1F0PA

Mycobacterium tuberculosis antigen 85b with trehalose
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
284
structure length
284
Chain Sequence
SRPGLPVEYLQVPSPSMGRDIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYSDWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHPQQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKLVANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNGTHSWEYWGAQLNAMKGDLQSSLGAG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTIGEN 85-B
publication title An interfacial mechanism and a class of inhibitors inferred from two crystal structures of the Mycobacterium tuberculosis 30 kDa major secretory protein (Antigen 85B), a mycolyl transferase.
pubmed doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Transferase
total genus 105
structure length 284
sequence length 284
ec nomenclature ec 2.3.1.122: Trehalose O-mycolyltransferase.
pdb deposition date 2000-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00756 Esterase Putative esterase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1f0pA00
4HXFB 3H2KA 5AM4A 3KWFA 2ZSIA 1ZJ4A 1JI3A 3IUMA 2ACKA 1K5PA 4UBNA 1XKLA 4QZVA 2C58A 3WQHA 1XLUA 2WM2A 2GYUA 4A5SA 3WA6A 2BJHA 1I6WA 1UZAA 5HQ3A 3O9MA 4FFVA 4Y2QA 2QOEA 4EY6A 3L1HA 1CUWA 3L1IA 4Q3KA 4ROTA 1GGVA 5DJ5A 4O08A 3I1YA 3M81A 3M3DA 2VA9A 5CH3A 2H1IA 1EDEA 1MX5A 1N5RA 2Z8ZA 3G8YA 1U8EA 3L1JA 4K2AA 1XRQA 2PU7A 3AZOA 4OPMA 3UUEA 3WYNA 4BE9A 1QE3A 2OG1A 3WK9A 5HF8A 1H2YA 1CUFA 2X5XA 5AI4A 5CT6A 4F5ZA 2AJCA 1UFOA 3PE6A 4GWLA 4BVJA 3DLTA 4KE6A 3WK5A 3V1KA 1UK6A 3VJKA 1GZ7A 3O4GA 5A62A 1TRHA 2DHEA 1XRPA 2FX5A 3PF9A 4WY5A 2XMGA 3UMJA 4KRYA 3K6KA 1MAAA 4YASA 4A16A 1UWCA 2PM8A 3WKEA 1EB8A 2X8BA 4Y2PA 2HHAA 2PSFA 3C6BA 1XZGA 1GKLA 4I3FA 2BAGA 1CUXA 2VSQA 4OB7A 1JU4A 3FVTA 1PV1A 1YB6A 3DS8A 4EY4A 2JGKA 4BDSA 1SCKA 1P0MA 1DWPA 1X2BA 1K63A 2OGZA 3I2HA 1JMKC 1WHSA 2C7BA 3G9XA 4BZWA 4C6HA 3E3AA 3DOHA 1UOOA 2VAVA 1CUDA 4ITVA 5IVKA 5A71A 4UBJA 5EGNA 5A6VA 1QIEA 2DCMA 2WTMA 4DYHA 2QM0A 3TEJA 3W05A 1YA4A 1VXRA 3FBWA 4U2FA 2XMQA 3LS2A 4M0MA 1K4YA 1N8SA 1CUAA 5J3JA 4KAAA 2PUHA 1R88A 3QPDA 4P92A 5FDFA 1WB5A 3R3VA 3QBJA 3O4HA 2HA0A 3AIOA 4W1SA 3KD2A 5JD4A 3ED1A 1VOTA 4G4JA 3FLAA 5CRIA 5ALIA 4Y2YA 2B9VA 3I6ZA 3OTQA 1ODTC 5C81A 2QJRA 1H2ZA 3BIXA 5AKKA 4HVTA 3RKSA 3K2IA 4DTCA 4G8DA 4Y2VA 5AM5A 5FPPA 5EIAA 2JGMA 4L3WA 1KEZA 1BRTA 4EHBA 4EY5A 4B0OA 4ARBA 3G0DA 3H2JA 2CJPA 2GZSA 3R41A 3N0TA 4HAIA 4QEKA 4B0PA 4BC1A 3R3UA 3N2ZB 2ZYHA 1PJAA 2RHWA 2DHCA 2ZJFA 4C01A 2C5GA 1Q0RA 2E3JA 5AHXA 1HPLA 4OU5A 4QDUA 1VJ5A 2V97A 3WI7A 4C4ZA 2ROQA 4C4XA 5AIAA 4ZGBA 4M0EA 5K5EA 2D0DA 2QUBA 1MT3A 1XRLA 3F98A 3R3ZA 1QO7A 2ZYRA 4H7HA 1QIFA 3WL6A 1QIJA 3WZLA 4FBMA 5A7HA 1XZFA 3C6YA 1B41A 5ALMA 5E4JA 2I03A 2VJCA 2WJ4A 1Y7IA 3KDAA 4F21A 5AKLA 4DIUA 2B20A 4CIBA 4HS9A 5ESRA 4PV7A 1F6WA 4E11A 3IVMA 1IVYA 2OPHA 1FFBA 3JWEA 2WKWA 4V2IA 1VLQA 1D07A 3HI4A 3VXKA 4BCBA 2VEOA 3BF8A 3WWPA 2FJPA 3ZPXA 1C7IA 1C4XA 2YYSA 4H7EA 3PF8A 3NOXA 1XZLA 1CQWA 2VQ6A 3EIOA 1VZ2A 3I6YA 4JYPA 1E5TA 3QMWA 5HFNA 4U2BA 2D5LA 2WIKA 3QH4A 5JD6A 1TCBA 4FNMA 2JEZA 1ZIYA 4AX4A 1A8QA 3H04A 3FYTA 2VF2A 3C8DA 1AZWA 5CURA 2DSNA 4LXHA 4JUIA 1L7QA 3V48A 1OILA 1XKTA 1GT6A 5AI5A 1ACLA 3BF7A 5FV4A 5DNVA 3O0DA 1QIIA 3PDCA 3BXPA 4NZZA 1QIDA 5ISMA 1CUBA 5K3FB 2WHRA 4UHHA 2W6CX 1BEZA 5ALUA 4AN0A 4J0IA 2DHDA 3W9BA 2XUFA 2C0PA 4AB1A 3GUUA 4UBIA 3GELA 1AURA 1XZHA 4BVLA 3DOIA 1NU8A 1XQWA 5AI9A 5EIHA 1FFCA 1X70A 1VE7A 1CEXA 4N5IX 4NS4A 3QZUA 3EQ9A 1LPBB 4FNGA 4QLAA 5AI0A 2FJ0A 4G8CA 2UZ0A 1SFRA 5A7FA 3ILSA 2WJ3A 4L72A 4UUQA 3WLAA 4DNFA 3MUNA 3IBTA 4BCCA 1UKBA 5JAUA 5CH5A 2XUHA 1MU0A 2QXTA 2W22A 5CTAA 3VVMA 3WWEA 5EHQA 4JNCA 2VJDA 1BE0A 4WDRA 1DQZA 2VAXA 3HJUA 2XUGA 5T4EA 4Y2TA 2QXUA 1AQLA 3SK0A 1CUGA 3H0CA 3BJRA 3D3NA 3RM3A 1BROA 4LXGA 2O7VA 2XQJA 5CMLA 5ALNA 3VISA 1J2EA 3DL7A 3C43A 4B85A 2WIJA 1ORWA 2RONA 4J0CA 1QTIA 3KWJA 4A23A 2X76A 3CXUA 1QZ3A 1LPMA 1UK9A 2O2GA 3YASA 4P08A 1DT5A 1LZKA 4X93A 3AINA 1AUOA 5AOCA 2HFKA 2XT0A 4CG2A 1CUIA 4BBZA 4QDTA 4PSDA 4JYMA 4ZI5A 4OD0A 3T4UA 4GEGA 3G9TA 2QR5A 3WL7A 4BRZA 1CUJA 4XX1A 2CUTA 4X91A 2ACEA 3D5EA 3ZI7A 1L7RA 1UOQA 5JANA 3Q8WA 1MX9A 3WK6A 2EDAA 2JGLA 4J7AA 1TQHA 4BCDA 1XZIA 3ICWA 1WPXA 1N1MA 1XZDA 3O4IA 3PFCA 3C45A 4QDOA 1T2NA 2JGIA 2BCEA 4LYDA 3BDVA 3UUFA 5AI8A 4MWSA 3CN7A 1J1IA 4FWBA 3FCYA 4PSUA 3F9CA 1ORVA 2CMFA 4H7FA 4BAGA 1WOMA 5FP0A 2GBGA 2ECFA 2JIDA 4FHZA 