1EUDA

Crystal structure of phosphorylated pig heart, gtp-specific succinyl-coa synthetase
Total Genus 113
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
113
sequence length
306
structure length
305
Chain Sequence
CSYTASRKHLYVDKNTKVICQGFTGKQGTFHSQQALEYGTNLVGGTTPGKGGKTHLGLPVFNTVKEAKEQTGATASVIYVPPPFAAAAINEAIDAEVPLVVCITEGIPQQDMVRVKHRLLRQGKTRLIGPNCPGVINPGECKIGIMPGHIHKKGRIGIVSRSGTLTYEAVHQTTQVGLGQSLCVGIGGDPFNGTDFTDCLEIFLNDPATEGIILIGEIGGNAEENAAEFLKQHNSGPKSKPVVSFIAGLTAPPGRRMGAGAIIAGGKGGAKEKITALQSAGVVVSMSPAQLGTTIYKEFEKRKML
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUCCINYL-COA SYNTHETASE, ALPHA CHAIN
publication title Phosphorylated and dephosphorylated structures of pig heart, GTP-specific succinyl-CoA synthetase.
pubmed doi rcsb
source organism Sus scrofa
molecule tags Ligase
total genus 113
structure length 305
sequence length 306
ec nomenclature ec 6.2.1.4: Succinate--CoA ligase (GDP-forming).
pdb deposition date 2000-04-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00549 Ligase_CoA CoA-ligase
A PF02629 CoA_binding CoA binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 1eudA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1eudA01
4R5HA 4ND1A 4CLRB 4B79A 1I2BA 3CUKA 3ITKA 1CQIB 3TZKA 1ADGA 5DT9A 1NR7A 2Y0EA 4DLBA 1P1RA 4AICA 3HDQA 2VZ8A 2HSDA 2J3KA 4R68A 4RJTA 4DPLA 1LBEA 3JQGA 3GDOA 3HG7A 4IY1A 1Y5MA 5BNIA 3A06A 4BV9A 1E1NA 3D4PA 3BTSA 2X5JO 4MKXA 4RF5A 4W4TA 1AXGA 2UUPA 2O3QA 4OQYA 2OMEA 1JN0A 2EKPA 4EYEA 3DMYA 2GUGA 2NVUA 4D43A 3BZUA 1B26A 2NVUB 1VKOA 1EE2A 2E37A 1KEUA 1T2CA 4I9NA 3ZV6A 3ZW8A 1N8KA 1JTVA 2Y93A 2R2GA 3P19A 4ND2A 3W1VA 3ZWCA 2OOSA 2YQ5A 4YJFB 3JQGB 2BD0A 1DC4A 1JAXA 5IDQA 3Q6IA 2DTDA 3P2OA 1AHHA 5L4LA 4MP8A 2WJPA 4GX1A 1K89A 1FDWA 1JWAB 5F1OA 1LQUA 2X5OA 3RCBA 4YJGA 3QVWA 2C54A 2VWHA 5A5FA 4Y8VA 3B20A 2IEDA 2O3RA 4TROA 4HWKA 2Q1TA 2FSVA 2DC1A 1E3WA 2A9FA 4GVXA 1O5IA 2ZJ1A 2V6BA 3I9OA 5DNAA 1ARZA 1QRRA 4R1NA 1U3WA 2B37A 4O1MA 4E5YA 4Z0TA 1F06A 1ADBA 1R4MB 2BMAA 1YBMA 2Q2QA 3B1KA 5ENDA 4DYDA 4YAIA 3LQFA 4RGBA 1Y8RB 1P33A 3MEQA 1LLDA 2YZ7A 2V6FA 1ZJYA 1NTOA 1KVTA 5LCXA 4BO0A 3F1LA 3CE6A 4H16A 3QQPA 1PTJA 2VHXA 2UAGA 5IDYA 4B3HA 4DL9A 4NMHA 4GKVA 4XRRA 2O23A 2GF2A 1Q2XA 3QRWA 4PLZA 3HNPA 2X9NA 4FBGA 1DIRA 4MIOA 2AEMA 1IE3A 4RZIA 4R9RA 4DQUA 1AE1A 1JLLB 1VPDA 3WGHA 1M66A 1UP4A 3JV7A 2B4TO 4XGNA 3ZWYA 1O95A 1PJCA 4GKBA 2GSDA 2OZPA 1Q7BA 2AHRA 2BFPA 4UUNA 3DO5A 1GV0A 2C2XA 2YFHA 1JVBA 1LRLA 3ZHYA 2BI8A 3Q9UA 1C0LA 1Q0LA 5EIOA 1V6AA 3RKUA 4ZRMA 1PL8A 3RAJA 4J4TA 1HZJA 1RPNA 4KTVE 3MOIA 3LLVA 2UYYA 4K6FA 1TA4A 4R54A 2C82A 5ILGA 1U7HA 2HLPA 3SBOA 5KKCA 4W99A 4UEOA 4IDAA 2VUTA 1ZXLA 1BW9A 1U5CA 4ITUA 4J1TA 5DN9A 5F5NA 2PV7A 5BSFA 1M67A 1EVZA 1R15A 1AN9A 3GLQA 4TSKA 3FTPA 4B8WA 2FR0A 2HK8A 1E6UA 2AG5A 4BQRA 5JLAA 4OQZA 1HE3A 4XR9A 4EITA 2HKIA 4B4UA 3PYXA 5I9MA 4CR7A 1ZO8A 4N5LA 4UVIA 3VH1A 5JE8A 4GWGA 1U28A 1W4ZA 5JBIA 1LUAA 4FJ1A 1E7WA 1H0KA 1E7YA 3EVTA 1ZKMA 3FBGA 4U6SA 1JKIA 3SC4A 1PGNA 5ER9A 4TMFA 1KIFA 1WXDA 1T26A 5A04A 4EEXA 1C3VA 2YJZA 4GL4A 1NVTA 1T25A 4MVJM 1N5DA 2OBNA 2AEJA 2DVMA 5DCUA 1MLDA 2QYSA 2PZJA 4FPXA 3GQVA 9LDBA 1H6DA 4L9RA 3TJRA 5IJZA 4J1NA 3WGTA 3NX4A 2G17A 4XJTA 1KC3A 1N1EA 4GGPA 4NG5A 1NAIA 3AM5A 4WECA 5IXYA 1PJ3A 1P0CA 4U8GA 4RF4A 4M1QA 4Y6RA 3M6IA 4E32A 3WIDA 1C1DA 4GMGA 4AJKA 2EW2A 1IULA 5A06A 3ZWVA 1ZK1A 4FFRA 1ZNQO 4RORA 1I10A 1IHXA 3SX2A 1U8FO 1A7AA 4IQ0A 4NBRA 2JJYA 4EUHA 4LMRA 1DB3A 3CH6A 3JQ9A 5T8KC 4CQMB 4DC1A 3H9UA 4B7UA 2P5YA 6LDHA 3OETA 3BMNA 5JO9A 1F14A 1OC2A 2Y1OA 3F4LA 4GAEA 5KOIA 2FZEA 4FOSA 5TX7A 1DC6A 2CMDA 2P9GA 4ALMA 4YT4A 3O8QA 3ZHXA 5JC8A 3RU7A 4EUFA 4NHEA 1OOEA 2Z1MA 3C7AA 3DL2A 3GEDA 1HYHA 4KUGA 2NU6A 2RCYA 5T5QA 2X0NA 3LK7A 1Q0QA 3RC7A 2QG4A 2GN8A 1JWBB 1K5HA 2NWQA 2PZLA 3D4OA 4XR4A 3AY3A 3C24A 3M1AA 3O38A 3P2YA 4D3FA 3T7CA 4OSOA 2TMDA 2VUSA 1MP0A 4A2CA 1XA0A 4FC7A 3E82A 4BVAA 4FFNA 1HDGO 4CMJA 4BNUA 4PLPA 4MKZA 2EXXA 5ER6A 4L4XA 1CYDA 3M2PA 4CLXA 3RVDA 1DIGA 1Z7BA 4PLTA 4OGWA 3IOYA 4YJHA 5TJ9A 4EDFA 3OECA 4FFPA 3OJFA 5AXAA 3DB2A 4Q3NA 2BKAA 3GPIA 3H5NA 4UEKA 3PTZA 1R0LA 4TZKA 2AG8A 3JQ9C 1SAYA 1OC4A 1P77A 3HADA 4NJMB 4GX5A 3X2FA 4F46A 3FR8A 4CMEA 3ICPA 5IXSA 2Y1DA 3SLKA 4LK3A 3LC1O 1LDGA 1G0NA 3UF0A 2DT5A 1PQPA 3KSZO 2XXJA 3GDFA 2I65A 2OBYA 4A10A 2HJRA 2EG9A 1EVIA 1JKJB 1SMKA 4IQGA 2JCVA 4KWHA 3VTZA 4W9NA 3JTMA 5G0VA 4IPTA 4DREA 3OEWA 3LT4A 3LVFO 1DIHA 4N18A 4UUMA 5COQA 2IYOA 2D59A 3GC6A 3WGGA 2R00C 3HSKA 4UVDA 3RBZA 2YDXA 1QLJA 2QZ9A 4AFNA 5A1TA 2JD2A 4FCCA 2GNAA 4YACA 4U0KA 4PRLA 2HCTA 3E6AA 2X4GA 1PGQA 3QW2A 3O03A 4BMVA 4OHUA 1PS9A 1M6HA 2PKRA 4YAKA 2NTNA 3FRJA 4L4SA 2PNFA 2QX7A 4JP3A 5JY1A 2CF5A 3G49A 3ON5A 4DRYA 2GGSA 2UVDA 1LSUA 1QV6A 4CMIA 3UXYA 5KVVA 1ADFA 3D5QA 1ZXBA 3RIHA 4YBZA 1NQ5A 1UAGA 1SBYA 3HN7A 1DEHA 5DP2A 4CLEA 3CXRA 1OFGA 3PI7A 4I5EA 2PZMA 1JAYA 3JQDA 3CEAA 4J9UE 5A3VA 2NU9A 1PGOA 3BMCA 1SOVA 3WOHA 3AUTA 3TRIA 4WLOA 1ZSNA 2NUAB 3DBRB 2Q49A 4IINA 5A5EA 4DGSA 3GG9A 1EQUA 3A9WA 5G0UA 4DIOA 3NT2A 4URFA 1MA0A 2Q1UA 4KUEA 1R0KA 5KJFA 2NU6B 4R5MA 3DC2A 3JD1A 1PJSA 1DC3A 5A4DA 1O89A 4NBWA 4ESOA 1R16A 2X7HA 