKA 1XXCA 3N3YA 5IOSA 4PAAA 4ZG6A 2FQOA 2B63A 4KARA 4C3IK 1IW7A 4A3IK 2JA6C 3PO3C 3H0GA 4KMAA 3HOZC 4G7HA 3S15C 1KHNA 2JA7K 4Y7NC 2PHCB 4C45A 4BLAA 5M5XK 4FDJA 4QJVB 3NKPA 3FOFA 5IP9C 1DCOA 2PMZD 3GEEA 5FLMK 3GTMC 3GTQK 1TWHA 4A3LC 3HOWC 1O27A 1J98A 1TWGA 3HXAA 1I50K 3S1NK 5K4PA 4YR1A 3UN3A 3GTPK 1AJBA 3GTGC 1TWAK 4BY1C 3H0GC 4BBRK 1USOA 4KAWX 5E68A 4MEYA 2IFYA 1ANIA 5L0EA 2R93A 1PJ6A 3UN5A 3GTLC 4YG2A 3K7AC 1O98A 4G7OA 5L0KA 4Y52C 5C4JC 1Y6VA 3RZOC 5IJQA 1YNJA 4Y7NK 2JA5A 1ELXA 2R93K 4Q5SA 4GTZA 1E1ZP 3T01A 4MY4A 1G51A 2ZUFA 3M8YA 4A3LK 3A8JA 5LIAA 2Y0SL 4GTEA 1ZEFA 4J3NA 4P9SA 5TMFA 1TWHK 4UOOA 3GTKC 2IUCB 1ISEA 2YU9A 3OREA 3GTJC 4MHXA 5C44K 2V6TA 1E3CP 2CFAA 4G0WA 2X98A 2E2JC 4KM4A 4X6AK 5DLTA 2W7VA 5FJ8K 4A3FK 3S17K 4CYRA 1I50C 4GFQA 2VQRA 4FZBA 4KMDA 4OIOA 3GTPA 1E2SP 1VH2A 1I3QA 3AD9C 4MEXA 4NOIA 4A3IC 3S2DK 1HQMA 3UNYA 1DD5A 3HKZD 1ZYRA 4YFKA 4A3CC 4KDDA 4A3KK 1SMYA 3SZYA 3HOUK 4A3GK 2JA8K 5IOQA 4XSXA 3GTKA 4LR8A 1I6VA 1EW9A 5M5YK 2ANHA 3BDGA 3TFJA 3VA7A 3S16C 2W5WA 3BDHA 2Y3PA 1O99A 4LRFA 1R9TK 1B4BA 2E2IK 2JA5K 4OIRA 5KXAA 1SFOC 3BDFA 1VGXA 1PJ7A 1AJDA 4KMUA 2Y0SD 1AUKA 4P5BA 1XZPB 5IYCC 3CAGA 1ZVUA 2NVTC 4BY1K 1O28A 2W8DA 1R9TA 3RZOK 3DPCA 3G4CA 3GTMA 4LR9A 4KMHA 3B5QA 3K7AK 4A3MK 3M4OK 5L46A 2NVXA 4LR2A 1Y1VK 5C4JK 4Y52K 3NVLA 4N7TA 4M1XA 4A3KC 2R92A 1O2FB 3GIRA 4XLPA 2CFAB 5INHA 1IQ0A 1V5VA 1I3QK 4QIWL 3UO0A 3GTLA 4C3JC 1J6XA 4X6AC 3IGZB 5LRNA 2A6EA 1R9TC 1C0AA 4FDIA 3NKMA 3GEHA 5C4XC 2XCQA 4A3DC 3GTKK 4CXUA 4AH6A 3GTJK 4A3EC 4G0VA 4KM9A 3HOVK 1ED9A 1KHJA 4FM9A 5LQQA 4KC6A 4QIWD 3IPJA 2CW0A 2JA5C 1K83C 4KJGA 1VJEA 1ELYA 1IL2A 1KH4A 4KAYA 4KATA 1WOSA 1TWCA 1SFOK 4BY7C 2XCOA 3S14K 1ALJA 1EK8A 1ALKA 3M8ZA 5EGEA 1I6HC 3WBHA 5LRMA 2GSNA 3L4JA 1JOEA 3LAPA 1TWCK 4RMFA 2JA8C 1IS1A 4G7ZA 2RH6A 2B63K 3LAJA 4NWXA 4GT9A 5AJ9A 3V4GA 2ZKTA 2XCRB 5DLVA 2WAQD 1IE0A 1ANJA 3GTOA 1KQ4A 4PABA 2O5IA 4C2MC 3N0BA 4A3BC 1WORA 3UN2A 3OEPA 4WILA 3GTQC 4WJ4A 4XLNA 3S2HC 4TN0A 1F7UA 1WQHA 1O2BA 1O2AA 