The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
29
|
sequence length |
123
|
structure length |
123
|
Chain Sequence |
MQVWPPINKKKYETLSYLPDLSQEQLLSEVEYLLKNGWVPCLEFETEHGFVYRENNKSPGYYDGRYWTMWKLPMFGCTDATQVLAEVEEAKKAYPQAWIRIIGFDNVRQVQCISFIAYKPEGY
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Lyase
|
| molecule keywords |
RUBISCO (LARGE SUBUNIT)
|
| publication title |
The transition between the open and closed states of rubisco is triggered by the inter-phosphate distance of the bound bisphosphate.
pubmed doi rcsb |
| total genus |
29
|
| structure length |
123
|
| sequence length |
123
|
| ec nomenclature |
ec
4.1.1.39: Ribulose-bisphosphate carboxylase. |
| pdb deposition date | 2000-03-01 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| S | PF00101 | RuBisCO_small | Ribulose bisphosphate carboxylase, small chain |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | 2-Layer Sandwich | Ribulose 1,5 Bisphosphate Carboxylase/Oxygenase | Ribulose bisphosphate carboxylase, small subunit |
#chains in the Genus database with same CATH superfamily 1RLD S; 1RLC S; 1BWV S; 2V63 I; 3AXK S; 1RCO C; 1WDD S; 1BXN I; 1AA1 C; 1UWA C; 1RXO C; 1UW9 C; 1UZD C; 4MKV S; 3ZXW B; 2YBV B; 1SVD M; 1RSC I; 2V69 I; 4F0M B; 1RCX C; 1RBO C; 3AXM S; 1UPM C; 1EJ7 S; 2V67 I; 2V68 I; 1GK8 I; 1UPP I; 4F0H B; 1IR1 S; 4HHH S; 2VDI I; 1UZH C; 3RUB S; 1RBL I; 1AUS S; 4F0K B; 2VDH I; 1IR2 1; 4RUB S; 8RUC I; 1IWA B; 2V6A I; #chains in the Genus database with same CATH topology 2DFX I; 2FHZ A; 1RLD S; 1RLC S; 1BWV S; 2V63 I; 3AXK S; 1RCO C; 1DWU A; 1WDD S; 3ZQJ A; 1BXN I; 1AA1 C; 4REO A; 1UWA C; 1RXO C; 1UW9 C; 1UZD C; 3TG8 A; 4MKV S; 2HW8 A; 3ZXW B; 4QVI A; 2YBV B; 4DFC B; 1SVD M; 1RSC I; 2V69 I; 4F0M B; 1RCX C; 4LQ4 A; 1AD2 A; 1RBO C; 1UPM C; 3AXM S; 1EJ7 S; 2V67 I; 1MZP A; 1I2A A; 2V68 I; 4F9T A; 4QG3 A; 1GK8 I; 1UPP I; 4F0H B; 1IR1 S; 8RUC I; 3UMY A; 4HHH S; 2VDI I; 1UZH C; 3U56 A; 1U63 A; 3RUB S; 1RBL I; 3U4M A; 3FPN A; 1AUS S; 4F0K B; 5DM7 0; 1ZHO A; 2VDH I; 1CJS A; 1IR2 1; 3QOY A; 4RUB S; 5DM6 0; 4QGB A; 1IWA B; 2V6A I; #chains in the Genus database with same CATH homology 1RLD S; 1RLC S; 1BWV S; 2V63 I; 3AXK S; 1RCO C; 1WDD S; 1BXN I; 1AA1 C; 1UWA C; 1RXO C; 1UW9 C; 1UZD C; 4MKV S; 3ZXW B; 2YBV B; 1SVD M; 1RSC I; 2V69 I; 4F0M B; 1RCX C; 1RBO C; 3AXM S; 1UPM C; 1EJ7 S; 2V67 I; 2V68 I; 1GK8 I; 1UPP I; 4F0H B; 1IR1 S; 4HHH S; 2VDI I; 1UZH C; 3RUB S; 1RBL I; 1AUS S; 4F0K B; 2VDH I; 1IR2 1; 4RUB S; 8RUC I; 1IWA B; 2V6A I;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