4BMSA 2NVBA 5JMWA 3OQBA 2PD4A 1U2GA 5L7WA 3A28A 2GD1O 5L40A 2FHSA 2NTVA 3F4BA 3JD3A 4WPGA 3F46A 3FCOA 5FWNA 2H63A 4DPMA 1YDEA 1PWZA 3D0OA 4JLWA 3TNLA 3ONEA 4FR5A 2VYVD 3FNFA 3ULKA 2P5UA 4DUPA 1LLCA 2I3GA 1KBZA 1N92A 2VYND 5I8ZA 4CM4B 2Y1FA 5TSDA 1HWYA 1T1RA 4TVOA 1ZW1A 4AJPA 1V3TA 1GY8A 4NU5A 2H1SA 3ENNA 3Q3CA 4PRKA 1NNUA 4Q3CA 4ZN6A 2IRWA 3HFGA 4U6QA 4JNKA 5CEFA 1GUFA 2AA3A 3TOXA 3B6ZA 4E30A 3AU8A 4PZDA 4BKQA 3DZHA 3MTJA 3E8XA 2PKQO 3FF4A 3VHRA 3QVTA 4B7CA 3B1FA 4DVJA 5C7IO 3GNQA 1I33A 1BRMA 3NGLA 2P9CA 4JJFA 3BHIA 2Y68A 1YS4A 5EESA 3ZN2A 4XQEA 1AUPA 3WJ7A 1AXEA 3RUCA 4WASA 1WP4A 1IZ9A 3GG2A 3OIDA 2FMUA 3PWZA 1SPXA 2CZCA 1TI7A 2SCUA 4FGWA 1I32A 4TRMA 1DFGA 1A4UA 4BOYA 1DPGA 4E12A 4BO4A 2YV3A 3GPDG 2AQKA 3I9MA 4CR6A 4RLSA 4RVGA 4K28A 3RC2A 4G81A 1YJ8A 3DBHA 3VOSA 4BO3A 3WXBA 1HEUA 4S1VA 2CVOA 3TPCA 2B83A 3TF5A 3ROQA 5A3JA 5ITVA 3NJ4A 1DDOA 2E4AA 4PLWA 1UDCA 1VE9A 4ROSA 4RQUA 4F6LA 4GSKA 3WICA 2HAEA 4D44A 1NASA 3ZI0A 5BR7A 2JCYA 2YV2A 1BVRA 1QMGA 5U9CA 2GERA 1MV8A 3W8DA 4P38A 3GF4A 5F1KA 4Z6KA 4HFMA 3GNTA 2BLLA 2PWZA 4I9HA 1DRUA 1E3SA 3O26A 4L0QA 4A03A 1L7EA 3ROPA 5CDYA 2HMVA 4TRRA 2X22A 1V3UA 2RAFA 3CMMA 3H7AA 5A9TA 5I9NA 2PGLA 3GZNA 4JQCA 3VVBA 3NT4A 1UXHA 4CMKA 5GMOA 3RD5A 3JD0A 4YJGB 5JAQA 4UEJA 1GZ4A 3JQ8B 7ADHA 4J4BA 1BSVA 4EI2A 1Y9EA 4E31A 3BTOA 3X2EA 3PQEA 2X5KO 1ZIDA 1N9GB 3GA0A 3CZRA 5U4QA 2PR2A 2Q3EA 2PY6A 1QKIA 1DRWA 4YJDA 2J8ZA 3S1LA 1LC0A 3Q0EA 5AVOA 4Z0PA 3CZMA 3S2GA 5L95A 4HNGA 3ENKA 5H82A 2VWGA 1H94A 3AFMA 3ANNA 3UKOA 2EKQA 2ZB7A 3KXDA 1EFLA 1T2AA 2VHVA 4R1TA 4HX5A 2YV1A 3ZNPA 4R41A 4R1SA 1GUZA 4J16A 1D7OA 2NUAA 1SO8A 3DBRA 1CWUA 3TSCA 1SOWA 5TLSA 4UREA 1Y8RA 2VCYA 3AY7A 4W82A 1WLYA 2IODA 2QW8A 2PH3A 5L45A 1ZH8A 3ASVA 3TZ6A 5JDIA 3ZW9A 1G0OA 2OO5A 3MJTA 4J1QA 1NPDA 3I52A 1D1SA 4A0SA 2LDBA 3H5AA 1FDSA 4EJ6A 2J3IA 4O0LA 2AEFA 3QWIA 2B5VA 4FIZA 4K9DA 1EUDB 3LU1A 4RQTA 1YH3A 1I3KA 2Y1CA 3CKYA 4ZHSA 1E3IA 4RO0A 1YB1A 3FNHA 4IDFA 3N74A 1H9BA 4P8RA 2O48X 1OBFO 3ZU2A 1QYWA 1LX6A 4FD3A 1ULUA 3RROA 1DHTA 1I5RA 1MC4A 1CQJA 3COSA 3ORFA 2Z95A 3Q2IA 3GY0A 2X6TA 1NPYA 2VZ0A 4NNJA 4NDNE 2I3AA 2I67A 4Z9YA 4O63O 1HYGA 2EF1A 5TT0A 3JQAA 3PP8A 3W4KA 3VH4A 4CM9D 1E6EA 3QWAA 3UH1A 4YQZA 5MDHA 3GNSA 1CF2O 1I8TA 2BFAA 5G4LA 3NT5A 4AJHA 4CMAA 1RWBA 5AXDA 1T2DA 1Y8QA 3SXPA 2HMSA 4OO3A 3WNQA 5MGBA 3DOJA 4JK3A 3ZNQA 5KNLA 4XQGA 3UFXA 1ISIA 2OXIA 1DLJA 4BNHA 4J43A 3S2EA 1LI4A 4OMUA 4RPGA 3OH8A 1F8FA 5ES3A 1UP7A 1A9YA 4DXHA 3O8QB 1KERA 5GZ3A 4CLOA 1E6WA 1WDMA 4RZHA 1BXGB 1LDNA 4A73A 4IJKA 3PFWO 4RPJA 3FTNA 2O3JA 3F9IA 4GSLA 4CV3A 4XJSA 4LVCA 4ZQEA 3T4XA 1PJTA 5FI3A 3V2GA 4QSMA 3VZSA 1E3EA 4PIVA 1A9ZA 3VDQA 3NTOA 1ONPA 5H83A 2X9VA 1RM0A 3PJGA 3VPHA 1DC5A 2NU7A 2Z5LA 3E5MA 4B8ZA 1LDEA 3PFFA 4DLAA 4MJLA 5KVSA 4XIYA 4XRGA 5I9LA 5THQA 4CUJA 4L76A 5DF1A 1E92A 4CM9A 1XKQA 1KEWA 4WLNA 5BSGA 3AI1A 4M86A 2PH5A 3VPXA 5L53A 4OAQA 4Y6SA 2PTGA 1NXQA 3KEQA 3KM0A 5EMHA 3BTUA 1N2SA 1ZFNA 3E9MA 4R69A 4ALJA 2NACA 4JJGA 1QYCA 2FSSA 4BNXA 2V6GA 4CV1A 3ASUA 4CQMA 4JX8A 3ZNOA 4BL5A 1GYPA 1MG0A 5KTKA 3WGZA 1NX6A 4PLCA 4FW8A 3L9WA 2J3HA 1KETA 1NHGA 3DBLA 1TT5B 4NBUA 2UDPA 3WMWA 1BMDA 3BHJA 2BRUA 3RUFA 1QXSA 1CDOA 2NU8A 1XHLA 1UDBA 4J7XA 3GN2A 2CDCA 2FOIA 3UVEA 3OMLA 1KYQA 5THKA 1DIAA 3I6IA 2IZ1A 3IDSA 2BELA 4OKNA 5F3RA 4ALLA 2GCGA 4BO7A 4XYBA 3KOUA 3ONFA 3QV1A 3SVTA 1GPDG 5BQFA 2Q4EA 2Y1GA 5CDSA 3KV3O 1R0SA 4IIUA 2J5KA 3IJPA 4RLHA 3AI3A 1P74A 3OIFA 4LVUA 4AJEA 2CNBA 2VRCD 3C1TA 3GMDA 4JXKA 1SEVA 3GVIA 1PJBA 3IJRA 4KP7A 4FB5A 3OJLA 3KHUA 4BKOA 2JFGA 4EUEA 2JKVA 1ZZEA 2VYVA 5BNTA 3DTTA 3G1TA 4ZU3A 4BNYA 3KSDO 4TQGA 3TOZA 3BYZA 1KC1A 2DTEA 1C1XB 3HDJA 3IKTA 4J1SA 4P4LA 2YUTA 4PZEA 5FEUA 4YAGA 1GTMA 1HZZA 3I4CA 5KVQA 3ZWWA 2GASA 3JYQA 3GAZA 2IXAA 3GVCA 2VWQA 3VKVA 5GZ6A 2GZ3A 5ADHA 4D79A 1NFFA 3O9ZA 3L0DA 1IZ0A 2GN4A 3C7DB 3PIDA 2IYPA 4LCEA 5DZSA 1I3MA 4OSPA 3ZWXA 3S8MA 1B8VA 5L4NA 1ISHA 2BGLA 3RI3A 2XPCA 4MP6A 4RV9A 2JHGA 4NQZA 1I36A 4PGFA 2VHYA 1R4NA 3WQSB 3WTBA 4Q3BA 1IB6A 4M8SA 3WSVA 3V8BA 1N1GA 1EDZA 3ZWBA 5JCJD 4CL3A 1XDWA 3QHAA 1HE5A 1R37A 1WWKA 3JQ6A 3H3FA 2A92A 1DAPA 4R3NA 1H2BA 3I6QA 3PHIA 2QYTA 4ZA2A 4F3YA 1GZ6A 3R1IA 1HYEA 4DA9A 1W0CA 2B0JA 4Q39A 1B8UA 4RF2A 1O9BA 1LLQA 1PJ4A 4HV4A 5IN4A 3BXXA 4GQAA 5B4UA 4BB6A 3NAQA 2ZCVA 4GLOA 3RQSA 1IL0A 1ENPA 3R6DA 4HFJA 1GCOA 4CLOB 3FWZA 2B4RO 1LEHA 3RUDA 3GOHA 5HA5A 1Q1NA 3OQ6A 1DFIA 1V35A 2EP7A 4A5OA 1U9JA 4EW6A 3DEYX 1HSZA 4WCDA 1I3NA 5JNLA 1LJ8A 1V3VA 1ONNA 1JVSA 3LZ6A 3NTQA 4QTZA 2FPIB 4JN6B 3WQRA 3HJAA 1P31A 1G6KA 3D1LA 3JYLA 4DLLA 2B4QA 1BHSA 1X1EA 2EW8A 4JBGA 1JKFA 1RKXA 1E3LA 1VM6A 1KVUA 2DFDA 3KZVA 4CUKA 2WD8A 3V1YA 4E21A 4BNWA 5LC1A 2XAAA 1E3WB 1U1IA 1HDCA 1HLDA 3WGYA 3NYWA 4XCVA 4BUCA 4MVJE 3OA0A 1BWSA 1PQWA 5DCYA 1VLLA 3KYDA 4KDEA 4E2YA 1Y81A 2GZ1A 3PGJA 1B3BA 5EL0A 4BO6A 1NFRA 1U4SA 3OHSX 5CAEA 5G2OA 4B4OA 3H9EO 3PJEA 4WKGA 2OHXA 4UULA 4W7IA 3JQAB 4GPD1 3H8VA 4YJFA 4H7PA 5HS4A 1J6UA 4YWJA 5AYVA 3OIGA 3ZNNA 3PQDA 1GEGA 4U0JA 5F5LA 3NDRA 3VKUA 5AXCA 3D5TA 5KWEA 1V9LA 1VJTA 3HDHA 1YBVA 2ZB8A 1ZBQA 3H65A 4LCJA 3ROKA 3VZQA 2X9GA 3V1TC 4YPOA 5L4SA 3E9NA 2FPIA 3W4JA 1DRVA 3D7LA 3GR6A 4RDHA 