3MK2A 4BBRC 5HL8A 4GZYA 1F93A 4A3DK 2A68A 4G0UA 1SHNA 2JA6A 4A3EK 3HOVC 2W5TA 3S1NC 4ZG9A 4GTWA 5IP9K 2V6UA 3I4NK 1HDHA 5IOTA 4BXXK 4LK0A 4C3JK 1F7VA 3HOWK 2A6HA 4A3JC 3M8WA 3EQLA 5IYDK 3MK1A 5C4XK 3AD8C 4GTBA 1KHLA 2BE5A 3TX0A 1Y1WC 1WOOA 3NUHA 1IBAA 1YNNA 4KAVA 4LRBA 3T00A 4UPIA 1EH1A 2ZFZA 2R92K 4LK1A 1USMA 3M3YK 1K83K 4XSZA 1EQRA 5C3EC 4KN4A 4A93K 1RU0A 2GAGC 1WCMK 3NKOA 1BS2A 3RZDC 1TWAC 3TWZA 1O26A 3DXJA 4LJZA 1AB4A 2E2HK 1K83A 2NVQC 1URAA 4B56A 1XZPA 4KB2A 1TWCC 4UPLA 3S14C 5IP7C 1FSUA 3TFIA 3WAVA 3CMRA 3Q3QA 4A3CK 5HRTA 4YFNA 4BKWA 1E33P 1WCMA 4ILDA 2NVXK 3S1QK 4A3GC 1HJKA 4YFXA 4ZGAA 3PO2K 1TWFK 1Y1WK 4MQ9A 1PJ5A 3QX3A 3FKIC 5JVOA 1JVIA 1L0WA 3FHZA 2R92C 1J6WA 5IYDC 4ZG7A 3ED4A 3GTOC 5IORA 3A52A 1BGWA 1SHQA 1JQWA 2W5QA 1B4AA 4O2DA 2GSOA 1XZQB 3S1MC 4LLGA 4C3HK 1WQFA 4GTYA 3S17C 2R7ZK 3DYCA 4Q4ZA 4KB4A 1WIHA 2NVYK 3CQZK 2A69A 2YU9C 3E2DA 3BDGB 4LR7A 1ED8A 3I4NC 1EJJA 4QAXA 2V6SA 3HOXC 4BXXC 3HOYK 4BBSC 3NKRA 2ZUEA 1ZBSA 5IYBC 1N2KA 4ZH4A 3N0CA 2E2HA 1WOPA 2W8SA 1BDFA 2P5MA 3HOUC 2E2IC 3CQZA 5L0BA 3M3YC 2W5XA 4CXSA 1KH9A 5CHPA 2JH3A 4C3IC 2R7ZA 1ALHA 2QZUA 1I3QC 4UPKA 4MIVA 1P49A 3OT9A 3WAWA 3I4MK 3GSIA 5TMCA 1EW2A 3PO2C 3S0XA 2KWAA 3BP3A 1ZEDA 1TWFA 1DCHA 2NVTK 1Y1VC 5TJ3A 3HOZK 3GTOK 5M3FK 2NVXC 3CQZC 4A3MC 3KD8A 3GTGK 1XPPA 5FLMC 1HI9A 3HOXK 1J6VA 1I6HK 2XR9A 1XXAA 1EFWA 3GTQA 3S1QC 1ZEBA 1Y7AA 3A8IA 1KH7A 1UV7A 4LQYA 5C66A 1VRQC 1N2LA 2RGRA 3IGYB 5IYBK 3GEIA 3AQOA 1I50A 2WAQL 2O5JA 2B63C 3AH5A 4OIPA 2YU9K 1O29A 2GA3A 3LXQA 3I4MC 3HKZL 1Y1WA 2E2JK 1HQAA 3GTJA 4KN7A 2WB1D 1GE9A 4AYBD 3ERED 4XCHA 5EGHA 1TWHC 2R93C 1EW8A 4UPHA 5C44C 5CJ9A 3S2DC 4BBSK 4QJVA 4A3FC 2W5SA 1INNA 2D1GA 2G9YA 4A3JK 2P8TA 1WSVA 3GTGA 1YCLA 4LRAA
chains in the Genus database with same CATH topology