1ZD4A 3AFIA 1JJIA 4Z49A 1E89A 4F0JA 2WSLA 2J3DA 5EHZA 1FJ2A 1QGED 4W63A 1WHTA 1YR2A 2K2QB 2BGRA 2XMBA 1RP1A 4DNPA 2Z5GA 2HU7A 3KSRA 4X6XA 4BVKA 4I4CA 3I2IA 2WHPA 3B12A 1CV2A 3HXKA 3WKAA 4J3JA 2HRRA 3H1BA 1ZJ5A 4EA6A 4QLOA 4CCYB 3AILA 4DLNA 5IVHA 5AK4A 1Y7HA 3FSGA 1DINA 4KYVA 4FFWA 4TGLA 3VKFA 3BJMA 2DQYA 2XI4A 3EQ8A 3R3XA 2HIHA 3V1NA 1QFMA 1JKMA 4B9EA 5HF9A 4LIPD 5FRDA 4B84A 5AI6A 1U65A 4OB8A 1R50A 1RWQA 3IURA 1F0PA 2EEPA 5HQ3B 5HCUA 5ALQA 2WTNA 2GBCA 1FFAA 1U4NA 2QVBA 4ZV9A 1ZI9A 1BN6A 1XQVA 2GYWA 4LXIA 3G0GA 2BFNA 2Z8XA 3VJMA 1XZAA 4UBLA 3E4DA 3A70A 2J4FA 4H35A 4U2DA 2H7XA 4J0DA 5HF6A 4FLMA 2XB6A 4Y9SA 3QPAA 4MQMA 1IUOA 4WFJA 3DYIA 5AIBA 1CUCA 2Y6UA 5ALWA 1E66A 1ZGCA 4PNZA 3WL8A 5DYTA 2ZYSA 1XZCA 1R9NA 5ALTA 2Y6VA 5LP1A 5AKEA 4G5XA 4X71A 2YASA 3H1AA 4Q1VA 5ALDA 4RE5A 5CXXA 4AMYA 4X00A 3TRDA 4B83A 5DYYA 1R4ZA 1DX4A 1Z68A 3D59A 1JT2A 3RK4A 5HFAA 5KBYA 5IH7A 5ALGA 3IIIA 4XWGA 4G8BA 2OLEA 3M82A 4ZWNA 1BEEA 4X3CA 5HKAA 3FLEA 3D7RA 3D4LA 3ESDA 1XZJA 5EI5A 1E3QA 1TAHA 4BTLA 4KJXA 3QMVA 4IHAA 1QOZA 1P0IA 4KEAA 4JEIA 3G0CA 4TVKA 2OGTA 1EX9A 1UT6A 3A2LA 2LIPA 4Y2UA 4UHFA 4QDZA 5LLSA 1EDDA 1CLEA 4FLFA 2CEKA 2WILA 3PUIA 2QUAA 4B81A 5LYYA 1W52X 1J06A 1HKHA 4UBKA 2WIGA 5EFZA 2PUJA 4GECA 1A8SA 4BAUA 3ZLVA 4J0HA 4Q3LA 1USWA 3AUKA 4DNOA 3MVEA 1MAHA 1ZOIA 3FYUC 1IUPA 1EXWA 3H2HA 4BP8A 1LPOA 1HDEA 1XRMA 2ZYIA 1PFQA 2OCGA 5JADA 3B3QA 4NVRA 4BAZA 4C88A 3DYVA 4HRYA 3WKBA 3DDUA 3PUHA 4PO3X 1A8UA 2XE4A 1SCQA 1TIBA 3AZPA 3U1TA 1TKRA 3HSSA 5CBKA 1CPYA 5K3BA 2ZJ6A 3GBSA 1JFRA 4CIAA 4MEBA 3CCBA 1BCRA 5FXMA 1F0NA 2XMDA 5ALJA 5JAOA 4HZGA 1JMYA 1LPNA 2QZPA 3FVRA 1OCEA 2C0QA 4QWWA 1M33A 1GKKA 2QTBA 2RAUA 3FNBA 5A7GA 5K3FA 3EF3A 5K3EA 5AM1A 1L7AA 2QMQA 2XUQA 4MJ3A 4CG1A 3W2TA 3WK4A 4WDQA 1OXMA 2I3ZA 1GPLA 1WCYA 4FTWA 2R11A 4WY8A 3PI6A 4B9AA 3QITA 1XLVA 4OYLA 5BV7A 5AICA 1QONA 1O6FA 3I2FA 4J0GA 3ICVA 4DNQA 4WJLA 5DTJA 3O9VA 3E1GA 3FWHA 1EDBA 5LKAA 4EUSA 5JIBA 1VZ3A 1W6RA 4CG3A 2XUPA 3F97A 2ZSHA 2XQIA 5JARA 2BKLA 4MQLA 3IULA 4X92A 5AKZA 3G9ZA 2XUIA 4XVCA 2WG2A 1THGA 4B82A 4Q34A 1UOPA 4X85A 4OUKX 3G7NA 4M0FA 4Q3OA 4WFIA 3GA7A 1WPRA 1YAJA 3BE8A 1MNQA 3RLIA 1XROA 3WK8A 3PFBA 1JJBA 2GBFA 3A2MA 4YPVA 2Y2VA 1YAHA 4EY8A 1QFSA 4KR0A 2C5FA 5JASA 1DWOA 3C5VA 3V9AA 3T52A 5JAPA 3H2IA 5LKRA 4UFPA 4H18A 2Z3WA 2XQGA 1CFJA 1H2WA 4LHEA 1VKHA 2O2IA 5E2IA 4C87A 1AGYA 5IKXA 3WA7A 2PKYX 1LNSA 4Y7DA 4X90A 2OGSA 1SOMA 3F8SA 2WG0A 4HTAA 2VT7A 4OU4A 1KU6A 3JYHA 1A7UA 1HBJA 4GXNA 4Y2XA 1C7JA 3WZMA 1E8MA 2HM7A 1LGYA 5AOBA 4G4IA 2H9YA 2GBIA 5AKXA 1XZEA 1CUUA 1GPNA 2XMRA 1MTZA 4C89A 1RYYA 3FSGD 4KAJA 2B4KA 2OAGA 2OQVA 4MYDA 1FSSA 4K6HA 5YASA 5IVIA 1G42A 1IUNA 3FLBA 1EVQA 4KE9A 4KAFA 2H7CA 2HU5A 5LZ8A 3V1MA 3R0VA 3D0KA 3U0VA 4L0CA 4H7JA 3MUOA 2XQFA 1H23A 1VE6A 3TGLA 1TK3A 3STYA 2BUAA 4U2GA 2HL6A 4CFSA 4DGQA 3LLCA 3C5WP 3VVLA 3WWDA 2WQZA 3DCNA 3STVA 1EK2A 1XQXA 3BIWA 2WU4A 2HU8A 3HRHA 1J07A 5JZBA 4BE4A 5HF5A 3WYDA 3NWOA 4U2EA 4PQEA 2BGNA 1O6GA 3HABA 2XDWA 2CZQA 4PSCA 2V9ZA 1HL7A 2V98A 2OCIA 1CUEA 1ZD5A 1LZLA 3DD5A 1IMJA 1EINA 4AMZA 5BOVA 4RPCA 5CT5A 5KWJA 3QVMA 1EI9A 2G5TA 2OCKA 3WIBA 1N5MA 1MJ5A 4DSAA 3I2KA 2HA4A 5LZ7A 4CCYA 4OSEA 1AKNA 3SC2A 1ZIXA 4MEAA 2WHPB 4IQ4A 1KU0A 3BWXA 3DKKA 3R3WA 2O2HA 4WFKA 4BP9A 1QTRA 2DFPA 5LZ9A 4GI1A 3DNMA 3WWOA 2WFMA 4PF1A 2BUCA 3H19A 2AXEA 4OB6A 4MWTA 4IH4A 3G0IA 2AJDA 1DU4A 5E4TA 5AH0A 5C8XA 2PSJA 1EH5A 4X6UA 4J0JA 2WUGA 4AQDA 4UHBA 1LPPA 1QIKA 1B6GA 2WIFA 2EDCA 5AOAA 4AN1A 1UXOA 1UK7A 3ZLUA 3QMMA 3ANSA 1Q84A 2G63A 5IVDA 1EVEA 2WIDA 3QM1A 2WUEA 1A88A 3ESAA 3FYUB 4KE7A 5ALEA 1XRNA 4W1QA 5C7YA 1CUHA 3ZLTA 3STUA 2VT6A 1LBTA 4YX9A 4K6KA 3W9UA 1YA8A 3VJLA 3HACA 1MPXA 4ZXFA 4GLBA 2VATA 4FKBA 1THTA 2CBGA 4G9EA 3D2AA 1SC9A 3WJ1A 3H2GA 2VTVA 3WIOA 3TJMA 2WG1A 1BN7A 2GYVA 5A2GA 1F8UA 4EB0A 4N5HX 2XUDA 1ZI6A 1LBSA 5CXUA 4AO8A 3EQ7A 1CR6A 5KREA 4ZREA 1DWQA 2YXPX 3OOSA 1QLWA 3WWCA 2WUDA 1CUSA 2HA2A 5ALVA 4FMPA 1TCAA 1S8OA 4X94A 5EHXA 1ZD2P 5D6OA 4FBLA 3WKCA 5LIPA 3WL5A 3D2BA 5ALFA 1XZMA 2PSEA 4X97A 2FUKA 4EY7A 4CI9A 2PPLA 4OYYA 5K3CA 3EBLA 3FAKA 1FFEA 1BS9A 2AJBA 5DTIA 2QKYA 3FYUA 3KXPA 4DMHA 3M83A 5AKHA 2JGEA 1MO2A 4HXEB 4FDMA 2AJLI 4LYEA 3MGAA 3V1LA 5I9IA 2RGUA 3G9UA 1MX1A 2VJBA 2WFZA 5I7UA 4S0XA 5LZ2A 1Q83A 2HA7A 3A2NA 5AKGA 4H0CA 1UK8A 1ACJA 5HK8A 1XFDA 2PSHA 2V96A 1EA5A 4H7IA 4UHEA 1Q0ZA 1WM1A 5T4BA 3I6MA 3VDXA 3HLKA 2XUJA 1ODCA 3F96A 4N8SA 2WJ6A 5K3DA 4YK7A 1QJ4A 5ALKA 3WKDA 2ZVDA 2ONCA 