4Y9DA 3WTCA 1HE4A 2I76A 2AE2A 2CY0A 4J91A 3VAZA 4Z9FA 4QEDA 1WPQA 5IZCC 3FNGA 3I3OA 2WD7B 4BO9A 1KVQA 1Z73A 4ONEA 3RWBA 2E48A 1XSEA 2G82A 2H6EA 3BMQB 4U5QA 5GZ1A 3H5RA 3EZLA 1PQUA 4JBHA 1LTHR 1P0FA 5IZCA 4FFMA 1KVSA 1MUUA 3DBVO 5U1PA 2Q46A 1ENYA 3PDUA 3GZNB 4EJ0A 3UN1A 1BXKA 1LXCA 2YW9A 3HZZA 3KBOA 2RHRA 1IY8A 1VC2A 3BMOB 3A14A 3ZV4A 4LN1A 4BV8A 3NUGA 3DOOA 1U2DA 2Q1SA 2A35A 1NQTA 4WGGA 4CJXA 3GFGA 4D0SA 1Z74A 3SJUA 4PLYA 4KOAA 3BMQA 1YVEI 1P45A 3UAGA 4R9SA 4IM7A 4R3WA 1GUYA 3L6DA 3E1KA 1EFKA 1U8XX 3GVPA 3ZV3A 3VVCA 3GHHA 3G0OA 1NHWA 5JO0A 2I66A 2C59A 1T2FA 3N58A 3QVXA 4AJ2A 2ZYDA 2D5AA 4GLLA 4WEOA 4UVGA 3STHA 2W8ZA 2CFCA 4AJNA 3VZPA 3OEYA 5HM8A 1PL6A 1SCUA 5FFFA 5DBFA 2C07A 5L3ZA 3RUIA 3KETA 2JAPA 4IDEA 2X0IA 1FJHA 3U4DA 2GPTA 4NPCA 1A4IA 3JQCA 1N9GA 4MKRA 4PZCA 3L4SO 1YQDA 4IZIA 3GMSA 5H81A 3ZCXA 3AUSA 3DZIA 1IYZA 4F45A 2DPGA 2ZATA 3DMTA 2A94A 3U4HA 4AG3A 1HE2A 4YT8A 3GEGA 3DR3A 2YHIB 2FWMX 3EMKA 2ZTUA 3UCXA 4EJMA 2OUIA 2Y66A 1ZEJA 2XF8A 2VTEA 5DP1A 2GN9A 1ADCA 3QA9A 2JFHA 4MIYA 3AW9A 3F5SA 1K3TA 4L8VA 4WLEA 5J23A 3RJ5A 1YL7A 3C3XA 4DQXA 3ZU4A 4CMHA 1P1FA 1OMOA 4EZBA 5T57A 1TVEA 4N5NA 1OI7A 3DONA 3NGXA 1NFQA 4II3A 4NJMA 4XWYA 1EUZA 2DBQA 2ZK7A 3ADPA 4LSWA 3ZZNA 3BHMA 4MVJA 2P4QA 3RSHA 1PZEA 3BTVA 1D1TA 4JP2A 1F17A 4W7HA 1LLUA 4LRTB 1XYGA 4YT2A 1NAHA 5B37A 1KS9A 4NJOA 5JS6A 2WE7A 3CMCO 3L4BC 2J5QA 1CIVA 4WE3A 1LU9A 4DC0A 1ML3A 4B3JA 1I30A 1UJMA 3ST7A 3WLFA 1Q7CA 4XKJA 1PS0A 1U5AA 5TJHA 3GT0A 3QP9A 3OP4A 3FI9A 1YE3A 4WUVA 5HRUA 2HO5A 5TIIA 2OGUA 2CUKA 3MZ0A 1SC6A 3FN4A 3DAPA 1ZEMA 4PG8A 1NQAO 4UUPA 3D64A 5TS3A 4OXYA 3AY6A 3IUPA 2AQ8A 3JQBC 4P4NA 3A1NA 2GO1A 3G3EA 3M1LA 4I8XA 2X8LA 1X15A 5DOVA 1DXYA 1XIVA 2PKQP 3K5PA 1GCUA 4RVDA 5A05A 4CV2A 4LRSB 2GLXA 2IEBA 3HFSA 1Y7TA 4K6CA 2QRJA 4MVJP 4CL8A 3VC7A 5A9SB 2FN7A 1LA2A 3BMNB 9LDTA 4ID9A 5AOVA 2BFMA 4C7JA 1CJCA 4ILKA 3EYWA 3JYOA 3DFUA 3K8ZA 1RM3A 2NU7B 2BI7A 5TC4A 1Z7EA 4MVJD 1T4DA 4YRAA 5EINA 1E77A 3C1OA 5C5IA 3TZCA 4Z3DA 2A4KA 3WBFA 5TNXA 5C3MA 2Q1WA 1D3AA 1P9LA 2I6TA 3UW3A 4Y67A 4CR8A 3QY9A 3PPIA 3MJSA 2IZ0A 4IMPA 4YAEA 4NIMA 2Q2VA 4XYEA 1ZMTA 1EUCB 2E49A 4YRBA 3KO8A 4OL9A 3OJEA 5ICMA 4Q3AA 3G79A 4J2HA 1GPJA 1DAOA 2GN6A 3PEFA 1UAYA 1KVRA 4DBZA 8ADHA 3JQ7B 2JD1A 1MXHA 4CODB 2B35A 3MJVA 4KMSA 4W9NC 3GZ4A 1W73A 4FGSA 2FR8A 1M75A 3QVOA 2ZKLA 3IAHA 4ZVVA 1M76A 1ISGA 1WMAA 3INGA 3HUDA 3RFVA 4QO8A 3MJ4A 2DBRA 4BGUA 4IGFA 3VDRA 1WMBA 4GWKA 4D0RA 3IS3A 3I9NA 2X58A 4OOFA 4E4YA 1PX0A 1B7GO 4KWIA 1E0DA 4QFDA 1M2WA 1LC3A 1UZNA 1V8BA 2JFFA 1O94A 4YTEA 3VH3A 3QSGA 1A71A 2X0RA 1HXHA 1U4OA 3Q2KA 1IOLA 2P9EA 3DHYA 4DMMA 3VPGA 3AWDA 1P44A 1ENZA 3JCZA 1KOLA 1PJLA 1XQ1A 4X54A 1GQ2A 4OXNA 4RVSA 4GX0A 1H5QA 2O7QA 1GV1A 1PSDA 1QYVA 3RBVA 3HB5X 4GBJA 3KTDA 3U0BA 3JQBA 5ITWA 2BF7A 4FDAA 3U5TA 2VOJA 3PYMA 2NLOA 3IL2A 3ONDA 2EIHA 2B36A 3PDJA 1YGYA 2D0IA 4OXKA 3BMOA 3V5NA 3JQFC 3SJ7A 4G5HA 1PU2A 1SEPA 3H2ZA 1DO8A 1Q0HA 2AMFA 2W2LA 3AOEA 1ISFA 3EK2A 5IZ4A 4LMPA 3I5MA 1LSSA 3FPCA 4QECA 1WVGA 3WMXA 4CMCA 3KLMX 4DWVA 1HDRA 2FPPB 4RVFA 1VSVA 2WM3A 4HKTA 3RU9A 1PR9A 5CEJA 3HQ4O 2DAPA 4GX2A 1ULSA 2Y0DA 4ND3A 5G4KB 1UXKA 5EQDA 1RYDA 4CM3A 1YRLA 2Q50A 4QO7A 1H6AA 1UDAA 5DCWA 1JQBA 3CTMA 5BT9A 3PXXA 1MXFA 2H9IA 2VQ3A 2D8AA 5G4KA 5ILOA 3Q1LA 4C7KA 3K2EA 3WSWA 4E13A 4NZ9A 4RF3A 1ZK4A 2POQX 1SZJG 1EZ4A 1H93A 3KLPX 4RPKA 3ZHZA 2FPPA 4MVJF 4TVBA 4DBVO 1DOHA 3GEMA 5I7EA 4Z9XA 5CDTA 1X7GA 2O3SA 3AOEC 4I5GA 3L6OO 4MIEA 4CMBA 3VH2A 1PJQA 1LDBA 3MWDA 3Q9NA 1JW9B 2ZQZA 3E5RA 1NYTA 3A4VA 1YJQA 2O4UX 1LNQA 3P5SA 3UGKA 3JD4A 5DULA 3V2HA 1YOVA 3OA2A 4JIGA 1ZMOA 8LDHA 4YDRA 3QJ5A 5CDUA 1P1KA 4ZQBA 1PL7A 4HBGA 4MDHA 5CPFA 3L6EA 3JSAA 4IJVA 1ISJA 3T4EA 1Z82A 4BHTA 2DPHA 2HRBA 1ID1A 3V1UA 2O4CA 4IMRA 4AJ4A 1OAAA 4CV0A 1RJWA 1DFHA 1B8PA 1E5LA 3TFQA 3WGIA 3PWKA 2VHZA 5JDIC 5KJCA 1BG6A 1PWXA 4G2NA 5TF4A 4L73A 1O6ZA 1ZK3A 2OL4A 4TRJA 2EKLA 2GRAA 4P22A 2JAHA 1ENOA 4MOWA 4D42A 3L07A 1X7DA 1XEAA 4FQ8A 4IDCA 4WEQA 4RVHA 1WW8A 1YL6A 2C7GA 1U3UA 4UVHA 5JW6A 4ALKA 3H2SA 3MWEA 5JYDA 1UR5A 2EHDA 1X13A 1T2EA 5F1PA 1CETA 1UH5A 1ZJZA 5CAEB 3H3JA 4FOOA 4BO1A 5A9SA 5I7FA 1I3LA 3ETGA 1GYRA 3KYDB 3NEPX 1GYQA 4J3FA 2ZTVA 4JROA 5AQ1A 3JQ7A 3KEOA 3WX0A 1B16A 4BGEA 1R66A 3RUHA 2R00A 1B15A 1LDMA 2RIRA 1Z75A 1UXIA 2YY7A 4D3DA 3PGXA 2I9PA 1PGPA 1WZEA 5JDCC 2AQHA 2EERA 4II2A 2C0CA 4RL6A 5EN4A 2TMGA 3EHEA 2O2YA 3OBBA 3DAGA 1D8AA 1X14A 2WEKA 3GGPA 1HDOA 3PHGA 3TFOA 5A02A 1B3RA 5KKAA 4XB2A 1YL5A 3GGGA 2X23A 4CLDA 1ZVMA 4QQRA 2G1UA 3N7UA 5G0SA 4BO2A 5AXBA 3B70A 3MCVA 4PG5A 1GU7A 3IP3A 4AJOA 4EBFA 5JMPA 2HJSA 1J4AA 2FZWA 1J5PA 3PHLA 3TDKA 4XEHA 1FMCA 4HADA 1GEEA 3QWFA 2NNLD 4BKUA 4MVJG 3SEFA 4GH5A 4TWRA 4ZQFA 4YR9A 1K6IA 1JU9A 3G1UA 5IF3A 3K92A 3IP1A 1NBOA 2Y99A 1NM5A 2ZB3A 1P3DA 1Y1PA 2G76A 2UV8A 1R4MA 3KRTA 1JDJA 1TB4A 3EVNA 4O59O 4ZICA 3EAGA 4LSMA 4QFCA 1R4NB 4ZQGA 3E48A 4B7XA 3IKVA 3NRCA 5JAIA 5JAZA 2F1KA 3INRA 2AE1A 4WCFB 4YCAA 4CQLB 1UP6A 3BMCB 1ZSYA 3MWDB 3PHHA 2DUUA 5I7SA 2Y67A 2H5LA 3DMTC 5KJ6A 4N54A 1TT5A 2QZZA 4IS3A 1HRDA 1ZK0A 2DM6A 2RH4A 4NK5A 1E7SA 2O3UA 3E9QA 4E5MA 1P1JA 4IXTA 5COBA 1PR3A 3WBBA 1YONA 4M54A 3ZWOA 3OICA 3WGQA 