3UO0A 1EQJA 4GTXA 5LRNA 3IGZB 2GSUA 4CYSA 4FDIA 4LRCA 3NKMA 4ZG7A 3ED4A 3A52A 4CXUA 1SHQA 1ED9A 2W5QA 5K4PA 1KHJA 4NWJA 4YR1A 2GSOA 3UN3A 1AJBA 4LREA 4GTYA 1ALIA 5LQQA 3DYCA 4KJGA 1KH5A 1ELYA 1KH4A 2IFYA 4KAYA 1ANIA 1EI6A 5L0EA 3UN5A 3E2DA 3BDGB 4LR7A 2IUCA 1ALJA 3SZZA 1ED8A 1EJJA 1ALKA 1O98A 4QAXA 1URBA 3M8ZA 5EGEA 3NKRA 3WBHA 5L0KA 1Y6VA 5LRMA 2GSNA 1N2KA 2W8SA 5IJQA 1KHKA 1ELXA 4UOPA 5L0BA 2W5XA 4CXSA 1KH9A 4GTZA 1E1ZP 2RH6A 3T01A 4ZGAA 1ALHA 4MY4A 2QZUA 4LRDA 4UPKA 4MIVA 4NWXA 3M8YA 1P49A 3OT9A 5AJ9A 3WAWA 5LIAA 2ZKTA 5DLVA 1ZEFA 1ANJA 4UOOA 1EW2A 2IUCB 4MHXA 3UN2A 1ZEDA 3NKQA 1E3CP 2X98A 4KM4A 4TN0A 5DLWA 5DLTA 5TJ3A 3MK2A 4CYRA 1AJAA 2VQRA 1SHNA 3NKNA 2W5TA 1E2SP 4ZG9A 4GTWA 1AJCA 3KD8A 1HDHA 3TG0A 2W5RA 3UNYA 2XR9A 1K7HA 5GRRA 3SZYA 2W5VA 1ZEBA 3M8WA 3MK1A 1B8JA 1Y7AA 2XRGA 4LR8A 1KHLA 1KH7A 1EW9A 3IDDA 4LQYA 2ANHA 3BDGA 3TX0A 5C66A 1N2LA 4UPIA 3IGYB 4KAVA 4LRBA 3T00A 2W5WA 3BDHA 1O99A 4LRFA 3M7VA 3WAXA 5KXAA 3T02A 3MK0A 3BDFA 5IJSA 2GLQA 1AJDA 1AUKA 2GA3A 3WAYA 3NKOA 3LXQA 4UORA 4KJDA 5GOVA 3TWZA 2W8DA 1HQAA 1ELZA 3DPCA 1URAA 4B56A 4LR9A 5EGHA 4CXKA 3B5QA 1EW8A 4UPHA 4UPLA 4ZG6A 1FSUA 4LR2A 3WAVA 3CMRA 1KHNA 2W5SA 3NVLA 4N7TA 3Q3QA 5HRTA 1E33P 2D1GA 2G9YA 5INHA 4FDJA 1HJKA 3NKPA 4LRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3UO0 A;  1EQJ A;  4GTX A;  5LRN A;  3IGZ B;  2GSU A;  4CYS A;  4FDI A;  4LRC A;  3NKM A;  4ZG7 A;  3ED4 A;  3A52 A;  4CXU A;  1SHQ A;  1ED9 A;  2W5Q A;  5K4P A;  1KHJ A;  4NWJ A;  4YR1 A;  2GSO A;  3UN3 A;  1AJB A;  4LRE A;  4GTY A;  1ALI A;  5LQQ A;  3DYC A;  4KJG A;  1KH5 A;  1ELY A;  1KH4 A;  2IFY A;  4KAY A;  1ANI A;  1EI6 A;  5L0E A;  3UN5 A;  3E2D A;  3BDG B;  4LR7 A;  2IUC A;  1ALJ A;  3SZZ A;  1ED8 A;  1EJJ A;  1ALK A;  1O98 A;  4QAX A;  1URB A;  3M8Z A;  5EGE A;  3NKR A;  3WBH A;  5L0K A;  1Y6V A;  5LRM A;  2GSN A;  1N2K A;  2W8S A;  5IJQ A;  1KHK A;  1ELX A;  4UOP A;  5L0B A;  2W5X A;  4CXS A;  1KH9 A;  4GTZ A;  1E1Z P;  2RH6 A;  3T01 A;  4ZGA A;  1ALH A;  4MY4 A;  2QZU A;  4LRD A;  4UPK A;  4MIV A;  4NWX A;  3M8Y A;  1P49 A;  3OT9 A;  5AJ9 A;  3WAW A;  5LIA A;  2ZKT A;  5DLV A;  1ZEF A;  1ANJ A;  4UOO A;  1EW2 A;  2IUC B;  4MHX A;  3UN2 A;  1ZED