7YASA 4LKOA 5CW2A 3C8HA 3QPCA 4QNNA 1MNAA 4INZA 2VJAA 5K3AA 1IZ7A 3R40A 1CRLA 1YB7A 1MN6A 4GW3A 4RE6A 5DNUA 4W1RA 3ZV7A 2HA3A 2HRQA 4H7KA 5BWCA 3IUQA 1EK1A 4UBOA 4UHCA 5HZGA 3I28A 2WUFA 2PSDA 1R1DA 3OC0A 1P0QA 2CKMA 4QWMA 2WHQA 2H7YA 4G9GA 5AP9A 3DL4A 2DR0A 2XMCA 5CT4A 5D7BA 4HRXA 4H77A 3SWWA 3S8YA 3HYSA 2XMSA 1XLWA 4BYMA 4GHWA 3K9BA 1WB6A 4ARAA 5DWDA 4DM7A 3AIKA 2DQZA 2PX6A 1YSCA 5DLPA 3DQZA 1ODSA 4QA9A 2I3DA 2WLSA 3PICA 2QJWA 4P93A 1K6EA 2QRUA 2XUOA 3ESBA 3STXA 4AXBA 3DKRA 5JD5A 1XQYA 1QO9A 5LZ5A 3LCRA 3RARA 5AKIA 1DTEA 4EBBA 4X95A 4GBGA 4PW0A 5AO9A 5C8ZA 4RNCA 2XLCA 1IZ8A 4DMCA 2NW6A 2WFLB 4NMWA 5SYMA 4IO0A 4QE3A 3IA2A 1EHYA 3QYJA 2XUAA 3JW8A 1CQZA 4GDMA 4UFNA 3OURA 4KACA 1UKAA 1WB4A 1E8NA 4JH0A 4UFOA 2HADA 4Q05A 1CVLA 4P9NA 2PU5A 2PL5A 5H3HA 3GZJA 4Y2SA 3C70A 1W76A 2Y1KA 3CCCA 5ALXA 3H17A 1HLGA 1CUYA 3C6ZA 1CUZA 3IDAA 1ETHA 1XZBA 3I2GA 5JZ9A 1ZGBA 2ZJ7A 2JGFA 3LIIA 4B7ZA 1DQYA 4E15A 4FLEA 1BU8A 5ALOA 4TPKA 1X2EA 5ALLA 5AKJA 2IX9A 2Q0XA 3D2CA 4UBMA 5AK5A 5AM3A 2Y2UA 2J3QA 2QS9A 6YASA 2XQKA 4H7DA 2CB9A 5EIEA 5FUMA 3WK7A 5JALA 3W06A 1LPSA 2ES4A 3WMRA 2JF0A 1UKCA 1EB9A 2P8SA 3FCXA 4E14A 2I78A 3BL8A 1LPAB 2XLBA 1AX9A 2RHTA 1GPKA 2YH2A 5SYNA 3LP5A 3DJYA 3G0BA 3HEAA 5AM2A 1YASA 2XMZA 3NGMA 4Y2RA 1R3DA 2OQIA 3GROA 3OPMA 2HA5A 3FOBA 4AZ0A 4CCWA 1K8QA 3KOOA 3R3YA 4ETWA 2OAEA 3LIPA 4KE8A 5JZSA 2Z3ZA 5T4FA 4WCVA 3AIMA 3E0XA 4IH9A 5E4YA 5LZ4A 4D9JA 5EHNA 1YS1X 2B61A 2ORYA 1W1IA 4UHDA 3STTA 1G5FA 4EZIA 3S2ZA 5AK3A 3ESCA 1HQDA 1CUVA 5FLKA 1LLFA 1SCIA 1ZICA 4AO7A 4IH1A 4L9AA 3SX4A 1G66A 4AO6A 2JGJA 4C4YA 3I1IA 5JAHA 5F4ZA 4Y2JA 2RIPA 4HXGA 4MXDA 5ALPA 1H2XA 4BRSA 1VA5A 3OM8A 3P2MA 1R9MA 4BZZA 1NU6A 2QT9A 4B6GA 5C8VA 4FOLA 4DMKA 5ALRA 3F67A 1VA4A 3NUZA 1QIGA 1BCSA 3I2JA 1Y37A 4BB0A 4J0KA 5FPQA 1DX6A 3WJ2A 1T4MA 1ZD3A 1XRRA 5ALZA 5ALSA 1NX9A 3ANTA 4W1PA 1H22A 3IB3A 5AM0A 5DYWA 2HDWA 3C87A 1U2EA 2J4CA 4N8EA 2AJ8A 4BTVA 5D3KA 1W75A 3H18A 1G4HA 1JU3A 4U2CA 3O4JA 4K6GA 4UPDA 4J03A 4G4GA 1CIJA 4AZ3A 2OCLA 3Q0TA 1DT3A 4RGYA 1W4LA 4XIIA 3O95A 5HKBA 3AJAA 2WU3A 3IUNA 4DSZA 3W04A 5D3ZA 1GQSA 2JBWA 4Q82A 2OXEA 2IITA 2PVSA 5ALYA 2BUBA 3IUJA 5DNWA 4N8DA 4KRXA 2HFJA 1XZKA 3HZOA 5CT8A 1E8DA 3B5EA 1GQRA 2PBLA 3STWA 1VXOA 3AZQA 4BDTA 3A6ZA 2IIVA 3HC7A 5I8PA 2GZRA 4ZRDA 4W9RA 5JATA 3CN9A 2R8BA 1YCDA 5AKYA 1AMNA 2G4LA 4ZV7A 1AC5A 4BC0A 5CH8A 5FOQA 2G5PA 3OG9A 4XJVA 4G1FA 4K5QA 2HA6A 4X7BA 3BDIA 2O7RA 5T4HA 2JEYA 2RI6A 5FKJA 1ZI8A 5AK6A 1TCCA 3G02A 5KWIA 4BATA 2WFLA 2C4HA 1ISPA 4X6YA 5CT9A 3DEAA 1QIMA 2XUKA 3ZWQA 5BWBA 1GXSA 3C6XA 4B80A 1YS2X 4E46A 1JJFA 4I19A 5AJHA 4DMFA 5HK9A 3X3HA 3GFFA 4MYSA 5ALHA 1FFDA 5JYCA 1QIHA 4F60A 4OCZA 4QDXA 1P0PA
chains in the Genus database with same CATH superfamily
4GO1A 1RJFA 3TMYA 2FHSA 3H6GA 3A3OA 3SJ7A 1T4BA 2H63A 3H2KA 1WNTA 4OXQA 3OP1A 3KWFA 2GF2A 2WWHA 3U13A 2LRHA 2EKPA 1J5XA 2P75A 5AVYA 1TM7E 1JI3A 1PL8A 4S1PA 1EFAA 1PLLA 3GGCA 3EXEA 4J7CA 1WSWA 1T9GS 4BXOB 4MV1A 3ZCRA 1AS3A 2JLQA 5FWXB 1QGOA 3DZCA 1MTOA 3LVBA 5C8DA 1PP4A 5FBKA 1XKLA 5HM6A 1C9JA 2OSVA 2Z58A 2JLYA 2PLAA 4KRFA 2ZR8A 5LP6C 3NT2A 1EPUA 1KR5A 4FK8A 4HQFA 2OXTA 3DBVO 5GJVC 2Z1DA 3Q7TA 1QG4A 3WQHA 4QJBA 1XLUA 1BEUB 2GYUA 4ZOCA 4V1CA 3W78A 1JYSA 1IB0A 1P81A 1SQGA 4K9NA 4L0QA 4X7PA 3F5MA 3ZVKA 1SWVA 2CJWA 2PO7A 3GP3A 5K6AA 3P9NA 4FFVA 3JSAA 4DV7B 1I36A 3L1HA 4KH1A 4XARA 5KHLB 3L1IA 5IPFA 4ND4A 5IKEA 4XVQA 3IPXA 3BWCA 4AY3A 3AVVA 1CU1A 2HIGA 1KZYC 2I7DA 5DI9A 3KB8A 3OOJA 3I1YA 3M81A 1IN1A 1Y1SA 3M3DA 3O03A 3GPCA 1MLDA 4NNPA 1YC5A 3QSGA 4ZU3A 5FBLB 4NMHA 1SPBS 2ADOA 4WESA 4YAFA 4NCKA 2HNKA 5FT9A 2CXSA 5D8DA 5FI3A 1KJIA 1VBFA 2Q5QA 3L1JA 4KQGA 4IVRA 4OGLA 3WO1A 1XRQA 4MS4A 2FP4A 2PU7A 5J2TF 2VRCA 4N5DA 1ISGA 2NACA 1M8JA 3KZMA 4GGOA 4JCOA 3N8IA 5TB5A 4ZZ3A 1GQ2A 4DV3B 2DU8A 2OG1A 3UMCA 1UFVA 4O2AF 1X39A 1BX1A 3B8HA 5M3BA 1VRWA 3RHZA 3ROFA 3WGIA 2ON6A 1MD9A 3IQIX 1C5KA 3RIEA 3WLNA 4EW6A 2X5XA 3P9PA 5K4GA 2Z56A 1QGUB 2B7BA 4PYLA 3WGZA 3UFBA 5IZCC 4NBRA 1ZSVA 4DCVA 3OZVA 4F5ZA 1RHJA 2Z1NA 3BIOA 3ZI0A 1UFOA 1KQGA 1D2EA 3UJNA 2Z3VA 1JFSA 1TVEA 3NBQA 3QE9Y 3W8FA 4ALNA 2Q7XA 2CD9A 2Q46A 2ZJ4A 4IHJF 3S7TA 4WX2B 3H6KA 2GAIA 3T3GA 2PKEA 1Z5VA 3NWBA 4GGPA 3VJKA 2JS7A 3O4GA 3OBBA 3NETA 4YJHB 1W36C 1Y8RA 1NJ6A 5J5VA 1YMQA 2DHEA 5SZHB 2SKCA 4XEHA 3EXG2 2CXRA 2UXDB 2QZSA 1HNWB 4F3RA 2COUA 5F73A 1JIVA 5DNAA 2RE8A 5JV5A 4KRYA 4MYTA 3L7YA 1ZH6A 2XD4A 5DSTA 3I01A 4KODA 1DV1A 3ROXA 5KTSA 1UWCA 5G1NA 4BO0A 1KMHA 