4DPKA 3U09A 1N7GA 4TZTA 1HSOA 4M49A 3V2UA 3PIIA 2JD0A 3SLGA 4QX6A 5G0TA 2HRZA 4E2ZA 4MVJH 3KUXA 3QVSA 4W6ZA 4G65A 5JAMA 2PZKA 1AGNA 4CM1A 4BIIA 4XYMA 1L7DA 4IZHA 5FI5A 5B12A 3RUAA 2WSBA 4PG4A 1XGKA 4M55A 2EEZA 5KJ1A 4E2XA 3NV9A 5JXWA 4IXWA 3WWZA 3R3JA 2EJVA 4JCOA 4BNTA 1VL8A 3QE3A 3I9LA 4E33A 4XZ3A 2D3TA 4K1LA 1LQTA 5ICSA 4CLRA 1SB8A 4KZPA 2YHUA 4I1IA 1GFSA 3K9QO 2ZTMA 4YB8A 5CPBA 3GHYA 4OYRA 2WE8A 4IDBA 2PD3A 3C8MA 4E6PA 1XELA 4IJUA 3S2IA 3GGOA 1EK6A 3HDYA 1Y5RA 1V0JA 2O50A 3C85A 3JD2A 1IUKA 4WK6A 2NSDA 3AM4A 1SNYA 4L75A 2YDYA 4AJJA 4CMIB 2Y1EA 1NVGA 2GZ2A 2Q45A 4YXFA 1GDHA 5T6BA 1E1MA 3WWYA 2NTJA 3PLNA 4FS3A 4XD2A 1B0AA 1E1LA 3ANLA 1N7HA 5JCJA 3BAZA 3UFXB 4QT0A 2IXBA 2JCXA 3WS7A 1DLIA 4AJ1A 4BNIA 2CVZA 2AW5A 2X0JA 1GQQA 4BNGA 4IJWA 1T4BA 4NU6A 1E1KA 3IC5A 1L1FA 3MTGA 4HNHA 2NV6A 1E3JA 1Y6JA 2Q4BA 3CSDA 2OP0A 5DDIP 3ZWPA 4EEZA 4J7CA 3NDIA 1DJNA 2CSUA 3WB9A 4B3IA 3OF2A 1CQIA 4CLHA 2G0TA 1C14A 4S3MA 3UICA 4DTIA 5KVCA 2E82A 3DQPA 3R3SA 4U7WA 2W2KA 4BNJA 2DBVO 1QV7A 1A72A 2P2SA 4FC6A 1FK8A 2UUOA 1DJQA 4KUHA 1TEHA 1UZMA 3OSUA 1H9AA 3RJ9A 1EBFA 2WD7A 2P68A 1H6CA 2VOEA 3H9QA 4XYGA 4EGFA 2I99A 3AUUA 1HETA 5CEEA 2ZYGA 2HMUA 4XA8A 2BHLA 4YVFA 3FD8A 3UOGA 1YXMA 5IDXA 4HFNA 4IDDA 4CPDA 1RYEA 2VT3A 4AVYA 4E5KA 1VRWA 4DYVA 5TQVA 2HMTA 3F6YA 1BDMA 1ZK2A 2VYNA 3KB6A 3TL2A 4CMEC 3QIVA 4ZD6A 3T7EA 3WR5A 1E7QA 1R12A 3AJRA 2EGHA 4L4RA 3ETEA 4CQMD 1UZLA 1X7HA 2CVQA 4R4JA 3TWOA 1JKJA 2YQ4A 4BNZA 3EGOA 3VPSA 2VUUA 1QLHA 1O0SA 5T64A 5EPOA 3U4IA 4CM6A 5KCZA 3TZQA 1LDYA 1I24A 2VRBA 3JQAD 2PLAA 3GRKA 1TLTA 3H9JA 4R1UA 5IN5A 3GH3A 2DLDA 5L7YA 2WWRA 3UCFA 3JYNA 3L9XA 1MGOA 1X0VA 5BNFA 3OFSA 3GN1A 3W6ZA 4TRNA 1S6YA 1GAEO 2DU8A 2VN8A 1ZCJA 3HE3A 4MVJI 2Q99A 3IMFA 3NKLA 3DHNA 3MJCA 2DUWA 3EC7A 5HWSA 4N5MA 4XB1A 3H4VA 4YJHB 3AK4A 4OIMA 2CDAA 3JQFA 4WNCA 4Y98A 4YEDA 3LYLA 1VJ1A 4R01A 1DBVO 1E5QA 1GR0A 1ZSVA 3LC7O 2NM0A 5K0ZA 2VRCA 2ZYAA 3DHEA 1F8GA 4BB5A 3FSRA 1EQ2A 4YAJA 1UUFA 2WDZA 4RVUA 3K31A 4J7UA 2QHXA 2WMDA 4CM8B 3AFNA 1VKNA 5BSEA 3WDSA 4WLUA 3IUSA 5JC1A 5CG2A 1C1XA 3I4FA 1NVMB 1HL3A 4NBTA 3TN7A 4BGVA 4NFYA 3S55A 4J2OA 1DHRA 5K6AC 1YKFA 2Q2WA 4XDYA 3E18A 3PWSA 4ZQHA 1RM4A 2O3TA 3EZYA 2ILTA 3GVHA 3HWRA 1H2HA 4IGEA 5TGDA 1XU7A 4GI2A 1FF9A 4NR0A 2OP1A 3LDHA 1XU9A 4HP8A 5TRTA 2NVWA 4WNIA 3D3WB 1XG5A 2C20A 4O5OA 1HKUA 3DAFA 3O4RA 1LSOA 1WZIA 4IQ8A 2HQ1A 4NK4A 4PLFA 1E7RA 2CF6A 2VZ9A 4Q3DA 3ZHBA 5JDCA 1I01A 1YWGO 1GADO 4PG6A 1VL6A 4HFRA 5EJ2A 1FDUA 1P1IA 4XQ9A 1QSGA 3DZKA 4BQPA 5K9ZA 3KYBA 4RPLA 3W8EA 4M87A 2PGJA 4HUJA 3MWEB 2NQTA 1NWHA 5EERA 4A27A 2IE0A 3UHAA 3C7CB 2VWPA 2RHCA 4E5NA 1WAMA 3FBTA 3F5QA 3QWHA 4WOKA 4E3ZA 1GL3A 4D41A 3KVOA 4ZJUA 5KIAA 1UXGA 4BNKA 1CERA 2P91A 3ZU3A 2WYVA 2ZB4A 3K30A 5C7OO 1U3TA 4FJ2A 4MP3A 1NWCA 4D3SA 2C2YA 3WG9A 1PJ2A 3ROMA 3ZGYA 1KEVA 1PGJA 4J0EA 4PLGA 1IPFA 3U4CA 2HK7A 1AHIA 3OQ1A 4B4VA 5COAA 3DBHB 3DWFA 4RPHA 5CP8A 1PIWA 2PGDA 2CDBA 1OZAA 5C37A 2OORA 1QG6A 1HT0A 3K96A 3RKRA 3GK3A 3GUYA 4BO8A 1K6JA 4MPDA 2FR1A 5GY7A 2FY8A 3I1JA 1LSJA 5FYDA 2SCUB 2W2LD 2J6IA 3JYPA 1K6XA 1FDVA 4I9UA 4OH1A 1JLLA 1F0YA 1BW9B 1R6DA 4R51A 2DKNA 4Z3KA 3DFZA 4BNMA 1SCUB 5CG1A 3U62A 1K0UA 3F1KA 2QQ5A 3Q11A 2D4AA 2EGGA 2O7SA 2EJWA 2I5PO 2PD6A 3DZGA 5JFOA 3EW7A 1G1AA 3LT1A 4XX0B 3GAFA 1XWFA 1FXSA 2O2SA 2B69A 5FF9A 4J49A 1PZGA 4YA6A 1BVUA 1MX3A 2WTBA 5I8WA 1QORA 4D7AA 5K6AA 2Z1NA 2LDXA 3LF2A 2VTDA 3PHJA 3GDGA 1QYXA 5I7VA 1I2CA 3AI2A 1CEQA 3B1JA 2RH8A 1EEHA 2HMWA 2ZJ0A 3ZV5A 3H9GA 1NQOA 4IIVA 4PLHA 3U3XA 4NFHA 1B14A 4BNNA 3IQDB 4ND5A 4BKPA 3OM9A 1NPTO 3ETDA 2EWMA 3RFTA 2HU2A 4XX0A 3K73O 3AUAA 3E03A 1RM5A 5JYEA 4R16A 1HTBA 3M2TA 2FP4B 4YT5A 1BXZA 3PQFA 3FHLA 4P4GA 4JGBA 3I23A 3ZWAA 4E0BA 2GR9A 3ZH2A 3RASA 4KQWA 3BA1A 4D46A 4WLFA 2NQ8A 3HB4X 1PS8A 2R6JA 1P1HA 1YDWA 1QR6A 2FP4A 3WQQA 3WYCA 4DMLA 3KSUA 3R0IA 5JY6A 5DBIA 1EUDA 4M89A 4CMGA 3H6KA 2W2KB 1EVJA 3EDMA 3PVZA 5ENVA 5IDWA 1LRKA 1BGVA 1NR1A 2WYWA 3LSYA 4RDIA 1KEPA 1YOVB 4BS9A 5CDGA 1X1TA 2PA3A 4J4HA 4CM5A 2VNSA 4YQYA 4OKIA 1K2WA 1TT7A 2E6UX 1SB9A 3EUWA 1J49A 3GRPA 2NU9B 1C0KA 4FFLA 5L7TA 4I08A 3W8FA 2YFQA 2Y0CA 2C7VA 4H15A 3PK0A 5KJEA 2QIOA 5L51A 3AOGA 4XQCA 5T67A 5JCXA 5B4TA 1MG5A 5A03A 4XGKA 1YBAA 4OJNA 3K6JA 3FR7A 1ZUD1 1XCBA 3GUCA 1CQJB 1T24A 3L77A 3FNEA 1C0IA 3AU9A 4B4WA 3S2FA 2X1HA 3AM3A 4ZGWA 2DTXA 1Y9AA 2ZTLA 1O8CA 4ND4A 1HDZA 1A7KA 2BGKA 1YQGA 1YO6A 2DFVA 3CIFA 2ZQYA 5BSHA 2WYUA 1C0PA 1WDLA 4GVLA 4CM7A 2VT2A 3F47A 3U9LA 4A7PA 2ZIZA 1YB5A 1E7MA 3OJ0A 4BNFA 4OM8A 1T1SA 3DTYA 3LT2A 1HDXA 1IHYA 4YYZA 3JQ8A 3LF1A 3PZBA 5C7LO 1DSSG 1TXGA 4JJIA 5TT1A 1MB4A 3HHPA 2C5AA 3VZRA 4LISA 3DZBA 2AQIA 1UXJA 4FN4A 3D3WA 4HXYA 4PLVA 5HS6A 2CD9A 1EBUA 3PJDA 4XDZA 4PFJA 1EDOA 4YRDA 3DXFA 5DOZA 2BGMA 2B5WA 1W8DA 4D45A 1QP8A 5DBGA 2ET6A 1MFZA 1VSUA 1WDKA 3SC6A 4PCVA 3ABIA 3EY4A 5EQFA 2PK3A 1U7TA 3ANMA 3DOCA 1FDTA 4OOEA 4TKMA 3CINA 4L74A 3PZRA 1XLTA 4GMFA 3I9JA 4MO2A 3WFIA 4ALNA 3GVXA 4NBVA 3JQEA 2QRLA 4N7RA 4IUYA 4BGIA 2W90A 1MC5A 1LRJA 2EP5A 3C1AA 1H6BA 2D5CA 3RUEA 4BNLA 3NTRA 3FPLA 3I9KA 4XYLA 2NU8B 2FPGB 1GD1O 3WGOA 4BKRA 2FPGA 3ADOA 4AL4A 3K2BA 4NH4A 2JHFA 4XGIA 2X86A 4Q3EA 4H3VA 1EMDA 1CRWG 