A;  3NKQ A;  1E3C P;  2X98 A;  4KM4 A;  4TN0 A;  5DLW A;  5DLT A;  5TJ3 A;  3MK2 A;  4CYR A;  1AJA A;  2VQR A;  1SHN A;  3NKN A;  2W5T A;  1E2S P;  4ZG9 A;  4GTW A;  1AJC A;  3KD8 A;  1HDH A;  3TG0 A;  2W5R A;  3UNY A;  2XR9 A;  1K7H A;  5GRR A;  3SZY A;  2W5V A;  1ZEB A;  3M8W A;  3MK1 A;  1B8J A;  1Y7A A;  2XRG A;  4LR8 A;  1KHL A;  1KH7 A;  1EW9 A;  3IDD A;  4LQY A;  2ANH A;  3BDG A;  3TX0 A;  5C66 A;  1N2L A;  4UPI A;  3IGY B;  4KAV A;  4LRB A;  3T00 A;  2W5W A;  3BDH A;  1O99 A;  4LRF A;  3M7V A;  3WAX A;  5KXA A;  3T02 A;  3MK0 A;  3BDF A;  5IJS A;  2GLQ A;  1AJD A;  1AUK A;  2GA3 A;  3WAY A;  3NKO A;  3LXQ A;  4UOR A;  4KJD A;  5GOV A;  3TWZ A;  2W8D A;  1HQA A;  1ELZ A;  3DPC A;  1URA A;  4B56 A;  4LR9 A;  5EGH A;  4CXK A;  3B5Q A;  1EW8 A;  4UPH A;  4UPL A;  4ZG6 A;  1FSU A;  4LR2 A;  3WAV A;  3CMR A;  1KHN A;  2W5S A;  3NVL A;  4N7T A;  3Q3Q A;  5HRT A;  1E33 P;  2D1G A;  2G9Y A;  5INH A;  4FDJ A;  1HJK A;  3NKP A;  4LRA A; 
#chains in the Genus database with same CATH topology
 3MML B;  2PPB A;  4OIN A;  4A3B K;  2E2I A;  1EQJ A;  4GTX A;  1O24 A;  2GSU A;  4CYS A;  4DDQ A;  3S1R K;  4LRC A;  4JK1 A;  2WB1 L;  3BUE A;  4NWJ A;  1WCM C;  3S2H K;  1X31 C;  2FQT A;  3AD7 C;  2PMZ L;  4LRE A;  4GTD A;  2D6F C;  1ALI A;  1KH5 A;  1EI6 A;  1F9N A;  1TWG C;  1WQG A;  1Y1V A;  4A93 C;  4WJ3 M;  2IUC A;  3M4O C;  3SZZ A;  5IYC K;  1URB A;  5M3M K;  3LPX A;  3S16 K;  3L4K A;  2VUM K;  1KHK A;  4UOP A;  3GDZ A;  5IP7 K;  4GTL A;  4LRD A;  4KM8 A;  4GTF A;  3RZD K;  3BP8 C;  3TTG A;  2VUM A;  2E2H C;  4KAS A;  5C3E K;  1TWA A;  1YX2 A;  1ZXO A;  3GTM K;  1VLO A;  3NKQ A;  4OIQ A;  3S1M K;  5DLW A;  1SFO A;  4GTA A;  4GTC A;  2JA6 K;  3PO3 K;  3S15 K;  2R7Z C;  3JST A;  2NVQ K;  1AJA A;  3NKN A;  1XZQ A;  4BLB A;  4AYB L;  1AJC A;  4P5A A;  3H3V D;  3TG0 A;  1DCP A;  2W5R A;  2NVY A;  1TWF C;  3HOY C;  2JA7 C;  3FOE A;  3FKI K;  2EBB A;  3ADA C;  1K7H A;  5GRR A;  2VUM C;  2GAH C;  2W5V