1V47A 2WY2D 2Z2IA 3WKEA 4PX2A 1VL8A 4JDPA 3E58A 2QAGC 3NIDB 3QOXA 3UMRA 4RTQA 3CF2A 1EB8A 1S8AA 4IZOA 3G88A 2Z4TA 4KK4A 4Y2PA 5AVKA 1E9DA 2Y92A 2HPZA 3JPWA 4KNVA 4KKXB 4QUBA 2R3SA 2J9FA 1G21B 3FOZA 5KNLA 3ZDYB 3HU1A 3SC2B 3IEUA 1P18A 1DEKA 2RAFA 1N5OX 4JEHA 1XZGA 2CDRA 2FSVC 2O2SA 3KPUA 1GKLA 4QHTA 4BNKA 3HKBA 1DBQA 4EG4A 2VSQA 3LPCA 3VC2A 1P72A 4D6PA 1YB6A 1T36B 1QK4A 3RSLA 1G19A 4EY4A 1ZN2A 2VWGA 4MQ4A 2WZCA 2CMHA 4N5NA 5B6JA 1TYZA 2HJSA 4BDSA 1Q77A 2C61A 3KVNA 2CXUA 2BI8A 4ARIA 3M9WA 4RHXA 2NP7A 3WIEA 1E1RD 4TV8F 3PKZA 3TL3A 3Q5GA 1GPYA 1Z4MA 1Y9JA 3MRSA 4XR9A 2QGZA 4CL0A 4L5YA 2E49A 2I87A 2OGZA 5P21A 2HV9A 1W0JD 5FNVB 3UV7A 1GFSA 1OXTA 1PWZA 1WHSA 3KT6A 3OPQA 4MRVA 2WYIA 3FDIA 3S70A 1L4MA 2C7BA 3G9XA 1XX6A 1Z74A 4FDVA 3C7CB 4OI4A 2BYTA 4MW5A 4RVUA 4MKIA 5GADl 1G20E 3CVWA 5DHPA 5SY9A 4BZWA 4C6HA 4PO8A 4B3MB 4KUGA 3E3AA 5HGXA 1OBCA 3P8ZA 3VV3A 1NNLA 5IVKA 1XIVA 1MA3A 4JXZA 4F4CA 2QD1A 3CG4A 4K88A 4QPZA 5EGNA 1QIEA 4EJ2A 3KYCA 4PU0A 2YXBA 3L4BC 3DLCA 4YCLA 1OTHA 1H9BA 1VXRA 3UEOA 1FB5A 1F4LA 1Q3HA 1HH4A 1W4ZA 2FLKA 3LS2A 1E2PA 1AGNA 1E2DA 1NBAA 5AW1A 5FWNA 4FE7A 5JNRA 3AIIA 1N8SA 1TK9A 5AJYA 5LSAA 1ORTA 4B7UA 2A5GA 4GR5A 1FFGA 2PUHA 2GDZA 4WD3A 1YA6A 2NO4A 3AF0A 3PLRA 1JHRA 1WB5A 3Q85A 2X9NA 3X44A 1YDWA 4BL5A 5EJ9A 4QYWA 1MZPA 1UXKA 1BX3A 4DCGA 1R5OA 3VR6A 1WZCA 2B2NA 2O23A 3HL4A 2GMWA 4AY4A 4M8KA 4ZYWA 5FTLA 3FCEA 1FSZA 5GM1A 4EYQA 4XVRA 4QTYA 1IDN1 2HGSA 5CRIA 3ZE2B 1XTZA 2B30A 5ALIA 1SK9A 3MWYW 4BNDB 1KEKA 5CDGA 1X92A 3ELBA 4IIJA 3X1XA 4GL4A 4UAVA 5CVJA 5HPYB 3OTQA 3I53A 4U0KA 4Q48A 4FMCB 2C9MA 3UWSA 2F1JA 3WG9A 9LDBA 3O4FA 1H2ZA 2A0WA 2ASEA 2IXAA 1ZSNA 3JXEA 1I4DD 4YCDA 3R75A 1HDIA 3RKSA 3SM9A 4DLLA 5KYWB 1KFCB 4KPEC 1RZVA 1V71A 1W88B 1HRDA 4PXAA 4DEXA 2QYSA 3EC1A 4NU5A 2XCQA 3MS4A 1P2UA 2X42A 1GLGA 2XVYA 1BRTA 4IJUA 3PQ8A 3HCPA 4G84A 2Q5OA 1WCIA 2CLLB 5G40A 2IWHA 4ARBA 4YGXB 3LWZA 1IN6A 4DLKA 3KNZA 5DCWA 2WKSA 1AQNA 5DMXA 3SDBA 2J9XB 1VYTA 3PXAA 4QEKA 4HOYA 3LFUA 5A05A 3K73O 5CX4A 4BX3A 3P0RA 4NG5A 3HB4X 3MLEA 3H0EA 4H1VA 4V39A 2V6FA 3C6QA 4RH0A 4YRCA 1FUKA 1SU6A 4BNUA 2DHCA 4JODA 1DG9A 3OIUA 4ZMSA 4FGZA 5B7GA 4D3YA 5AMXA 4K6OA 4BKRA 1UZLA 1OLOA 4US1R 4LYAA 4DA6A 4UM9B 4E1BA 2HSWA 3PQFA 4LFCB 2R62A 3HRIA 4ENQA 3W2IA 1W87A 2RGBA 4JBIA 3Q8MA 4G0UA 2JAWA 1GARA 2KHZA 3PX3A 1RAHA 1T0PA 1E3MA 1H6CA 4M0EA 1FMFA 5DBGA 2FMHA 1MT3A 1PNQA 1XRLA 1Y4SA 3F98A 1JDZA 1T3HA 3DO6A 1KE2A 3EMDA 1RWVA 3OLYA 4E4TA 1WHSB 2ZYRA 1AXGA 3IH5A 2NG1A 3VNUA 3SZGA 1HE1C 1EKXA 3MOIA 1KC3A 4H7HA 1QIFA 3SZUA 3WL6A 4EJ6A 3OQIA 2IDMA 1LTKA 5D00A 4FBMA 4YMWA 3M6WA 3UKJA 1JJAA 4DPLA 4TYYA 3CKLA 3FOAA 1B23P 1V11B 1M72A 5IHPA 1AG9A 5ALMA 3KSMA 4LX8A 5JDIA 2VJCA 1Y6GA 2ZIZA 3F4BA 5AD1A 2QV0A 1ZMOA 1YKGA 3R7SA 3ZWMA 2CLDX 3EAGA 4KXUA 1FU4A 2CVOA 3KDAA 3LQRA 3LOPA 1JAHA 4V0SA 1YQUA 2P9QA 3HA7A 1XYVA 4DIUA 2B20A 4UE6A 7REQB 4HS9A 1KI3A 3ZKAA 2WJYA 1NKTA 2O7NA 3CCFA 2HB6A 1F6WA 2WSMA 3JQ8B 4K9SA 1ZJZA 4RXTA 3U3DA 4UVHA 2J46A 1T1SA 3UAZA 1DXHA 4CLOB 4ZIRA 2EAUA 4CIYA 5FTMA 4E4YA 4EVRA 1GA6A 1I0IA 5IKMA 2OPHA 4ECAA 3I9OA 1E4VA 2Z04A 4RS3A 5TMDA 4CM9A 2BL4A 3K0AB 4V2IA 2H9IA 1DUSA 1YL5A 2Q3MA 3G8AA 1TMGE 1VGVA 1D07A 3OX4A 1P1RA 2OC4A 3P9CA 4FZ3A 3RSOA 1FVOA 3E2PA 3WJAA 4BJ5A 3BIFA 4X1KA 1NXQA 2R9VA 3R8CA 1FDSA 3B1VA 3N3BC 4YRMA 2ZPAA 1TGVA 3VXKA 4BCBA 4PTLA 2VEOA 4LJYA 4LRYA 5JS1A 1SCAA 2PUTA 3C7TA 5F21A 4RGQA 4N48A 3O1HB 2A9OA 1V1MB 1PFKA 2ZIXA 2NQ8A 3HXOA 4E07A 5DYGA 1MRSA 5F98A 3AVTA 3CVJA 3H05A 2I0FA 4L8FA 1LKZA 2GN1A 3ZZTA 2ZUVA 3G49A 1C4XA 4XFDA 4DIBA 2A59A 1AHNA 1KZ1A 4H7EA 2GEFA 1ISHA 2OO5A 1XZLA 3LZ6A 4ABYA 2BBOA 3UM9A 2ASVA 5KKNB 4FGSA 5KJ1A 1JAXA 3RBAA 2A5LA 1M0SA 1E5TA 3NXSA 3KEMA 3PGVA 4B1FA 1PSWA 2RGXA 1XD2A 3DZKA 3MLAA 2QG6A 2MR5A 2C2KA 1BVRA 2WK1A 2ZWOA 4ZT2A 3INGA 4BO4A 3QH4A 1EU1A 1G5PA 5MFPA 3BFXA 5KUTA 4BNXA 4DA4A 1KAGA 1GN9A 4FZJA 3WLIA 4AX4A 4Z0TA 3FYTA 3GRYA 3OQMA 1OWMA 1XLTC 1WVIA 3C8DA 1GLVA 1NUAA 1N3LA 1RKXA 4GBJA 4JUIA 5JBNA 2C0CA 4Y0AA 3BTOA 3V48A 3K0BA 4YV2A 5HX7A 3BGDA 1Y0BA 4O8ZA 3UY4A 1PRYA 3EMBA 3ZZNA 4DQUA 2GQ0A 4RTPA 1MUUA 1R3UA 2H2HA 1ZM9A 3KVRA 1FP7A 2HSGA 1Z4KA 2CFOA 1D09A 3QELB 3WTCA 3OCYA 2W2TA 1CULC 1DC4A 5JCJA 1PG0A 5FV4A 2V7WA 3VNQA 2I7XA 1P60A 2IW3A 2YJTD 4FONA 4MCHA 2YW9A 1QH1B 4MO2A 4N40A 4DUPA 3DV9A 4CHGA 4B4WA 3HJFA 4ZJPA 3OPVA 2FPKA 3RAEC 1ZK4A 4ACBA 3ZC3A 1E32A 1PR3A 2JFZA 5E7MA 3T3IA 4EPVA 5ISMA 3THWA 4MWEA 4PSAA 1NBHA 5BURA 2W6CX 2YJ6A 3NTXA 