3TZHA 2V6MA 3QLJA 1S7CA 3UUWA 2HDHA 2V7PA 4FFOA 2W4QA 4IDGA 4BNVA 4PVDA 4DIFA 4ALIA 4Y6PA 1I0ZA 4WCFC 1YQXA 4J9VA 3PRJA 1Q7GA 4K26A 3IIEA 2IDZA 1U3VA 4FJ0A 4AJIA 4E5PA 1ORRA 2FRDA 4KDFA 1B2LA 3PLRA 4LW8A 2OFPA 4DIBA 1VJ0A 2HK9A 5LDHA 3RC1A 1HF3A 1BTOA 1EUCA 4TKLA 4JBIA 3I83A 2PFGA 3LC2O 3UCEA 3L4BA 4J0FA 6ADHA 1WNTA 1VI2A 3W4IA 2D2IA 2DQ4A 4E2WA 3G17A 3GFBA 2JL1A 5JPIA 1KY5A 3DDNA 1DIBA 3INTA 3KYCB 4LGVA 3KYCA 4CM8A 1A27A 2GYYA 3D3EA 4UAGA 4Z0HO 1C1DB 2DBZA 5LDGA 1F12A 2YYYA 1HLPA 4UUOA 3MOGA 1I2ZA 1W6UA 3PYLA 4I5DA 5F21A 3BIOA 4PN3A 3DBLB 1BXGA 4UVEA 1ONOA 2P4HX 2D1YA 1J0XO 1HDYA 3WYBA 5IAAA 2J3JA 4INAA 3FWNA 4WOJA 3WLEA 3ZU5A 4WCFA 4AJLA 4CQLA 4IS2A 2VHWA 3RC9A 1QYDA 4A26A 3VTFA 2RBEA 5JSFA 2XXBA 4WLVA 3ZWNA 1EK5A 3OJOA 3NJ8A 1EVYA 3W6UA 2XOXA 3HN2A 3WJAA 5A9RA 3TL3A 1Z6ZA 4IBOA 5L9AA 1X0XA 1XR3A 2YHIA 1PEDA 3ZWMA 3WYEA 3CPSA 3ZDFA 1D4FA 5HTOA 5CFZA 4KTTE 2VNAA 4GGOA 1MFPA 1ISMA 1XQ6A 1Y8QB 1YB4A 4J90A 1NP3A 2C5EA 4XIJA 1BDBA 4PG7A 1Z45A 3MJEA 7MDHA 3TQHA 2AXQA 3LLSA 4QXMA 5CHEA 5T8KA 4CUZA 4I5FA 2G5CA 4CM4A 1GZ3A 3U49A 3D4NA 4C4OA 1M6WA 3F3SA 5B4VA 1JA9A 1PZFA 4F6CA 2QRKA 5G0WA 3ICCA 3DZFA 3WNVA 4HY3A 4ZRNA 4J6FA 3NDJA 3RFXA 3PJFA 2BH9A 3ITDA 3RBXA 2HUNA 2IZZA 1GQYA 5IG2A 2V65A 3WFJA 4PVCA 4BMNA 4FSHA 5IFLA 1A5ZA 4NFSA 2NADA 3QWBA 1EE9A 2F00A 4Q9NA 4KQXA 2J5RA 2Y05A 4QUKA 4BO5A 2C29D 1PZHA 3P7MA 1VL0A 5B1YA 4NI5A 5HBRA 2EV9A 3DZJA 3LT0A 4O6VA 2ZCUA 2W98A 2GDZA 4MINA 2BFOA 1IPEA 4DQVA 3WIEA 4RCVA 3VPFA 1KY4A 4WJZA
chains in the Genus database with same CATH superfamily
1QRDA 4ND1A 1KEEA 1XUOA 4HLDA 1AKVA 4UHDA 3T52A 3F5FA 3Q6NA 5J3JA 3K9FC 3F7MA 3ITKA 2Q5EA 1XZLA 3TZKA 1ADGA 3WZLA 2KLHA 5DT9A 1VLHA 4DLBA 1RIIA 1P1RA 4FYKA 1Q15A 4M1TA 3KB8A 5FORA 4OI1A 3OC0A 1LBEA 1NW5A 2A9JA 1HKHA 4IY1A 3V7FA 2C03A 3GUZA 5DE3A 3SJBA 4DCNA 3A06A 4MH0R 4OHMA 1WU8A 2G07A 3D4PA 4XFKA 4MKXA 4LYEA 1EINA 3GLTA 4W4TA 3OX2A 4XW2A 2UUPA 2YVQA 4BRZA 3T5TA 1D0SA 1U4NA 2W71A 1JN0A 3T7TA 2E7ZA 3OE5A 2GUGA 4FVTA 5EHGA 1QF7A 3BZUA 2W48A 3AGQA 3F9RA 3MPUA 1KEUA 1W30A 5CUQA 4YRMA 5JSZA 4EMBA 4WGFA 4RMHA 3W2IA 3KXKA 1UFKA 2ZWVA 3P19A 3K0EA 4G41A 4ND2A 4TTIA 5GWXA 2D62A 5IAEA 3W1VA 3R0VA 1L5FA 4O2RA 1BIFA 5LLTA 2WUWE 1GAJA 3G5UA 3L8HA 3R74A 5K0CA 4X1KB 1ECBA 1K8YB 5EMJA 2PUAA 1DC4A 1JAXA 5EWLB 1QE3A 4RABA 1NVBA 2PL5A 4EO9A 4RKYA 5BP7A 5TARA 4MP8A 1IM5A 4LHVA 1JH9A 1V1MB 4MGEA 1R9GA 2X5OA 2MT9A 3G2MA 4JKOA 4QJIA 1E0SA 3AEUB 2C54A 3L40A 3QVWA 4P53A 4URYR 3RCBA 4D2IA 2ZUUA 1QGAA 3QUQA 4GQBA 4I50B 4F86A 2GPNA 3FHCB 7ABPA 3GLIE 3H87A 4GVXA 3LXXA 1AU9A 4TYPA 1N6KA 2EG5A 4G89A 3V4RA 2JS7A 1U7PA 3WDMA 1LK7A 1OKKD 2B37A 4KXQA 4FM9A 5IJWA 2K5UA 4DDMA 4B45A 3V4PB 1R4MB 1TO1E 5E0KB 4FYWA 1IUNA 3AVWA 3C16C 4DYDA 2Q29A 3AILA 2JK0A 4YAIA 2X2PA 2DUMA 1O0CA 2FQWA 2IY8A 2V1UA 2ZUBA 4G0XA 3OQIB 3QQPA 1BMTA 2C92A 2UAGA 4JUDX 2POCA 3AL0C 1DNPA 5AKYA 1RAIA 2J85A 5HF8A 3LGXA 1G9SA 4D96A 3T5AA 4DDKA 2O2IA 2XZLA 3FMVA 1ESCA 5FTWA 1XPJA 1Q2XA 3C6QA 5H80A 5JCPA 1N6PA 5AHKA 1JR3A 3N8NA 1Z4JA 2IY7A 4ESHA 5LXTB 2WY2D 2OO3A 4R9RA 4DQUA 3PNMA 5JS7A 4PYKA 1M66A 1UP4A 2ZUVA 3WGHA 2B4TO 3VYWA 1IOWA 2OILA 1Z7WA 3BD8A 5AM4A 4QLOA 2GSDA 1YR2A 1Q7BA 2NZXA 3OOSA 3CEJA 3ADCA 2GAFA 4A0FA 1ZIXA 3A6EA 3EGIA 2Q3LA 4KBGA 1XV5A 1L7PA 3NTUA 1IXYA 1S01A 4V1CI 1DXHA 2QD2A 3TRHA 1BA2A 2WUGA 3UJDA 4DT1B 1RYBA 1YRHA 2XX3A 3IUEA 2BMDA 4UAJA 2YFHA 4NOMA 5A5GA 3ZHYA 3CCCA 4EHLA 3WK7A 1C0LA 1Q0LA 3FDZA 1JIIA 1WPRA 2Q21A 5JVDB 1PFYA 4DHWA 4QNRA 1G4HA 4J4TA 3MCZA 1RPNA 1FFYA 4D0LB 4WBNF 4MDYA 3OEHA 2QTGA 2UYYA 5A5DA 1CQXA 2E5FA 3TUJC 4DGQA 4RA9B 1U7HA 4DCCA 4LDPA 1KBOA 1CDDA 1FFHA 1SUWA 2FJ0A 4IFBA 1ZD1A 4YNBA 3JAWA 2QLNA 1ZXLA 1U5CA 2BGJA 4O4LB 3MCUA 4GOOD 1TGYA 4L15A 1K4KA 5B7NA 1EVZA 1E2MA 1TK2A 5B7GA 1IEXA 3RIXA 1CB0A 3GT4A 2FR0A 2HK8A 3VU1A 4B8WA 5FYQA 2CUZA 2XECA 4BQRA 4C20A 4OQZA 3EARA 4XR9A 1F8YA 1RXEA 3IYLW 4EITA 2PXXA 2YXNA 4B4UA 5J47A 2R6CA 3PYXA 5FJJA 2IV3A 4WA8A 1ZO8A 2PMDA 4DSAA 4X7RA 4QYIB 5JE8A 4G8CA 1NDHA 2IYEA 5EJMA 5JBIA 1JYFA 1LUAA 4XM2A 3KSBC 3ZG6A 1X7YB 1H0KA 1DJOA 2VYQA 2OHIA 3DAOA 1A98A 1FFBA 3JWEA 2L82A 3OM1A 5E1BA 3S81A 1XMPA 2PUFA 4EG1A 1IQPA 1NNLA 4KLAA 2X8JB 5ER9A 1X8KA 3CUWA 3D4LA 5DMXA 2B8NA 2FFHA 4R6XA 4FHDA 3MK31 2H7YA 1TM7E 2FXVA 4QL3A 1XRSB 2OSBA 5ALEA 2PSFA 2Q2NA 4A2WA 2TSYB 3DZCA 2OBNA 2GRUA 3DOEA 4RJJA 3A37A 5DGXA 1JPJA 1KR2A 4KPYA 1IZYA 1FTNA 4JBNA 1Q91A 4MB0A 2FGKA 2QYSA 4FPXA 3GQVA 1ZI9A 3LO8A 1II0A 4KE7A 2ACVA 4AO6A 4Q0MA 3MT8A 2XE8A 1RBMA 1VLMA 2Z9CA 3EUEA 4Q03A 3CF6R 3SHQA 2NO5A 1ZVKA 3NX4A 1RPZA 1KC3A 4WECA 2HYIC 3OUUA 3U7RA 5A71A 3H8SA 4J3JA 2IY9A 4JWKA 2HA0A 3ENQA 2Q8QA 4Y7CA 2Q5HA 5F2KA 1K7FB 4KQJA 2Q4RA 3V1LA 2BDEA 4RHFA 5EHXA 1QHYA 1IULA 5DHTA 1IU9A 3NBYC 3DDZX 4G1EB 3TSAA 4DBLE 2GAIA 1VBFA 3C5HA 4C4XA 1ZD2P 4F4FA 3SQNA 4IQ0A 1H5UA 2YOFA 2JC3A 4NBRA 5BQ3A 2RAVA 3GROA 1DB3A 2ZSAA 3FUTA 3I2FA 5T8KC 3VR3A 4ZEMA 4NPHA 3GLFB 4TV8F 2B5OA 4PYMA 4B3GA 5JO9A 1OC2A 4JSRA 4RMGA 4QD3A 3IO5A 4FOSA 4ZWNA 3FI0A 4TYNA 4ZI5A 4ALMA 1RHRA 4WNAB 3MT9A 4TV9B 4KXFB 1FTQA 3CYFA 4PAGA 2LCFA 1E9BA 1EK2A 2FFQA 4EUFA 3I5YA 4B0PA 4B48A 2EBUA 2OC4A 4AJ9A 3C7AA 5CYFA 3H84A 