A;  1WSR A;  3GTL K;  3A8K A;  1B8J A;  2XRG A;  3WOD A;  5JFE A;  1XXB A;  3IDD A;  2PA8 D;  3G4A A;  1O25 A;  3AQP A;  4LOW A;  5D4D A;  5M5W K;  4C3H C;  3GTP C;  3S1R C;  2PA8 L;  3M7V A;  3WAX A;  3T02 A;  3OPF A;  3MK0 A;  4BY7 K;  5IJS A;  4C2M K;  2GLQ A;  3FKI A;  3WAY A;  4UOR A;  4KJD A;  5GOV A;  1BJT A;  3H0G K;  1ZQ1 C;  3H3V L;  2JA7 A;  1ELZ A;  2NVY C;  3TFH A;  1TWG K;  4CXK A;  1XXC A;  3N3Y A;  5IOS A;  4PAA A;  4ZG6 A;  2FQO A;  2B63 A;  4KAR A;  4C3I K;  1IW7 A;  4A3I K;  2JA6 C;  3PO3 C;  3H0G A;  4KMA A;  3HOZ C;  4G7H A;  3S15 C;  1KHN A;  2JA7 K;  4Y7N C;  2PHC B;  4C45 A;  4BLA A;  5M5X K;  4FDJ A;  4QJV B;  3NKP A;  3FOF A;  5IP9 C;  1DCO A;  2PMZ D;  3GEE A;  5FLM K;  3GTM C;  3GTQ K;  1TWH A;  4A3L C;  3HOW C;  1O27 A;  1J98 A;  1TWG A;  3HXA A;  1I50 K;  3S1N K;  5K4P A;  4YR1 A;  3UN3 A;  3GTP K;  1AJB A;  3GTG C;  1TWA K;  4BY1 C;  3H0G C;  4BBR K;  1USO A;  4KAW X;  5E68 A;  4MEY A;  2IFY A;  1ANI A;  5L0E A;  2R93 A;  1PJ6 A;  3UN5 A;  3GTL C;  4YG2 A;  3K7A C;  1O98 A;  4G7O A;  5L0K A;  4Y52 C;  5C4J C;  1Y6V A;  3RZO C;  5IJQ A;  1YNJ A;  4Y7N K;  2JA5 A;  1ELX A;  2R93 K;  4Q5S A;  4GTZ A;  1E1Z P;  3T01 A;  4MY4 A;  1G51 A;  2ZUF A;  3M8Y A;  4A3L K;  3A8J A;  5LIA A;  2Y0S L;  4GTE A;  1ZEF A;  4J3N A;  4P9S A;  5TMF A;  1TWH K;  4UOO A;  3GTK C;  2IUC B;  1ISE A;  2YU9 A;  3ORE A;  3GTJ C;  4MHX A;  5C44 K;  2V6T A;  1E3C P;  2CFA A;  4G0W A;  2X98 A;  2E2J C;  4KM4 A;  4X6A K;  5DLT A;  2W7V A;  5FJ8 K;  4A3F K;  3S17 K;  4CYR A;  1I50 C;  4GFQ A;  2VQR A;  4FZB A;  4KMD A;  4OIO A;  3GTP A;  1E2S P;  1VH2 A;  1I3Q A;  3AD9 C;  4MEX A;  4NOI A;  4A3I C;  3S2D K;  1HQM A;  3UNY A;  1DD5 A;  3HKZ D;  1ZYR A;  4YFK A;  4A3C C;  4KDD A;  4A3K K;  1SMY A;  3SZY A;  3HOU K;  4A3G K;  2JA8 K;  5IOQ A;  4XSX A;  3GTK A;  4LR8 A;  1I6V A;  1EW9 A;  5M5Y K;  2ANH A;  3BDG A;  3TFJ A;  3VA7 A;  3S16 C;  2W5W A;  3BDH A;  2Y3P A;  1O99 A;  4LRF A;  1R9T K;  