3GRZA 2VHEA 4DMLA 1UF9A 1XJ5A 5G4KB 1MC4A 3RFXA 5LYJB 4MUBA 5IDYA 5EIOA 1XEWY 2OCDA 4AN0A 1XPJA 2H2GA 2IF2A 2Q4BA 1ECLA 5FOXA 3TMAA 2KMLA 4XH9B 3X2SA 4P83A 3CJQA 3AEKB 2C9YA 3AF2A 1U8ZA 3NOOA 5FUYA 1XZHA 5BPFA 1OFIA 5FORA 3ITKA 1QORA 2VP3A 1I2ZA 2R97A 1JKJB 4YBZA 4P5DA 1P2FA 1XPOA 5ESDA 1KEVA 1IY0A 3HR4A 4JBWA 4PLYA 4WZAA 1GYQA 3T9BA 1UAYA 3L8GA 4MULA 3E82A 3ISJA 1NM5C 4QBKA 3D7MA 2AYXA 4NS4A 3O90A 2BI7A 2ZJ5A 1BYUA 3EQ9A 1LPBB 3F0TA 4QAQA 2GCIA 2BMDA 4GE0A 3T7KA 4QG3A 2BFBA 2PZ8A 4KX3A 2XY4A 1PUXA 2FJ0A 2P6NA 3VDRA 1UL1X 1QBKC 2UZ0A 5KEIA 4LF8B 4FX5A 2XNKA 2C20A 4UUQA 2CV0A 3DPUA 3TQHA 5B1DA 1V1RA 1N6LA 1X80A 4C0QC 4DNFA 1J20A 4BCCA 2ZI7A 3RRJA 1ND5A 1RXUA 5JJLA 4XB6B 4DB2A 1JZSA 2YNMC 3OT1A 2IH4A 4PEVA 5ITZB 2IE0A 1P2SA 4J76A 2Q28A 4YJ3A 2BGGA 2JNWA 2GR9A 2BJWA 4K3UA 4RD6A 2EG9A 2ZBEA 2ID8A 1ISFA 5KDDA 2C1EA 4FYHA 4IILA 4NK5A 2IUSA 4OATA 5CX1B 5KO2A 4TRJA 1XJCA 3QYPA 2JA2A 4CL8A 4TMVA 1VB5A 2JRLA 2RCYA 3R5TA 4F1JA 3TNDA 5HP4A 3RU7A 3E9RA 1V95A 1DQZA 4KUHA 2EEZA 1IE3A 1A9OA 2BGUA 5KOHB 5T4EA 4Y2TA 2AK2A 1WXDA 4L8VA 2I33A 3S8EA 1O94C 5DMHA 3CUYA 3S8MA 1KQPA 4NH4A 2YJNA 5ADVA 2OBBA 4CE6A 4R54A 3QF7A 2YMLA 4L9RA 4M1EA 1F60A 1OYWA 2EFCB 3DEKA 4R5HA 4I8XA 2CLKB 2O50A 2V7QD 3BD7A 3RSSA 1AKUA 2OB1A 2BLLA 1V8FA 3R6DA 1NSYA 3NBYC 4F4UA 3PC7A 5HIIA 5EXTA 3EZ6A 3AM1A 4J7XA 3GLGB 2CCJA 2BM8A 3LNTA 1LRJA 3OZAA 4P0TA 4I55B 3SJUA 1PUJA 3OCUA 4A1FA 4ZTUB 2F55A 3O91A 3AHJA 2P3LA 2DZDA 3RSFA 3DOUA 4RMGA 4EVSA 1P77A 2P9BA 2Z2ZA 3OF2A 2GEJA 4F4IA 4EUNA 2CSXA 4KIWA 3DFIA 2RONA 2GN4A 1JX6A 2GASA 4JLWA 4G37A 5CLIA 3BZWA 2YVQA 3DAFA 3IQFA 3GLUA 1BD4A 1QTIA 3E7PA 3FCSB 3FTNA 5EGSA 3CXUA 4MKHA 1ELOA 1U7XA 4QYIB 5F1YA 3LBIA 2AHOA 4DZZA 1NONA 1F8YA 1I3KA 1SCBA 2DFLA 5IAJA 4OJNA 1NF9A 1G5HA 4B5KA 1ZVVA 4ZKDA 5A4IS 3E9YA 2WMNB 4P08A 2HF7A 1LZKA 1LI4A 1M2KA 2P9TA 3C3CA 4PPGA 3IP5A 3IUSA 3KIPA 1TZBA 2ABWA 1V0JA 2JAXA 3FUWA 4CG2A 1XQ9A 4ZYYA 2C3UA 4HFJA 2XVAA 2Q1TA 4EQZA 4MUHA 1M8PA 3ND9A 3TLGB 1M6NA 3UC9A 1G6KA 1O57A 2PX8A 1BS2A 1HTTA 4NQRA 5KPJA 2HHLA 3I4FA 1V6AA 5CJPA 5EUMA 4U7DA 2C7QA 2VK8A 1FUEA 4PHCA 1VKOA 5K0EA 3MXOA 2QYHA 1W49A 5K7SA 5EKDA 1SZPA 1GTSA 4C2TA 4YWJA 2BEKA 4GEGA 5A0FA 3VR6H 3NR2A 4LDPA 4R9VA 4LK2A 3BORA 1U6IA 3NVKI 3OE1A 5E6SB 3QBTA 1JA9A 1AF4A 3F5SA 3F9IA 2P5SA 3KQPA 3U7JA 4PVCA 2PGOA 5BWMA 3RK0A 4F86A 3W5HA 1YZKA 3Q8XB 5L3ZA 16PKA 1G4UR 3HCCA 2BLNA 1KPHA 1NN5A 2BVNA 1CE8B 3HDYA 1L7RA 3E1KA 2AN9A 3HFJA 5JANA 2PUVA 3Q8WA 3RAJA 1P8AA 2OGWA 2X41A 2N1MA 4RY9A 1I5OA 4XIFA 1EAYA 1E4YA 1OBFO 1TA0A 2JGLA 1LB1B 5LVAA 5F9FA 2PX0A 4O4JB 3INTA 3KOUA 2X0EA 3ICWA 1SMKA 4RTOA 3D0RA 1UQTA 3IKTA 1N5KA 4US0R 1N1MA 3ETLA 4DMGA 5HRUA 1P9OA 4D8YA 2PVPA 3MRVA 1WLSA 3PFCA 3SYLA 3CW2A 4WKOA 1A0OA 2ZRJA 1OZAA 3C45A 1WOYA 1RLMA 4TUYF 2F6RA 5EJ2A 2ZU0C 3MWEA 3UJHA 1PLJA 4QYSA 1VCOA 4LYDA 3BDVA 3UUFA 2FR8A 2HXYA 1W4AA 3SJBA 4RDXA 1DJQA 5KC8A 3CN7A 3QX7A 1GRRA 4LZLA 3RUCA 2F9LA 1U3GA 3PJDA 4LRQA 5CVDA 5B3LA 3IT0A 1KQOA 2GVDC 2ZIVB 2I4IA 1RLOA 2IL1A 4QTTB 5CXSA 3UV6A 4TRMA 2DT5A 5TT1A 4D3SA 1OY1A 3MUFA 2COKA 1JTEA 2HRBA 1PV4A 3I9V6 2IX3A 3ZDBA 5DBIA 2JLCA 3TX2A 2G07A 3B9RA 4YDHB 1JLLB 2ZWMA 3JD0A 1TO1E 2H31A 3MFQA 2SECE 1RIIA 3ZWCA 1EDOA 4H7FA 1LC3A 1RKVA 1WOMA 4EA8A 1D6MA 4MP6A 1S9DA 3L4EA 5FP0A 5ILQA 2ECFA 2JIDA 2RJ3A 4OOEA 1ADJA 1XRJA 3QEMB 3T0GA 2FPRA 4TMWA 4UCQA 2R6R1 2FETA 4E4RA 4UTZA 5A02A 2V7GA 1UIMA 3HJHA 4Z49A 1E89A 5LL6P 4OV6B 3BTSA 3EF1A 4TOIA 3CWZA 2JLVA 1FRNA 1DKNA 1FJ2A 4LEIA 1QGED 2ZTVA 2K2QB 3E05A 5IMBA 1L4FA 2K87A 4NK4A 1UXGA 2UYQA 2ZIGA 1KI6A 1ULUA 1OE0A 4AJPA 2AZDA 1II0A 2YS7A 2Z5GA 5AOVA 5EQDA 2HLNA 2VDUE 2OZLA 1FUIA 2GTHA 3NEPX 3S29A 1U3FA 3THSA 3B12A 3I8OA 5E6UA 1BE6A 4IFTA 2V3CC 2HT1A 1Q74A 2VC2B 1QKIA 2VF5X 4I50B 1DDIA 3H1BA 1IQPA 1JPJA 4FKMA 1ZJ5A 4BWYA 1LDEA 4QLOA 4PIMA 1F6DA 4NYJR 4TS4A 2FR1A 3L6DA 1CP3A 3Q40A 1RQXA 2I6SA 3AILA 5EXXA 1IQUA 4IJQA 4WK6A 1DJLA 4IUYA 1VC2A 3PPVA 5DBFA 3A26A 2Q9AA 1T6ZA 3JARA 1ZHFA 4LV8B 3ZNPA 2OK7A 4NARA 4QT4A 5A4AA 5HYVA 5IAAA 5EIXA 3DP7A 2D06A 4KV9A 1HQKA 4S1NA 1VMEA 3NPAA 1AB6A 1YBMA 3WL3A 1T0BA 1PEKE 2H5JA 2IPOA 2IXDA 2GCEA 2J3KA 2BEWB 3EQ8A 2R751 5SYAA 2IU6A 3C1TA 2C9DA 4OSPA 3GD5A 4UCXA 4B6QA 2IIPA 2POCA 2ZDQA 2QQFA 4LECA 1PT5A 5U4XA 3W9SA 4XSGA 2FPIB 4CN9A 2CNWD 1KTIA 1JW9B 1U80A 1T5HX 1Q0SA 5FRDA 3AI1A 4OM7A 3LQ4A 1ZRSA 5CDSA 2XCRB 1YIAA 3GOQA 3SJCA 3WBKA 2R5WA 5L53A 4OB8A 1RMTA 4A10A 1R74A 4BJ3A 4OQZA 5HCUA 1WZNA 4D9NA 5EXEA 