1XKTA 2IVFA 1YB7A 2WHPA 4X60A 4KCGA 4DNPA 5ANRB 5T5QA 1BD3A 5E4YA 3DMNA 2GN8A 2OYCA 5REQB 4CI9A 1JWBB 3T54A 1K5HA 2PZLA 2C94A 3LX5A 4F4UA 2I91A 3O38A 4IICA 2XKAA 3IKLA 4TS4A 3T5GA 4FC7A 5HCIA 2XT0A 3BIFA 3FYUA 2GYWA 3T5MA 1JHZA 4FB4A 3LT5A 1IPHA 2ISSD 1N57A 3WI7A 1T6XA 3D7RA 2EFGA 3Q98A 1EFTA 4P3XA 2WUEA 3BPSA 1J07A 2Z83A 2QPTA 2Z58A 1YAHA 3BORA 4TT8A 4JJAA 4OQDA 1KK2A 3OJFA 3ZGVA 3NFYA 2ALJA 3M5WA 1NVEA 3GPIA 2FW9A 4JR1A 4UEKA 4EA6A 1NSYA 2J9FA 3BERA 5FNVB 1NSFA 4X41A 4L9WA 4X6XA 4JI4B 3EC2A 4OAOA 1FZTA 1XZMA 1FUEA 1V3QE 2ERCA 2XUOA 3NKVA 3SR4A 5CB6A 4XUDA 5EIHA 1DBIA 3ICPA 3O8LA 2EBFX 4QDXA 3N2IA 2UZAA 1MEOA 4TTAA 1LVUA 4G09A 3PR2B 5BV1A 4MRVA 1AKWA 1O54A 3UF0A 2QROA 2QV0A 3WL7A 3PC8C 1M2NA 4QGBA 2OBYA 3CCFA 1RWQA 2QT9A 2GEKA 3OTWA 4FLEA 1CR1A 2GVNA 3AKDA 4PV7A 3VTZA 3VNUA 4GC9A 1M8FA 3V1NA 5L3QB 5DXFA 1CTQA 2I2CA 2PLNA 2NIPA 3GC6A 1YA4A 4R31A 4CTOA 3OZDA 4FWBA 3CLUD 5E2AA 2XWBF 1XQVA 3RBZA 2FQQA 3WLRA 3R41A 2P11A 3KQVA 2JD2A 2GNAA 4LXUA 1VFNA 3HLKA 3KT8A 3AHDA 1XCLA 4U0KA 4U39A 4EW2A 1Y80A 4RKQA 4EPTA 1AZTA 1SG6A 4MROA 4HDSB 2YOHA 3LDFA 1NSTA 3FRJA 4L4SA 4QJ5A 4EFLA 1Q0RA 2QX7A 2IS4A 4KR7A 1CUXA 1RPJA 2VT7A 1C9JA 4KB5A 2EFJA 4P2GA 2RHGB 3BGDA 4A0RA 1QFXA 3MVEA 3O2JA 3PL1A 4EB3A 4TKZA 4LWZA 2J33A 3BSWA 4MGYR 4KN6A 4WOPA 3ROEA 4ADSG 1Z34A 2JW5A 4G8DA 1MV5A 4ITRC 3T4PA 4D6YA 3U1BA 4ND8A 1UWVA 3KKMA 1UEJA 3HN7A 2IU3A 1N8SA 2R9VA 1OFGA 2Q5LA 3D7SA 4LDQA 4QODA 2A6PA 3W2TA 4CT4B 1VCNA 1JAYA 2WSLA 2ZQ5A 3JQDA 4W1SA 3BOSA 3UT0A 4C04A 2P35A 4D8UA 5AJTA 3BMCA 3RU2A 3SBEA 1KAEA 1M1XB 3ANSA 1V47A 3AUTA 3MS4A 5IVHA 1DQSA 2CJFA 5JD3A 1P4SA 2PYZA 4HN2A 2WP0A 3PNKA 4IINA 4NAUA 3VYVA 3N2GB 2AEEA 4IIJB 1W8IA 2BSAA 1NJFA 3PDCA 4WN3A 4EY4A 1RYZA 4URFA 1Z5WA 3H4IA 5JNRA 1XZGA 4FEAA 1AGXA 5KJFA 1U81A 3LFUA 2V7QD 3THYA 1JAIA 2FUEA 4XLZA 3VR6A 5DGIA 4X65B 3EIFA 3EXG1 1BFDA 1W5SA 3WWEA 3LTEA 1BGWA 1Z5OA 2BE7A 4ESOA 4ZK2A 4YCBA 3KPUA 3UHOA 2X7HA 2A9OA 3C14C 2FWBA 1U2GA 1RACA 5AVZA 4NBSA 3I76A 3VHLB 1U8UA 3F4BA 4WPGA 5DI9A 1RADA 2RGUA 2VH2A 3F46A 3FCOA 1DX4A 2GHIA 5TB5A 3ZEAA 1ZJJA 3GCXA 5IKXA 5F7XA 3D0OA 4R1LA 2O8VA 1T3SA 2EWVA 2H4YA 2P5UA 4IJ6A 3KR1A 5B58C 1G9TA 1L5ZA 4HUQA 1KBZA 1N92A 1LBIA 1SBIA 1V8OA 2B2NA 4L8YA 3RVRA 2CCKA 3RC8A 1RXCA 1HWYA 1T1RA 3O8OB 2V55B 4ZN6A 2ZYSA 4ON9A 4Q3CA 3HFGA 3L4KA 1YJCA 3ORRA 5K8UA 1FNCA 2VQSA 3BICA 3RJZA 2XTZA 1EBBA 4DR3B 2QRNA 2Z2JA 5IMBA 4E30A 2BUCA 2KBFA 2XVMA 1E63A 4PZDA 1CUCA 4FGZA 1ORVA 4MR7A 3DZHA 3MTJA 3E8XA 2PKQO 1V11B 4B7CA 1TEZA 1E3TA 5C7IO 1Q19A 1XJCA 2NXWA 2VJYA 3IVXA 1E5TA 3DMHA 4JJFA 4OHRA 1QHEA 2OCAA 1ZDMA 3RS9A 1UMCA 3FSEA 2JASA 3ZN2A 4AMUA 4B40A 3KVYA 1AXEA 3PPYA 4HYTA 5DV9A 3RYHB 2IW3A 2O14A 3OQVA 1GLNA 1HO3A 1XZPA 2XBLA 3M6AA 3NTLA 4N41A 5FIUA 1WP4A 3BD6A 4JJ6A 4BBAA 1MC8A 2CZQA 4RWZA 1KP2A 2JGAA 3D7MA 3GA5A 3PKIA 1U0BB 3UJ6A 1TI7A 3LP6A 1MAWA 4J76A 5AJHA 1BDHA 5SY9A 3NMUF 4EHFA 1F51E 4M37A 5EZQA 1T1GA 3RS8A 4KAFA 2H2DA 4WKPA 4G0UA 1M34E 3DULA 4IFTA 2AQKA 2RKOA 1JEDA 1RYYA 1NV9A 4HAUA 5CIWA 3PUHA 3PQ7A 4FGJA 1E1QA 2PL3A 3TW0A 1GNSA 5AKIA 2ZUDA 1LPOA 3MBIA 3OTIA 4I4IA 3WLHA 5JRJA 5HILA 4JCCA 1Z6AA 5IBQA 4MDFA 1OASA 2JB9A 4PSVA 1A2OA 3A31A 3OIYA 1NJ6A 1R0BA 4OFWA 3AHGA 2MU1A 5JASA 2EX0A 4N0MA 5A0FA 2ZSEA 2A57A 4ZV7A 4EP1A 2WAYA 4QXRA 4ZVKA 5B1EA 2ZIXA 3UB4A 2YUIA 4RK6A 1A3CA 4IHJF 3COZA 1PSZA 4GSKA 4N6OA 1J0EA 2G4CA 3CPHA 3M4XA 4KAXA 1NASA 1ZVQA 3ZI0A 1YZNA 1IHDA 2JCYA 2OCGA 3L1JA 4JYCA 1WB9A 1LBQA 4O2AF 5U9CA 1MV8A 2BT4A 5HQ3B 2Y1LA 5AESA 4PPGA 2EQAA 2BTQB 4HFMA 3R7DA 2ZIXB 3TOVA 3GNTA 3I42A 2ODQA 3CUVA 4I9HA 3N59A 4HDRB 1SU6A 3NO4A 1FX1A 3OSZA 3O26A 2BUBA 3ROZA 3KE9A 4BPRA 1KK1A 1QAMA 4P34A 4RLFA 2XKJE 4V0ME 2O20A 2HMVA 4TRRA 5F33A 3GRZA 1LV7A 4TLCA 3BE8A 4DOMA 1CR2A 6YASA 4NCBA 3HO1A 3GZNA 1PYDA 5JAPA 5FA6A 1N6OA 2CLFB 4V0QA 3P4YA 1U0RA 3JD0A 5GMOA 5JAQA 3RD5A 1WS6A 1WZNA 3BS4A 1OROA 3CVOA 4I1RA 4KIWA 7ADHA 1BSVA 4EI2A 2II6A 1E79A 2PPLA 2ZUCA 3PT5A 5EVCA 3RG8A 2CFTA 5U4QA 3CZRA 3L05A 1N3LA 1GAXA 1CQPA 4YJDA 2NNWB 2PUJA 4OQ4A 4X95A 2JKZA 1EEXB 1XAJA 4FXOA 1FZQA 4GXQA 4LXQA 4WRRA 1OFUA 4LJAA 2BBSA 5FPSA 3EUFA 5KYUA 1G63A 5DX8A 5EKSA 3WMFA 1R0XA 1UCFA 4JB3A 2EIXA 1JEQA 1EHIA 2VFAA 3GLSA 2F8SA 4R1TA 4MI9A 1R0ZA 4E5UA 3ZNPA 5HRCA 3X2SA 1ZYUA 4YMHA 3NCHA 1CS0B 4R1SA 2CNNA 1V96A 2PBLA 1D7OA 1SO8A 2NUAA 2JNWA 2RSLA 3DBRA 1SOWA 5CH5A 4UBLA 3TSCA 5TLSA 1DZ3A 1UPUA 4HOYA 2VHTA 1J8FA 4ZVRA 4E6EA 4HH0A 5KOHB 2YOGA 4R05A 4O08A 1Z4OA 2P8JA 4KQKA 4UAVA 1I51A 2Q07A 3FUXA 1C41A 2WTNA 5JDIA 1C9MA 3V34A 2G8NA 4J1QA 2YWCA 5EMMA 3C8UA 3FJ1A 3VR3D 5IVDA 1RQPA 5LR6A 1KI9A 3H5AA 4KDRA 4E11A 3TUZC 3D7KA 4EJ6A 2E1RA 4MV9A 4O0LA 2JHPA 3K0CC 2QTBA 1T3HA 2X15A 5BN3B 3UIEA 2Q5IA 4GOJA 2W2NA 1GQRA 4DTCA 3QWIA 1RAAA 1RW4A 3OLXA 3DKKA 4LY6A 4EGQA 1X1DA 1JPNA 5LVAA 3SS9X 1FFCA 2BEJA 4IEEA 2Y1CA 3MWFA 1E3IA 1KP9A 1R8JA 2YIJA 2I1VB 2XWJI 3FNHA 1XCPA 1W5EA 2P6NA 3GEBA 4Y6LA 4Y7DA 1ULHA 2IOHA 4P8RA 4ZDJA 5DNUA 1I2DA 4URVR 3ZU2A 2EFEB 5EZ5A 2V7VA 3O82A 4MX8A 4R1QA 3OPYI 5FA8A 2VXOA 2ROQA 3L92A 1VPVA 4RWEA 1LWOA 2NTYC 1L4GA 4PYNA 1DAFA 2CCGA 5KX5F 3KE8A 3FHOA 4NNJA 4CWAA 2VZ0A 2HGSA 5J5CA 4UBMA 4IIJA 2I3AA 4O63O 