1B4B A;  2E2I K;  2JA5 K;  4OIR A;  5KXA A;  1SFO C;  3BDF A;  1VGX A;  1PJ7 A;  1AJD A;  4KMU A;  2Y0S D;  1AUK A;  4P5B A;  1XZP B;  5IYC C;  3CAG A;  1ZVU A;  2NVT C;  4BY1 K;  1O28 A;  2W8D A;  1R9T A;  3RZO K;  3DPC A;  3G4C A;  3GTM A;  4LR9 A;  4KMH A;  3B5Q A;  3K7A K;  4A3M K;  3M4O K;  5L46 A;  2NVX A;  4LR2 A;  1Y1V K;  5C4J K;  4Y52 K;  3NVL A;  4N7T A;  4M1X A;  4A3K C;  2R92 A;  1O2F B;  3GIR A;  4XLP A;  2CFA B;  5INH A;  1IQ0 A;  1V5V A;  1I3Q K;  4QIW L;  3UO0 A;  3GTL A;  4C3J C;  1J6X A;  4X6A C;  3IGZ B;  5LRN A;  2A6E A;  1R9T C;  1C0A A;  4FDI A;  3NKM A;  3GEH A;  5C4X C;  2XCQ A;  4A3D C;  3GTK K;  4CXU A;  4AH6 A;  3GTJ K;  4A3E C;  4G0V A;  4KM9 A;  3HOV K;  1ED9 A;  1KHJ A;  4FM9 A;  5LQQ A;  4KC6 A;  4QIW D;  3IPJ A;  2CW0 A;  2JA5 C;  1K83 C;  4KJG A;  1VJE A;  1ELY A;  1IL2 A;  1KH4 A;  4KAY A;  4KAT A;  1WOS A;  1TWC A;  1SFO K;  4BY7 C;  2XCO A;  3S14 K;  1ALJ A;  1EK8 A;  1ALK A;  3M8Z A;  5EGE A;  1I6H C;  3WBH A;  5LRM A;  2GSN A;  3L4J A;  1JOE A;  3LAP A;  1TWC K;  4RMF A;  2JA8 C;  1IS1 A;  4G7Z A;  2RH6 A;  2B63 K;  3LAJ A;  4NWX A;  4GT9 A;  5AJ9 A;  3V4G A;  2ZKT A;  2XCR B;  5DLV A;  2WAQ D;  1IE0 A;  1ANJ A;  3GTO A;  1KQ4 A;  4PAB A;  2O5I A;  4C2M C;  3N0B A;  4A3B C;  1WOR A;  3UN2 A;  3OEP A;  4WIL A;  3GTQ C;  4WJ4 A;  4XLN A;  3S2H C;  4TN0 A;  1F7U A;  1WQH A;  1O2B A;  1O2A A;  3MK2 A;  4BBR C;  5HL8 A;  4GZY A;  1F93 A;  4A3D K;  2A68 A;  4G0U A;  1SHN A;  2JA6 A;  4A3E K;  3HOV C;  2W5T A;  3S1N C;  4ZG9 A;  4GTW A;  5IP9 K;  2V6U A;  3I4N K;  1HDH A;  5IOT A;  4BXX K;  4LK0 A;  4C3J K;  1F7V A;  3HOW K;  2A6H A;  4A3J C;  3M8W A;  3EQL A;  5IYD K;  3MK1 A;  5C4X K;  3AD8 C;  4GTB A;  1KHL A;  2BE5 A;  3TX0 A;  1Y1W C;  1WOO A;  3NUH A;  1IBA A;  1YNN A;  4KAV A;  4LRB A;  3T00 A;  4UPI A;  1EH1 A;  2ZFZ A;  2R92 K;  4LK1 A;  1USM A;  3M3Y K;  1K83 K;  4XSZ A;  1EQR A;  5C3E C;  4KN4 A;  4A93 K;  1RU0 A;  2GAG C;  1WCM K;  3NKO A;  