2GBCA 3TLJA 1FSPA 2JJ1A 1FFAA 2VDOB 4DXHA 4EW1A 1ZI9A 2ZYTX 5HHTA 1Z3CA 1TCVA 3H8JA 4KXQA 4LXIA 1FE8A 3SC4A 3L6UA 2WF7A 4C0BA 3B53X 1UC5B 2A94A 3GX1A 1F14A 1JYFA 3TQQA 2V4MA 4PZAA 1R37A 2PWZA 5ITSA 4LF4B 3OAAD 5KTOA 3NPMA 3PUZA 4YROA 1NVDA 3CLSD 2XT6A 3E4DA 2GLUA 3FZYA 4DWJA 4KNYA 3HN6A 1FFSA 1KK3A 1SUAA 1TVCA 3KJXA 1GLNA 4U2DA 5HF6A 1CR0A 3V33A 3BC1A 1CY4A 1NE7A 3BKWA 3LBNA 2Y9PB 4FLMA 4R0VA 3KHTA 5HZKA 3NT4A 3FFAA 4NMXB 1NF8A 4S04A 4A2CA 4EITA 1IUOA 5B7QA 4YUZA 2VUSA 4W7SA 1OR8A 2ONJA 3WYAA 3HKCA 3COWA 1CUCA 1TAQA 2Y6UA 3GOHA 3PT5A 4ZVNA 1K6MA 1JKXA 1UCFA 3RS5A 3UXEA 4ERNA 5FUVA 1WU7A 3W1EA 1W0CA 1NJSA 3BXZA 3GLFA 3IP9A 5BXQC 2EF0A 2ZYSA 3QWFA 1IFXA 1EFTA 1JG2A 2OLKA 3MCUA 2XBUA 5EE0A 5K6RA 4TTQA 5ALTA 4DLAA 4CIDA 1Z73A 2BP7B 2YXNA 2C94A 3EJWA 4MIKA 2P7HA 3C85A 4EJMA 5D3MA 1VHJA 1CJBA 3IAS6 1CZNA 2CFRA 2G9RA 1U2SA 4MVCA 4QQRA 4QUKA 3DG9A 1T2UA 2EQAA 2W9XA 3ZLJA 3BWMA 3OETA 3EMKA 3PGXA 2WVHA 3B7GA 1L7BA 1SVOA 4G5XA 3BDAA 4LJ4A 3SF8B 1PJSA 4B6EA 3V8BA 2D1SA 4PBSA 3WGVA 1A9RA 3H1AA 5ALDA 5IYZF 4EDFA 1B1AA 3KJEA 4GZLA 4RE5A 4ZVPA 1HKUA 2M32A 4RHEA 1E2IA 1R6TA 4AJEA 4E22A 1PEYA 1D03A 1SOAA 3C5HA 1JYEA 4MAFA 3IUEA 3K5WA 3WQQA 1Y1QA 5LFAA 1TJYA 4MNTA 1YUNA 2HTEA 4YRRA 1XAGA 3AT1A 3D59A 1WCV1 1LSJA 1PZEA 2ZE6A 1OLSA 1TVMA 2QRVB 3P9YA 1BWSA 1C1XA 4G5GA 4OYRA 2CYCA 3SS8A 3O8LA 4WK2B 3ZEAA 1O5IA 3F6PA 4F1WA 5IH7A 1M0WA 1FNBA 3TOVA 1GNRA 5BNFA 4PXSA 5AJUA 3W2HA 3T3OA 4LJAA 2Q0HA 1I3NA 1T6BY 1XMPA 3U3XA 3VTFA 3M82A 2J07A 1KJJA 5GIPE 2J45A 1C1XB 1ONPA 4NYJQ 4M54A 3DMNA 2ZYVX 3U61B 4MHTA 1N2IA 2DBZA 3FLEA 4CM8A 3D7RA 3D4LA 1ZYUA 3ESDA 3R0XA 2HAEA 2V7VA 1XZJA 2W2XA 3SQMA 4W5RA 2UVDA 5TJHA 2I2BA 5T8KC 1E3QA 5FFMA 2E4ZA 4XB2A 3DE7X 3ER8A 2UZ3A 5EUCA 1TAHA 2ZCVA 3A7DA 3CYFA 4G0QA 3MA0A 4GT1A 4KJXA 4MS1B 1JIUA 3UFXB 4BTLA 4DRZA 2VIIA 2D3WA 3LDFA 1ZUNA 1QOZA 4IHAA 3RHSA 3UOGA 5LQCA 1P0IA 2JAUA 4R1PA 2QSZA 3KHKA 4FIZA 4BO6A 4A0FA 5IU6A 1MJGA 1RWXA 1OFTA 3WWZA 3R9WA 3GNLA 1T26A 2IYSA 1KMQA 4HH3C 2ZYAA 2F90A 2FNAA 1Y1TA 1GJRA 4MA5A 1N2EA 3K9CA 1OZ0A 3IAHA 1ZHHA 4XXHA 2LIPA 4UHFA 1I4EB 1DBWA 2Q9UA 4UCFA 3OQJA 5B1SA 3R6GA 4I8DA 4PZYA 5LLSA 3CRNA 2IK8A 2NO1A 2XEXA 3JQ9C 2CEKA 1SXJB 3FPKA 4Y7CA 4GPD1 4QRIA 3RF7A 3GLFB 3SXJA 5KWSA 3OIVA 1LW6E 5LYYA 1SWWA 4G9BA 1FP6A 2ENWA 1DKUA 5K45A 1B42A 4QUJA 1DADA 1GA4A 1A4UA 4M1OA 2FZCA 1HKHA 3GA0A 5FA5A 5GONF 4F3YA 3S2SA 1CJSA 5DHRA 3RC8A 3ZN2A 1BXRB 1CR2A 4UBKA 5TIIA 1BE8A 1KY4A 2OKCA 1V4VA 5EFZA 4DUGD 1L2TA 2H9AA 4CIWA 2A3RA 2GD2A 4OX9Y 3ZBQA 3EIEA 3RC7A 3ZLVA 4J0HA 3A9WA 3NAQA 4D80A 2XRFA 2J0UB 3BK1A 4BFLA 2NZWA 2CY0A 5FBHA 1E0JA 3T5BA 3TQFA 3AVPA 1DAHA 2DFTA 2VSNA 1QX3A 5CB0A 1FSGA 2C2GA 2IHYA 4WSOA 1S01A 2FH5B 2PQMA 1EVYA 4FN4A 4JP3A 4LDQA 4OA8A 1Y63A 2VBGA 5DYNA 1XHLA 3VR3A 9LDTA 1PYGA 2BZSA 1L8QA 4QX6A 3FCCA 3R9KA 2ZE8A 5MN4A 4NBTA 2P6RA 1CR4A 1RLIA 4NBWA 5GOTA 3U3OA 5HUQA 4BP8A 2HBZA 1WQ4A 3RVQA 6CHYA 5EMKA 2BR3A 4QHYA 1W85A 3WLJA 1K7XB 2VRCD 2ZYIA 2V8BA 5I5GA 2O19A 1MPTA 1QFYA 4M6WB 2INGX 4DW8A 3AWIA 3Q3GE 3O47A 3MT7A 3A1VA 2A0UA 5B1HA 2WPDA 2IUFA 3GXBA 1XDZA 2FZKA 5BW6B 3K6SA 3I6QA 2XPCA 1IY1A 2WP8J 3BHJA 1G60A 4HRYA 3K31A 1OBVA 2YV2A 3VX3A 2MMGA 3PXBA 3RE1A 1W8DA 2ZRIA 3BH0A 3JAWA 3JALA 1RQRA 4PIVA 2CCGA 4E1VA 3VO2A 4HDSA 4LNHA 1VP9A 1J00A 2VLIA 4HNAB 1SUPA 4IVPA 2QVCA 5AVTA 2ZBFA 5KX5A 2CGEA 1PZFA 3BGIA 4B6RA 3FSEA 4UEKA 2ORWA 2PIDA 1TIBA 2XE4A 3AZPA 3OX3A 3U1TA 1GY8A 3DR3A 1RHKA 2QZJA 2CMGA 1I9CA 4P3YA 4DLSA 2VDJA 2CHQA 4LSWA 1O0CA 1R18A 3Q15C 1QRTA 2OSBA 4AURA 4Q3CA 4RLFA 4MEBA 3DMGA 3GQBA 5CDFE 2G88A 3BCUA 4R01A 3B9QA 4JK3A 4R2WA 3KPYA 2XMDA 3KHUA 3ELWA 3W6NA 1RBQA 1TTQB 1U02A 4K40A 5CBPA 5JAOA 4LWOA 3H11A 2BV3A 1JFFB 3KELA 1JMYA 4IGKA 4LBVA 2EJUA 4MIYA 4Q7EA 3GN1A 4HYTA 4UZFA 1KO4A 3LC0A 4U6SA 1SKQA 1MVOA 1QPBA 4ZVKA 1NNUA 4BMCA 2Z2KA 4DL9A 5H80A 3LECA 1R6XA 3LUFA 3R5KA 4MVJH 1VIMA 4YRPA 3V4RA 3D8TA 3BXHA 3OTHA 1M33A 1ZLYA 1G8GA 4BPRA 1PWXA 1RQNA 1A96A 3BT7A 4RL4A 1MBZA 4ZQIA 3EZXA 1TZ2A 4N54A 5KNBA 4GMFA 3WGOA 3EF3A 2J67A 2LTAA 3F6RA 4EWLA 5AM1A 4OYHA 2ECKA 5HZMA 3L0YA 1L7AA 3GMDA 2MCFA 1ZUD1 3HM2A 4ZVRA 3FUTA 3WK4A 4JNKA 2IYXA 4JDUA 3TGWA 4IJMA 4B71A 4B3RB 2I3ZA 4UUBA 1YQQA 1Z26A 4G4SP 2VOEA 4RJIA 3I37X 1V8OA 1VBNA 3C8ZA 2LGJA 1J5PA 3GVHA 4YALA 3NHBA 2QN2A 3A6HA 2R11A 4POOA 3I76A 4EHIA 2HW8A 1JN0A 3K16A 2B1QA 4MW9A 1SIUA 4HNRA 1ODIA 4CM7A 4F7WA 2VSXA 4CQMB 2KBEA 2UZ1B 5ICGA 2HMYB 2IKQA 5FR2A 3ZS8A 4F72A 1JIQA 1LFDB 2CJXA 