4EY5A 1NOJA 3JQAA 5DM2A 4MPTA 5AWFC 2X76A 2Y2VA 1CF2O 1I8TA 1CJVC 1NR5A 2ZVDA 3KAKA 5E0OA 8AT1A 2QVLA 5BXYA 1E4VA 1FP6A 5AXDA 4BMOB 3GDWA 4HLNA 1SHTX 3IUMA 3WNQA 3DOJA 4L95C 5T3UA 4FYYA 2G5TA 5LSAA 3E3LA 2R84A 1NZDA 3F6CA 2OXIA 2DJ5A 5EHQA 3HU1A 3VZDA 5GIPE 4PFSA 2XD4A 5IXJA 4Z9AA 3OH8A 1H4TA 2E4YA 1MO3A 2RAPA 1MW9X 4EMSA 1A9YA 1KMHA 1Z29A 3CCBA 3PSHA 3BA6A 4YLGA 3OOYA 4NHOA 4Y2QA 4GI3A 2WKQA 1GQSA 1KFBB 1Z6PA 3DT9A 1IG0A 4UXJA 1CKEA 3RFFA 2DHCA 3C6MA 5AH0A 4AZ0A 1S1CA 1ZU5A 2ZT6A 3G89A 2W6OA 5EEGA 3J81k 3FTNA 2O3JA 3CB2A 4ZOBA 4W1PA 2AUNA 4O2BA 4K88A 4XJSA 5HDBB 3V2GA 1PJTA 4KYTA 5JHHB 1K4MA 2QVBA 5KVAA 1A9ZA 1HG1A 2JDIA 4MRMB 2G7MC 3NTOA 2AN9A 2EKZA 1GXSB 1TNDA 2XB6A 3HCWA 1RM0A 3LYAA 3GV0A 3PJGA 3R5KA 4R0VA 2GJ4A 3REOA 1NBME 3OTGA 3ZH9B 2NU7A 2QX4A 2HRQA 3FA2A 3BGWA 1Z17A 3MBOA 1ATIA 3H11A 1LDEA 2IF2A 2JGFA 3MTEA 5ERYA 3BDVA 1WMFA 3LDGA 3D8HA 4YXWA 2IELA 4DLAA 5FPKA 3LDAA 2UUCB 5LU9A 2PBFA 3SWWA 3DMGA 2AG1A 4L76A 3L7DA 1ZLYA 1FBNA 3TLZA 2A59A 1SPBS 1AKNA 4RDCA 4X00A 3MYRA 4RNCA 2FEAA 2F55A 3R9XB 4Y6SA 4V3BA 3E61A 2NPOA 4PO3X 3A9RA 4ITVA 3VDNB 2WJ4A 2NMVA 4PWYA 3DDWA 3UM9A 1XRPA 2WLTA 3NFRA 4HWPA 2A9QA 2V6GA 3O31A 4CV1A 2DFKB 3ASUA 1JZSA 5U4XA 3GLFA 4CQMA 1L4LA 1KH1A 4JX8A 2RHTA 3ZNOA 4BL5A 2HCJB 5INTA 2DJIA 3WGZA 2P78A 5K3FB 4CFSA 3GLFE 2X8JA 3WMEA 4C3UA 3DFKA 3Q87B 4C78A 3FHJA 5MN5A 3EA5A 5D5HA 3UWKA 5BSRA 1WCYA 1GZVA 3EXFB 2UDPA 3UHFA 3BHJA 2BRUA 2WFAA 3VI3B 1URPA 3AJEA 2NU8A 2ZXFA 2O52A 2CFOA 1ZBDA 3SX4A 4DAOA 4QLBA 1RVV1 3JRXA 2CDCA 2FOIA 2F3QA 4G2TA 4HC4A 4OB7A 4YFYA 1CRPA 3NTXA 1M0WA 1BCRA 1NYRA 3ZV7A 1DIAA 2IZ7A 3I6IA 4F5DA 3L02A 3THWA 1FC0A 3IDSA 2IH5A 4C4SA 4ZAXA 4FUTA 1Z4LA 2GCGA 2GZMA 3Q10A 1Y5IA 3AEZA 1WZCA 3QV1A 1VA5A 1LFAA 1AGPA 1R5BA 4ZCLA 3WQHA 1J2UA 3S99A 1WIWA 3KV3O 1CE8B 2JPDA 4IIUA 1C3LA 3OEED 3MMNA 4HDKB 3FOBA 4JQSA 4D99A 1V1RA 5K0BA 1JHUA 5DMHA 4LYFA 2AVNA 2EKBA 2I9KA 1OTYA 1P74A 4B31A 1FSGA 1E1CB 2CNBA 3GX1A 3WWOA 1NIPA 4B3BA 3GCWA 1A9RA 5SZJA 3IJRA 3OJLA 3S7ZA 5C1PA 4UKDA 4GZLA 3QU4A 4JZYA 1SBNE 4K9RA 1DG1G 2OV3A 1TMKA 1KE1A 1K66A 1ZUWA 4BNYA 1L2TA 3KSDO 3TOZA 4IDQA 4JB0A 1K27A 1KC1A 3FBWA 4JI1B 3THOA 3KZXA 2H65A 5KINB 2P6RA 2HTFA 4B5LA 4HYQA 1CG6A 5KX5A 2G9UA 2Z98A 3SIPA 3KJIA 2PVPA 4YAGA 1VPLA 2PMWB 3I4CA 4W7SA 3FCAA 2GKGA 3P9XA 4WXRA 5KVQA 4DWJA 3FOZA 2ZSFA 4QIHA 2EL7A 4B82A 2BTEA 2OHFA 4EW1A 3ND7A 3VA7A 2OCYC 2AR9A 5GZ6A 4I1SA 2PZFA 1E9RA 1CRLA 3NHBA 1P18A 1VMEA 2AJDA 2YY6A 4LQCA 4OUDA 4H7KA 3PIDA 2IYPA 2DMRA 2IIQA 2VSXA 2CJXA 2ZIEA 3IEUA 4OSPA 5JVDF 1ZGHA 4P3OA 1B8VA 1ISHA 2BGLA 1PVDA 3ORSA 2XPCA 4MP6A 3HA7A 4YJ3F 4DR2B 4EG5A 5C35A 4PGFA 3TLJA 3VR1A 1M54A 2OD9A 3KR2A 4M38A 4DMUB 2VHYA 1CUDA 4LF5B 5CA1A 3I1IA 1RP1A 4CKBB 1E64A 1H8HD 2ZSUA 1NW7A 3P9IA 1VRCA 2J0UB 4KQGA 1IB6A 4N48A 1HT3A 2WIAA 3EVAA 3B12A 4NS1A 4TXMA 5LQMA 1G38A 1G8KA 1NYQA 3WIUA 3WDKA 4C0WA 3A4NA 3Q7PA 4D9GA 3QHAA 1OZFA 1P2GA 4F91B 4XI9A 1DAPA 1POWA 1T34A 2Z2IA 5EP3A 1I7SB 3QX3A 4PAQA 1M2FA 1N7JA 1HYEA 5FPYA 4Q39A 2MDTA 4RF2A 3R8XA 1PR1A 1X38A 4HTAA 4I2NA 1Q0TA 3X1KA 3REQB 3DDHA 1RQRA 1I6MA 3A2LA 5PNTA 1C30B 3CLRC 4Z1MD 1H1LB 2PX2A 3RQSA 4DZTA 1IL0A 3F97A 3IAXA 5BPFA 1KEKA 3VJKA 3R6DA 2X4DA 1N1MA 4HFJA 1WBDA 2DY0A 4OYLA 5EVJA 4CLOB 1BD4A 4B2LA 4A36A 5IT4A 2BMWA 4DV2B 5TS2A 1LJUA 4I19A 3GOHA 1YASA 2P9HA 4A5OA 2EP7A 2PX6A 1QTRA 4EW6A 1FFWA 4RLQA 1HSZA 4HS9A 4C7XA 4P0PB 1LJ8A 1P4HA 5A1JA 2J1LA 2ZW9A 3K0HA 1V16B 3BDAA 3DH0A 4BJHB 4H7IA 4YRPA 4YUAA 3JYLA 4DLLA 4MSUA 1BHSA 2EW8A 4WBNA 4JBGA 1ZRNA 1JKFA 4NCIA 1E3LA 1VM6A 4XIGS 4R71A 3JXEA 4Q1FA 2C2BA 1KVUA 2CLHB 2B0CA 5DX1A 2XAAA 1E3WB 3I2HA 1HLDA 5IYZA 3MTQA 5KSWB 4Q6WA 2GWHA 3NBMA 3OA0A 1Q50A 3G6KA 4ZZ2A 3KYDA 2YVLA 1K9VF 4E2YA 2ACEA 1XXHB 3CE9A 4G1CA 4IDOA 2JLWA 5HRAA 2P8SA 4NNPA 5EL0A 3OHSX 2MYUA 2IHYA 2EZ4A 3R3ZA 4KFUA 4KPUB 1KY2A 5G2OA 4C4RA 1YIDA 1Z7YA 3PJEA 1D9XA 3IIKA 1IRXA 5EXDA 4L1KA 3UUEA 1XLWA 1E60A 1ANKA 4GPD1 1R9JA 4Z99A 4QTXA 3UWSA 2YTZA 5FUBA 2IGTA 2WF9A 1DBPA 5TDHA 5AYVA 4LGCA 3OIGA 4TV8B 3TTSA 1GEGA 4PCLA 5ALTA 1QONA 3NDRA 3H8WA 4RANA 5ALDA 5LQSA 3RHTA 3T5DA 2ZB8A 2OXRA 1ZBQA 1QHHA 1Y63A 1NLYA 2OV2A 3H65A 3ROKA 1AQNA 1I94B 1FOEB 1MC1A 1AKUA 1PR0A 1JQAA 3GLVA 2FPIA 1X1BA 4RCYA 3U61B 3GR6A 3STXA 3WTCA 1GDDA 3QELA 4U7FA 4TMTA 3KJNA 3PUJA 2WD7B 5AJYA 2DBYA 1KVQA 1GILA 1N3YA 2FB9A 3PXUA 4JUIA 2G82A 4H9GA 3N75A 4IIHA 3PC4A 4ONEA 4AQDA 4KSYA 1OAOA 1PQUA 1UPAA 2WU8A 1ACMA 1EDDA 1P0FA 3CLTC 5NULA 5J2UB 5U1PA 3FYDA 4TSFA 3O91A 1EK1A 1Q12A 3ITEA 5F2OA 3D6AA 1ORHA 3GZNB 3PDUA 5G02A 4EI9A 1OAOC 3UN1A 2VBFA 1GIAA 1BXKA 3HZZA 2ZPTX 3KBOA 4GZ5A 4UNRA 5LKAA 5DHFA 3OU7A 3FROA 5DIFA 1KGDA 1GPMA 2OK7A 1IY8A 4HO1X 1VC2A 2ZYWX 4HH3C 4O3FA 3A14A 5FI0B 4LN1A 1P6UA 2IHJA 2Q3CA 3FPHA 3GD7A 1HOXA 1U2DA 1XTUA 3IA7A 3PR3A 1Y8ZA 2A35A 4EA9A 3COYA 4CJXA 4BC1A 1HFKA 3PFGA 3DOFA 4KOAA 3BMQA 3CLVA 1OIVA 3EWAA 4OB6A 3KOXA 5J43A 3UAGA 5KU7A 1SXJA 1KDPA 2MIIA 2V45A 1U0GA 4R3WA 1GUYA 2R8EA 2ZI5A 3E1KA 4TQUS 2C0QA 2O7RA 3HBNA 1U8XX 4CNQA 3GT3A 1G55A 3GVPA 3NWEA 4B6SA 3G0OA 5JO0A 1BWPA 4UM5A 4YONB 1DCKA 3KQWA 4GYKA 4N9WA 4US0R 1ZUNA 2D5AA 2NXNA 1JEQB 2JLRA 3KUUA 2ES4A 2QLMA 3JVEA 