1BS2 A;  3RZD C;  1TWA C;  3TWZ A;  1O26 A;  3DXJ A;  4LJZ A;  1AB4 A;  2E2H K;  1K83 A;  2NVQ C;  1URA A;  4B56 A;  1XZP A;  4KB2 A;  1TWC C;  4UPL A;  3S14 C;  5IP7 C;  1FSU A;  3TFI A;  3WAV A;  3CMR A;  3Q3Q A;  4A3C K;  5HRT A;  4YFN A;  4BKW A;  1E33 P;  1WCM A;  4ILD A;  2NVX K;  3S1Q K;  4A3G C;  1HJK A;  4YFX A;  4ZGA A;  3PO2 K;  1TWF K;  1Y1W K;  4MQ9 A;  1PJ5 A;  3QX3 A;  3FKI C;  5JVO A;  1JVI A;  1L0W A;  3FHZ A;  2R92 C;  1J6W A;  5IYD C;  4ZG7 A;  3ED4 A;  3GTO C;  5IOR A;  3A52 A;  1BGW A;  1SHQ A;  1JQW A;  2W5Q A;  1B4A A;  4O2D A;  2GSO A;  1XZQ B;  3S1M C;  4LLG A;  4C3H K;  1WQF A;  4GTY A;  3S17 C;  2R7Z K;  3DYC A;  4Q4Z A;  4KB4 A;  1WIH A;  2NVY K;  3CQZ K;  2A69 A;  2YU9 C;  3E2D A;  3BDG B;  4LR7 A;  1ED8 A;  3I4N C;  1EJJ A;  4QAX A;  2V6S A;  3HOX C;  4BXX C;  3HOY K;  4BBS C;  3NKR A;  2ZUE A;  1ZBS A;  5IYB C;  1N2K A;  4ZH4 A;  3N0C A;  2E2H A;  1WOP A;  2W8S A;  1BDF A;  2P5M A;  3HOU C;  2E2I C;  3CQZ A;  5L0B A;  3M3Y C;  2W5X A;  4CXS A;  1KH9 A;  5CHP A;  2JH3 A;  4C3I C;  2R7Z A;  1ALH A;  2QZU A;  1I3Q C;  4UPK A;  4MIV A;  1P49 A;  3OT9 A;  3WAW A;  3I4M K;  3GSI A;  5TMC A;  1EW2 A;  3PO2 C;  3S0X A;  2KWA A;  3BP3 A;  1ZED A;  1TWF A;  1DCH A;  2NVT K;  1Y1V C;  5TJ3 A;  3HOZ K;  3GTO K;  5M3F K;  2NVX C;  3CQZ C;  4A3M C;  3KD8 A;  3GTG K;  1XPP A;  5FLM C;  1HI9 A;  3HOX K;  1J6V A;  1I6H K;  2XR9 A;  1XXA A;  1EFW A;  3GTQ A;  3S1Q C;  1ZEB A;  1Y7A A;  3A8I A;  1KH7 A;  1UV7 A;  4LQY A;  5C66 A;  1VRQ C;  1N2L A;  2RGR A;  3IGY B;  5IYB K;  3GEI A;  3AQO A;  1I50 A;  2WAQ L;  2O5J A;  2B63 C;  3AH5 A;  4OIP A;  2YU9 K;  1O29 A;  2GA3 A;  3LXQ A;  3I4M C;  3HKZ L;  1Y1W A;  2E2J K;  1HQA A;  3GTJ A;  4KN7 A;  2WB1 D;  1GE9 A;  4AYB D;  3ERE D;  4XCH A;  5EGH A;  1TWH C;  2R93 C;  1EW8 A;  4UPH A;  5C44 C;  5CJ9 A;  3S2D C;  4BBS K;  4QJV A;  4A3F C;  2W5S A;  1INN A;  2D1G A;  2G9Y A;  4A3J K;  2P8T A;  1WSV A;  3GTG A;  1YCL A;  4LRA A; 