3H83A 3QTBA 4XIGS 1XLVA 5DVZA 2H92A 5BV7A 3UGJA 4HUJA 3ENQA 1P75A 1E7SA 2PLNA 4J0GA 2ZQZA 3ICVA 4AZ0B 4DNQA 1LRKA 4YXWD 4OLAA 1PQUA 4PGMA 5EE9A 3UK6A 5EERA 1E1DA 3V4OA 3PLAE 4BMZA 5DTJA 3DNFA 1UFRA 2EX4A 2VI5A 4Q03A 5ICFA 3FWHA 3RIHA 1X8LA 4LF9B 4DA8A 5JNUA 5GIOE 3S1AB 1ZHOA 3L43A 3BMCB 4JU9A 2ISCA 4LDRA 4ZHQA 2Y05A 4XQCA 1B0AA 5AFSA 1VHTA 4AIIA 5JQGA 1N9KA 4TYNA 5K0TA 3IL2A 1TKCA 2ZBDA 5CEFA 4BN4A 5JIBA 1II8B 5TGDA 4G65A 3R4VA 1THZA 1DBPA 3HUUA 3PJRA 4OIMA 3WLLA 1E3SA 1PJQA 2Q6LA 3G5LA 2P4SA 1RJGA 2FOLA 2DLCX 3GEGA 2XUPA 4D42A 4FC7A 5JARA 5C4MA 4RTRA 2BKLA 4G23A 2AMJA 2CYAA 3SQLA 2QN6A 1NN3A 4LN1A 3PUYA 2JLRA 4R84A 3UXHA 2Z4RA 2W6OA 1R5BA 1TD9A 4HGRA 2CV2A 2PL1A 2CVZA 3N7AA 2Q0QA 3AUAA 3HVRA 1QVRA 3C3AA 4FHGA 4D3ZA 1XSEA 4JJ7A 1ZN7A 4Z9AA 4CF7A 1P4RA 3H1GA 1FPMA 1BKSB 2QDKA 5DM0A 4OUKX 2QTLA 4R2XA 1HT2E 4IGIA 4W6QA 4E5DA 1WX1A 4J1TA 3GLSA 4EKEA 4TXMA 1BMFA 3C6MA 4AUNA 1A9PA 2GSDA 1WZEA 2LUOA 1FMTA 1JSLA 4GYKA 4M9RA 4XDHA 4L3OA 3GPLA 1AKTA 5JZMA 1U3DA 3OPXA 4RIFA 3EFOB 5EYPA 1RHMA 1QUEA 1QHGA 3SMVA 1WMBA 2XYVA 2GEVA 2KX7A 3DXFA 2GBFA 2GJAA 2Z08A 2E48A 3OZ7A 2O3SA 3RC1A 3WHPA 1NC1A 1YZ3A 3PXUA 1YAHA 4EY8A 3CE9A 3KKZA 3ZDEA 2C5FA 3SQWA 3VZRA 4UVIA 4MQFB 1A9ZA 4D9MA 2V0GA 3CO0S 4KO1S 2DQSA 2EP8A 2HLDA 2Z5VA 2J0EA 1NI4B 4MDFA 1YHYA 3OZBA 2CK3A 4TKVB 5JAPA 2JC3A 3H2IA 4L5IA 4PAWA 5LKRA 2FQ1A 4TSKA 4YK7A 4FOTA 4RF4A 1QUFA 4XUDA 4JI6B 1XVVA 1F06A 1H2WA 2LKCA 1MABA 4HKTA 4JR0A 5HIMA 3I9KA 1PFWA 5AVZA 3QMPA 3R9IA 5C5IA 3KQHA 1IJKA 2H4HA 2VHVA 3VPXA 2GXAA 4ISCA 4TKUB 1LNSA 3ANMA 3NHKA 1SKYB 1U90A 4LMRA 4PINA 3ZIDA 1XWWA 4W9NA 4YJ3F 1Z6ZA 2ZYDA 2WA1A 3P2YA 3PD1A 2G4VA 4OU4A 4L57A 5IABA 3WNDA 4B43A 3UAWA 4JY7A 1W1WA 2QK4A 1T2EA 3N7UA 1IZ9A 3AHDA 5FADA 3RSQA 4PN7A 4AK9A 5KOHA 5LD2B 3EXAA 4KFTA 4C7KA 4F2WA 2BBTA 4GUAA 4EYSA 2O8CB 4D44A 1Y5RA 4HQLA 4KITB 3SYMA 2DX7A 1Z0ZA 1VJCA 3KKNA 4GXNA 4Y2XA 1U0NA 4IDAA 2DPLA 3PQ7A 4KQ1A 4C0HA 1OHHA 5AUPB 3L9WA 5HQJA 1S2GA 2HM7A 2H17A 1OU0A 1LGYA 1M1YA 1N6IA 2XGMA 1AUVA 4G4IA 4OMUA 1MJNA 1M0TA 4IOJA 5AOBA 5HRCA 4WWHA 4PLPA 1YVDA 5CX1A 4A8JC 2X3YA 2XMRA 1H8HD 1T9HA 4BFZA 1MTZA 4LQDA 5A5FA 4MV4A 3HCWA 3VYSB 3FSGD 1DIHA 5FV7A 1NR7A 3KJNA 1DTWA 4MVJG 4H15A 2F3RA 2JH3A 1X13A 1VB3A 2CXPA 4DLZA 1NZDA 4Y9DA 1E2KA 1XVIA 4HAOA 5BQFA 2CXTA 5YASA 1JEDA 1T8PA 2GBLA 5EJ8A 2GPWA 2Q27A 2F43B 1FTWA 2VHCA 4YRIA 1P74A 3FROA 4KE9A 1Z07A 2ONKA 5BQ3A 2CFIA 1QPZA 4MS3B 1NM5A 2Q2WA 1WP4A 3GZ4A 2ZZKA 2HHCA 4IDGA 3AERB 3GI1A 4PZLA 2BFBB 2HK8A 3D0KA 2WMOB 3RKRA 1DG3A 2WB2A 4PNPA 1H23A 4MUGA 3GGGA 5MF6A 3IAS1 4V0LA 1PD1A 1KDRA 4H1WA 3PQ4A 4DAOA 4CN8A 3D7LA 5DTEA 4EABA 4AS3A 3CV3A 3N0XA 3SXUA 1QF9A 3U4AA 1Y82A 3PDIA 1TB4A 2C8VA 1J2TA 4C30A 3RU2A 1FTQA 3QJ5A 4CM3A 5LLDA 1C3JA 5JHGB 3ECAA 1IOLA 3L4JA 2QVYX 3OE4A 3VVLA 3H2ZA 2WQZA 4FMCF 2RGRA 1JWBB 3BM5A 3TTVA 5AVVA 2G1UA 2EG5A 2R8ZA 1JDBB 5L3RA 5I6DA 4FZ5A 2X58A 2FB9A 2FXIA 3OVMA 4MARA 2IYUA 1VBMA 1KR2A 3RTAA 4FDTA 4F4DA 1UBCA 1J07A 3E9CA 3SLKA 1V26A 1RKQA 5HF5A 4BE4A 3NWOA 3FRJA 5LYJA 5AYVA 3WSVA 1ZA1A 1QYDA 3X1DA 3FPEA 1XOIA 1A9QA 1G7CA 1U3WA 5J2TA 1U0OC 2V7QA 1X3LA 2D1RA 1E96A 3MCAA 3S2FA 3SYKA 4CGZA 2IZZA 4NBKA 4P82A 4AJLA 5L6MB 5CB4B 4QSMA 1ND6A 4YR9A 6NULA 4RO0A 1R0SA 1ZCFA 2CZQA 2FY8A 3K4QA 1PJ4A 1PUIA 1L7DA 2RBGA 4X1YA 3ZJUA 3OEWA 3QELA 2CFCA 2G4CA 1HYGA 5D3QA 1HL7A 3E61A 4CFZA 1N6PA 3EYAA 4WTOA 2JVJA 1L7MA 1CUEA 3B6MA 5BYBA 1FFXA 1EBBA 2NTYC 3DD5A 2VP6A 2QTGA 4KR7A 3TOSA 1EINA 2I4NA 2J48A 3D3QA 3WYEA 2VXOA 3OJLA 3DE6X 3HY4A 3IRVA 3FTQA 1DJOA 3HDQA 3A1TA 1AGPA 1V7PC 2QLBA 2QX7A 4Q1AA 1SG0A 3BGVA 4P4NA 5COQA 2WUWE 4BMSA 2G5TA 2R48A 3JCZA 2GZ2A 5C8YB 5IDQA 1MG0A 4BMVA 5BORA 4ILKA 1PVDA 2FCAA 3BWDD 3K2EA 4CCAA 3EFEA 1EWRA 3IOMA 3K0KA 3H3FA 5CA0F 1RM3A 3K35A 2OCBA 2E4UA 3QIAA 3QVGA 4GX5A 4DNXA 1D3AA 2VJOA 1X9IA 1ZIXA 1YRLA 2VYNA 4DSOA 4CEIA 4MEAA 4ZAZA 5J5AA 5I3ZA 1YC2A 3IKLA 4IQ4A 1KU0A 4N9WA 2ZAYA 1GD1O 1KZHA 2VJQA 3IO5A 3DKKA 4NI5A 4U9IS 4E70A 3MT8A 5LA6A 4G63A 3LLVA 3S7ZA 1G5QA 3I64A 3BXOA 3TNFA 4P0PB 2F48A 1V96A 1ZM4A 5K01A 5L7WA 4AP6A 1SUSA 3KBOA 3BXFA 4BJHB 1RVDA 1TI7A 3RWOA 4P84A 4CTNA 2ZIXB 4C0AC 4BVFA 1L4GA 5JTUA 4F12A 1QTRA 5CCDA 3DAGA 5IT5A 3B1KA 2QN8A 1C80A 4NYMQ 4R9NA 1ESCA 1N2CE 3WWOA 1FXWA 4Z53A 4WXHA 2CFTA 2VSOA 1Q1NA 4AAYA 4H16A 2AXEA 1ZOLA 4OB6A 3WLHA 3I61A 3BMQB 4MWTA 1J24A 3DOEA 2AJDA 3CEJA 1X15A 2CJYA 3HWSA 5AH0A 2IT1A 1COWA 5ENVA 4D0RA 3ZNNA 3JQFA 1X9GA 4URVR 1EH5A 2ISQA 3F90A 2UU9B 