3E7DA 4GLLA 4UVGA 3WGNA 4AJNA 5CA1F 3VZPA 1CZNA 3E22A 4PO1A 1LZKA 3MWYW 1E2LA 3R5TA 4X6LA 2A1UA 4UARA 3R4CA 5DBFA 5I51A 2GZSA 4MMXB 3AFIA 2JAPA 2XCLA 1HYBA 5IVPA 5J4HA 3TLGB 1AO0A 3RADC 3U4DA 1Z2AA 3RS4A 5CFPA 2IBTA 1JA1A 5AO9A 8OHMA 1I4OA 3AX6A 2WP8J 1XTSA 1OTHA 1M6VA 2RJ3A 4TXJA 2O8BB 1NLUA 2OMKA 4AS2A 2BJVA 2DPGA 4F45A 3RSOA 2CBXA 2UZ4A 2HA7A 2JHCA 2ZIGA 3K3PA 2HPHA 3MQ2A 2WIBA 5KMGB 1GNVA 3HA3A 3R23A 2Y66A 1UMCB 1ZEJA 3EYAA 3K15A 1KJWA 1E1QD 4YRIA 2Z5FA 2ECQA 3D6TB 4LBYA 2JFHA 3PX3A 2GVZC 4ENPA 3QYPA 1A88A 4OFZA 4X1YB 1K3TA 3NWOA 4KO8A 1OWOA 3PNPA 4DR5B 1WB6A 3RJ5A 2EEPA 5AKHA 1L5NA 1KK0A 2JIRA 4G5GA 4C06A 3SIWA 1JG7A 4CMHA 1DPFA 4BYMA 4EZBA 2CL6X 5EIBC 2WNSA 4GI5A 4D6XA 3LTNC 2K87A 3D6MA 4HGRA 1GPYA 4LSWA 4RH0A 1PR5A 3BHMA 2P4QA 3RSHA 4MKFA 3BTVA 1W85A 4GOKA 1H0RA 4JP2A 1KE2A 1PNVA 4RVNA 3RYFA 5B37A 4N0QA 2ZSIA 2ABWA 5BOVA 3VQTA 5DN6A 2QZ4A 4A6PA 5ARDA 3AKEA 4HQ0A 2J7PD 2VPTA 2YWFA 2HSJA 3B89A 3TAUA 3EEBA 1Z16A 1GPWB 2XVZA 4B3JA 1J8DA 1YCDA 3MC1A 1DT5A 2W22A 2Q0QA 2NZVG 3WLFA 2OYSA 4C2TA 3ZGLA 1XF1A 3A3PA 4DJEC 1G21B 3FI9A 4TL8A 3T3EA 4WUVA 3OM0A 2HO5A 2XDQB 1TIKA 5TIIA 3E7FA 3QPCA 2CUKA 1B1AA 1SC6A 1Z0JA 1H8HA 3CZ9A 1D5CA 3DAPA 2RBKA 1ZEMA 3K4PA 4B7AA 4PG8A 1G8AA 2A0XA 4UUPA 2QAGC 1DOZA 1Q3TA 3E4CA 4O4HB 2W0MA 2YHSA 1U6KA 2CWWA 3DDCA 3HCFA 3V32A 5LIRA 1DGQA 4M7RA 3N3AC 3TQIA 4P4NA 1M9NA 1MDFA 1N9KA 3GAAA 3A1NA 1N2CB 2GO1A 3ZCQA 3C8ZA 2ZYUX 3O1JC 5DIZA 5KNDD 4LWQA 3NNDA 1MENA 2FLVA 4Q4JA 1H22A 2A4MA 5A05A 1Y82A 1G5PA 2VH1A 3HFSA 6AT1A 4GQIA 3DWEX 4L0MA 2VJNA 3C7TA 4ZJZA 2BFMA 2C2ZA 2W2VA 1N75A 1I2MA 1NVVQ 3CO5A 4W1QA 1FMFA 3TFWA 4LXTA 4N9QA 3SHOA 4EB8A 4HI0E 4ZI7B 2OCKA 1MJGM 2WHXA 1TU4A 4YRAA 1SXJC 2MSLA 4JLOA 2AD5A 4YO7A 1HDEA 4P84A 5EINA 4KITB 1P0IA 1M5UA 1T0UA 4QQ8A 3SOZA 3V8QA 8MHTA 4OEHA 5EUBA 3FNRA 5FO0A 2Q1WA 1D3AA 3A11A 4K9OA 3MJSA 1T36B 4YAEA 3ZD8A 2Q2VA 1UOQA 4WTOA 1BJRE 4XE5A 4YRBA 2ZRDA 3P20A 4YMUA 3GP8A 5FUXA 1TQ8A 5AUQA 3SNHA 1F6DA 4XJVA 4TV9F 1ZISA 2DUJA 2IYZA 4MWEA 5M04A 1Z8DA 4V0NA 3HEMA 1C4OA 1OX4A 5K99A 1ZJWA 4Q3AA 4RZ2A 2A7XA 2UVPA 4J2HA 1GPJA 2J3EA 1DAOA 3B6EA 2ONYA 3H16A 3TKYA 1KJ8A 4MB6A 4DCSA 3M6UA 3PEFA 1XDGA 2WUFA 2QW1A 4HWOA 3TLYA 2AZDA 5M34A 2ZI9A 2I7XA 3JQ7B 3KL4A 2JD1A 2HTEA 2MHCA 3GRFA 4U2DA 2ZKIA 4ZO7A 3A9VA 1MXHA 5CX4A 1L1RA 2ZJZA 4TTVA 2N75A 3MERA 3RRNA 4C05A 4L3VA 1C3OA 1N5OX 2WYHA 1IONA 1T6NA 1HMYA 1SXJE 1M75A 3FMFA 1ZNYA 1NW8A 3A6LA 2PRSA 1M76A 1ISGA 1WMAA 1ZI8A 2QUHA 3INGA 4K3VA 1X86B 4KXLA 4QO8A 3E2IA 4BFWA 1RRGA 3B1XA 2ZXEA 2FVYA 4FHGA 3F49S 1QE0A 2QZSA 2I7DA 3RRYA 3ZDBA 5IJ9A 4OXQA 4LBZA 2AKAB 4RY0A 3T9FA 3G2OA 3HKBB 3HZRA 1JHOA 2QJRA 1M2VA 1SVOA 3DVAB 4DLZA 3GH1A 1OHHA 2VDLB 5SZIA 4AG5A 4QDJA 1A04A 4UBJA 4EKYA 1ZUNB 3GFRA 4KJXA 3ROGA 4AQYB 4KLCA 1IOLA 1TQDA 1AHNA 3DHYA 4UPDA 2QMZA 3BMXA 3LO5A 4FIDA 1FNMA 3AWDA 4JR0A 3V7NA 3JCZA 1ENZA 2W2PA 3VFDA 1UZAA 4BN5A 1T4CB 1JHXA 4NX2A 5HR5A 4R2KA 3OCVA 1DC7A 1H5QA 1VA4A 1ZIPA 1QO0D 1P0QA 2O7QA 3HR8A 3I6ZA 4QXPA 4TVKA 1SKBA 1XCOA 3HB5X 3CLUC 3JVIA 1ZNWA 3SR3A 3LUAA 4BVFA 1GNRA 4ARSA 2ZROA 3KTDA 3VR6H 4LQ4A 4BBJA 3LQ4A 3U5TA 2BF7A 4FDAA 2VOJA 2JIZD 1FVXA 2BR5A 2BBOA 3LKZA 5AOAA 5K4AA 4CXMA 2B36A 4BLSA 4M36A 1YGYA 3G02A 4B74A 4C7VA 3B9PA 1EFUA 2AOXA 4YDQA 5TPZA 5EY5B 5C80A 4AP5A 3JQFC 3O2NA 3SJ7A 3SJCA 1MNAA 4LOAA 1EAYA 4WZ6A 4AP6A 4ZYWA 1G6OA 3H2ZA 4PSDA 2IHNA 1A82A 2W2LA 3LOPA 3AOEA 5HIMA 2EZUA 4NENB 4KR9A 5KTNA 1V1MA 3PE3A 3E81A 1FNDA 2WZDA 1P60A 3WISA 4Y2JA 2XCRB 1QG0A 4FMPA 3R5XA 4CMCA 1EFRD 1HOTA 3KSRA 1CUSA 4P9NA 1PR9A 5CB4B 3WDLA 5E8JA 4TM7A 1GGEA 3FZNA 3SE0A 5BN1A 3QEMA 4ND3A 1NBAA 3SZRA 5HM6A 5LUAA 2Y4OA 1UXKA 4DMKA 3G0IA 3EW9A 4EMUA 5BNZA 3Q9SA 2FP3A 1H6AA 1Z7GA 4S1OA 1JQBA 3CTMA 3M3PA 1MXFA 4ETWA 2GBLA 3OJXA 4ID3A 2BHRA 2H1HA 2H9IA 2VQ3A 3OZAA 4KKXB 4TXHA 5G4KA 3WYDA 1NC3A 3QEMB 2WB4A 4ZAGA 3N8IA 5ILOA 4KXVA 4KG7A 5EEHA 4NZ9A 3W9UA 5F4BA 3KTFA 2ZAOA 1EZ4A 1H93A 4X90A 3OZEA 4RPKA 2ID8A 4N76A 1Z22A 1Z88A 1PBNA 1DOHA 2FRDC 3GQBA 3MAAC 1KI7A 3PUVA 4II7A 4C3VA 3COPA 3QVGB 2ZBGA 4MUGA 4EATA 5CYGA 1XFDA 3WLLA 3MWDA 3IV9A 1QKKA 2XB9A 4K9MA 3VZCA 2VF2A 1AHPA 5CJJA 1AC5A 2ZQZA 1HC7A 1E1DA 3K6SB 2OO7A 1NYTA 3E5RA 1PQYA 3JWIA 2O4UX 1LNQA 2VL7A 3EXHC 2GCOB 4XOIA 1DQYA 3UGKA 3LS2A 3E3NA 1YOVA 2JLZA 3OA2A 2PJRA 1ZMOA 3INYA 3H1EA 2D1QA 2QXTA 4PX2A 2FSGA 4Q21A 1AMOA 3LHKA 5CPFA 2CKDA 3T4EA 1V41E 2YVUA 4BHTA 3LE8A 5FWDA 2SKEA 4MUBA 4IMRA 4EGCB 1IFXA 4CV0A 1VG9B 1DFHA 3SGLA 4E51A 3AEYA 4JSTA 4MS1A 3TXXA 2OD2A 3ZLBA 4FFVA 3WA6A 1P5FA 4UPEA 3ZI4A 5JDIC 3KOYA 2C9CA 3RV4A 4BQEA 1BG6A 2VZEA 4RKRA 5TF4A 1MO6A 4D57A 3OQMA 1SJ9A 1KYIA 2GRAA 4LS3A 2JAHA 2OV4A 4D42A 5JSQA 1YUMA 5WRFA 1JDNA 4M0CA 1YS7A 1HGXA 1TQHA 1X7DA 1B74A 3FDIA 2PRIA 2DERA 2C7GA 4L5AA 4D97A 5KPDA 3H2SA 3MWEA 3HP4A 1Q14A 3SZUA 1CP2A 2EHDA 1CZLA 2WAAA 1T2EA 4ZZ0A 1CUGA 1UH5A 1JHMA 1WUTA 2Z5VA 1ZJZA 3DTVB 4OD0A 4YCCA 2QP3A 2FMKA 4BO1A 1OZGA 2ZPAA 5CVCA 4QSHA 1XXHA 4BFCA 5I7FA 3ETGA 3S27A 4MCJA 1GYRA 5AW4A 5ECDA 4J3FA 2QAGB 4Y9TA 1WZ2A 2HDOA 3DEKA 1WW2A 4IV0A 1H1DA 3JQ7A 3KEOA 4DFDA 5IWAB 4L8FA 3W5CA 3RUHA 5K0JA 2W8BA 1RWMA 2B1RA 1YTLA 1S3IA 2R00A 3BBPA 4PCUA 1UXIA 2YY7A