#chains in the Genus database with same CATH homology
 3UO0 A;  1EQJ A;  4GTX A;  5LRN A;  3IGZ B;  2GSU A;  4CYS A;  4FDI A;  4LRC A;  3NKM A;  4ZG7 A;  3ED4 A;  3A52 A;  4CXU A;  1SHQ A;  1ED9 A;  2W5Q A;  5K4P A;  1KHJ A;  4NWJ A;  4YR1 A;  2GSO A;  3UN3 A;  1AJB A;  4LRE A;  4GTY A;  1ALI A;  5LQQ A;  3DYC A;  4KJG A;  1KH5 A;  1ELY A;  1KH4 A;  2IFY A;  4KAY A;  1ANI A;  1EI6 A;  5L0E A;  3UN5 A;  3E2D A;  3BDG B;  4LR7 A;  2IUC A;  1ALJ A;  3SZZ A;  1ED8 A;  1EJJ A;  1ALK A;  1O98 A;  4QAX A;  1URB A;  3M8Z A;  5EGE A;  3NKR A;  3WBH A;  5L0K A;  1Y6V A;  5LRM A;  2GSN A;  1N2K A;  2W8S A;  5IJQ A;  1KHK A;  1ELX A;  4UOP A;  5L0B A;  2W5X A;  4CXS A;  1KH9 A;  4GTZ A;  1E1Z P;  2RH6 A;  3T01 A;  4ZGA A;  1ALH A;  4MY4 A;  2QZU A;  4LRD A;  4UPK A;  4MIV A;  4NWX A;  3M8Y A;  1P49 A;  3OT9 A;  5AJ9 A;  3WAW A;  5LIA A;  2ZKT A;  5DLV A;  1ZEF A;  1ANJ A;  4UOO A;  1EW2 A;  2IUC B;  4MHX A;  3UN2 A;  1ZED A;  3NKQ A;  1E3C P;  2X98 A;  4KM4 A;  4TN0 A;  5DLW A;  5DLT A;  5TJ3 A;  3MK2 A;  4CYR A;  1AJA A;  2VQR A;  1SHN A;  3NKN A;  2W5T A;  1E2S P;  4ZG9 A;  4GTW A;  1AJC A;  3KD8 A;  1HDH A;  3TG0 A;  2W5R A;  3UNY A;  2XR9 A;  1K7H A;  5GRR A;  3SZY A;  2W5V A;  1ZEB A;  3M8W A;  3MK1 A;  1B8J A;  1Y7A A;  2XRG A;  4LR8 A;  1KHL A;  1KH7 A;  1EW9 A;  3IDD A;  4LQY A;  2ANH A;  3BDG A;  3TX0 A;  5C66 A;  1N2L A;  4UPI A;  3IGY B;  4KAV A;  4LRB A;  3T00 A;  2W5W A;  3BDH A;  1O99 A;  4LRF A;  3M7V A;  3WAX A;  5KXA A;  3T02 A;  3MK0 A;  3BDF A;  5IJS A;  2GLQ A;  1AJD A;  1AUK A;  2GA3 A;  3WAY A;  3NKO A;  3LXQ A;  4UOR A;  4KJD A;  5GOV A;  3TWZ A;  2W8D A;  1HQA A;  1ELZ A;  3DPC A;  1URA A;  4B56 A;  4LR9 A;  5EGH A;  4CXK A;  3B5Q A;  1EW8 A;  4UPH A;  4UPL A;  4ZG6 A;  1FSU A;  4LR2 A;  3WAV A;  3CMR A;  1KHN A;  2W5S A;  3NVL A;  4N7T A;  3Q3Q A;  5HRT A;  1E33 P;  2D1G A;  2G9Y A;  5INH A;  4FDJ A;  1HJK A;  3NKP A;  4LRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...