2Y1OA 2DBVO 3BTVA 2BZ0A 2J6CA 2RC6A 3P94A 3PJFA 4I1RA 4CKWB 3JQ8A 4WJKB 4ZAFA 2LIVA 4KBYA 3RJ9A 2GUWA 3TD2A 2GM3A 2JLAA 3COYA 5L9AA 4G0OA 4AM8A 3S5JA 1HI9A 4BNWA 1YVPA 1EWTA 1J7JA 2PUWA 4BMXA 2WIFA 5BSEA 3HBJA 3M1LA 2ZEJA 2DAPA 4AKSA 4A3SA 2P6MA 2O14A 2ZP1A 1ENZA 1OGJA 1TL7C 2EDCA 5AOAA 1DP4A 4DIOA 3TZKA 1JFLA 2HCTA 2I29A 5FPHA 5JPIA 2FPMA 2OXRA 5FHQA 3RBZA 1I14A 2Q7OE 3GCWA 1DJNA 2W2LD 5HJ5A 1JEJA 1OZGA 4V0OA 2X15A 1Q84A 1SA0B 2RG1A 2WVAA 1JU9A 3E9QA 1VJTA 3MB8A 1A8IA 5IM4F 3ROGA 4LJ7A 5HIAA 4G5YA 1LH0A 1A88A 1P2GA 3JQFC 2I67A 4IOKA 5CAEA 4YC7A 3GO4A 3IEMA 5ICMA 3FYUB 4AUKA 1E4OA 2PUCA 3PRKE 5DIFA 4N39A 5ALEA 2LV8A 4DKXA 1TPZA 5FQOA 4N41A 3L5OA 3NIBA 4ZQFA 3B36A 2P67A 2O8DB 1OAAA 3A3PA 4N7MA 1XPUA 3JVEA 4L0MA 3PC4A 4MHOA 3KL2A 4PHFA 1CUHA 3EBOA 3STUA 1HL3A 4KXMA 4ESHA 1NDHA 2C5AA 4ZVTA 3V5NA 3LJKA 2P3QA 1Y8ZA 3KUKA 4DMMA 2ERYA 1NW9B 4K6KA 1JSXA 3UAXA 3W9UA 3OJOA 4PLWA 3ZJ4A 1XNJA 3NHFA 4HZUB 2PGIA 1SHTX 2EL7A 3HCAA 4LJ8A 3N2LA 3UT5A 4RTMA 1J90A 3ZOZA 4DLVA 3HM9A 3QOFA 4C1BA 3WTBA 5B1IA 1JBQA 1BXGB 1DC8A 2UVPB 5BUCA 1THTA 2Y3IA 2YV1A 2VUIB 3EH2A 3NGXA 4IHQA 1U5BA 4Y67A 1OH8A 3EW7A 3NM6B 2X4DA 4QYMA 2C4KA 2E6KA 2VJNA 3G7SA 3D4IA 4CODB 1Z6TA 4JU8A 1FDOA 2BT4A 3C2QA 1R0LA 2D5AA 2ODQA 2JIRA 2WTAA 5IN5A 3WIOA 2JKVA 2HUPA 3CR8A 3UWOA 1QTQA 3V42A 3L6EA 1TQ8A 5CK4A 1OV6A 1TC1A 2OHOA 3MMSA 4CW7A 1DKPA 4BNJA 1VPWA 4DCUA 2ZJYA 1KETA 3OQOA 1S3GA 3AU9A 2M2IA 4PZ0A 3DTVD 4KQ9A 3EZYA 4MGYR 1J09A 4HFNA 2BTOA 3N28A 2ZR9A 3ZGLA 1FTSA 4IYJA 2GM4A 1TT5A 2IYNA 1J97A 1B6TA 1P0FA 2D54A 1FMCA 1NBWB 2RARA 1EJ0A 2C2WA 4P7FA 3PRYA 2OV4A 4MQ5A 1P6UA 5FFFA 3U1VA 4B34A 1IULA 4YJDA 4CIXA 2XXBA 2W2OA 3GFQA 4IIVA 2A7XA 1G64A 5KREA 4Q01A 2EWWA 4L73A 1IN5A 4UD6A 3S27A 5A5GA 1R4MA 5CITA 5K0SA 1DWQA 3ID6C 4DY6A 2I3AA 4KGXA 2YXPX 3DB1A 4UTNA 2YS6A 2H11A 4UEWA 3WWCA 4E30A 1IXRC 4FMPA 4G1CA 1EQUA 2R00C 3ESXA 2JFBA 1W44A 2GK3A 5EHXA 2O52A 3TPZA 4OKIA 3D5QA 1HXHA 1R9JA 3W4IA 5A0VA 1MO4A 1RRPA 1UBTS 2G83A 5T67A 1JTVA 2AXQA 4N4AA 1QX4A 2NOAA 4EPWA 1HSOA 4HZUA 3AR7A 2CNBA 3FSRA 1JUDA 4EY7A 3I0MA 3SHQA 3ETNA 3RUIA 2PLRA 4PFJA 2QTCA 4EHFA 2UXCB 1JXOA 2YBEA 4OYYA 3RVNA 4Z1OA 3E22B 1YI1A 4CLHA 4EGJA 2PUGA 4DIDA 5K3CA 3FPJA 1D1QA 1EVLA 3GC6A 5IXJA 2YIJA 1UWKA 3C4JA 3DW3X 3OF5A 3GLHA 2ZFUA 4NP6A 5CFMA 4HWOA 3HCBA 4W99A 1NJ2A 4NZYA 5ETJA 2HSEA 2JLUA 5KQRA 2O8DA 4HQ0A 4UNIA 1L5SA 3G6KA 4ER3A 4LZNA 1BS9A 1QHSA 4JLKA 4TLDA 5DTIA 5JEDA 2O8FB 1P0CA 3ND8A 4QO7A 3FYUA 3WBBA 4GSLA 2JVIA 4I4NA 1JQJC 5I48A 2OZVA 5CAEB 3R6TA 3U39A 4C07A 5BWNA 4C0LA 1T6NA 4HNHA 3U6BA 3VOTA 3ENNA 1TE2A 3F47A 5FNVA 1P17A 3G8CA 4LV6A 5BVGB 2DYKA 2X5KO 3TF5A 4JOQA 3CH6A 4H17A 2V4UA 2ZSAA 2KI5A 1V8PA 3W7VA 1VPDA 4FOPA 3ZBTA 4ZZIA 3G9UA 5CFPA 2QW0X 2VJBA 4QNMA 4B3FX 4KI0A 2AKAB 4K03A 3NLLA 4MUFA 4RDIA 2BISA 3NEJA 2YICA 4DDMA 1JHQA 2HA7A 4OFXA 2YOGA 2IGBA 2W93A 3A2NA 1G55A 3QFSA 2WT4A 1UBNA 3GARA 1HDCA 2OQ2A 4XYBA 4HB0A 1UK8A 5ERYA 2PUDA 1NUTA 5I8ZA 1JB9A 3DAOA 3WGYA 4JJFA 3UAOA 4E2XA 4B6SA 3PR3A 4YRQA 4N9QA 4EJSB 3CRZA 2C84A 4GX1A 3CSUA 3NNSA 2C4MA 2PX5A 3DE5X 4OO3A 2EBHX 1UP6A 2Y1GA 1N1GA 3NBKA 2Z98A 3SZMA 3PC2A 1EUYA 4N03A 4CDNA 3P9IA 5T4BA 3TZ6A 1VMAA 5CNIA 2EBWA 3VDXA 4F5YA 1LWOA 1T13A 3I39X 1CYEA 4WGGA 2GN2A 2HT6A 1ODCA 2XUJA 2PWAA 2ZAOA 4YJFA 1WZ2A 3RTEA 3UAVA 1Y8RB 5I7VA 4QPJC 1YMUA 2HJ9A 3IQZA 4LE0A 1BNCA 1LSUA 1N2SA 1V25A 3ZD8A 1VYUA 2IEYA 2ZUCA 1U3UA 3WLOA 3ZQJA 4HZIA 5TR9A 4EI7A 5JSZA 3W5AA 2A5FA 2AOUB 2DKOA 5KAPA 5I8WA 1TLFA 2ID9A 2PRSA 1NNSA 1VPLA 1QJ4A 2R1ZA 2VBFA 4G0MA 1BGVA 1NZFA 1Z0UA 4URWR 3U4DA 1P4AA 4O02B 3P2IA 5HBRA 5FI1B 1WXXA 3AV3A 3AKYA 2ONCA 7YASA 4LKOA 5CW2A 2FMXA 1IOVA 4DEVA 5FL3A 3IBFA 2Q3FA 3P2JA 2NZXA 5BNZA 1KWKA 2C7RA 5AW8A 3P4YA 3QPCA 3IXMA 3E23A 3QVGB 3L7OA 5F5LA 3ZY4A 3NFRA 2QM3A 1KKMA 1JEEA 3BPSA 3QNUA 2H1HA 3R5JA 1Y3IA 4INZA 4LKRA 1P91A 4L8LA 4FB4A 5CA1F 5M7EA 2G3YA 3IMCA 3L7BA 3R40A 3AUJB 1YB7A 5C8YA 2H18A 5LQDA 2OGUA 2R6JA 1LS1A 2DFNA 2F3TA 1GL3A 2H2DA 4W1RA 1I7SB 3ZV7A 3PHGA 4HWKA 5F64A 1CZKA 4L4UA 3TDMA 5BVHB 2IH2A 3GP8A 3AVQA 3HJAA 3BJIC 4UHCA 3X1KA 2W2LA 3GUHA 3OF3A 1G6OA 3Q88A 4U6QA 4U63A 2YHAA 1ZDMA 2J0QA 3L6RA 2OORA 4CNBA 2YVAA 2OILA 4PPYA 4PC2A 4KN8A 5BUSA 1ZPDA 1Z6XA 1F4PA 3BRWA 3HTXA 1FA9A 4EEXA 1E1QD 3OC0A 1HG0A 1Q95A 2CKMA 3EULA 4GXRA 4MQ6A 4A03A 5A4KA 4ZGGA 3NYRA 3SZRA 4TZ0A 1KVTA 2WHQA 1TM5E 2H7YA 1S6YA 4J6FA 4ARUA 2VR1A 3C5CA 3UH0A 2V1UA 5DHSA 2IGTA 4DWOA 5C37A 4D96A 3HDHA 3G2LA 4V0RA 3HXPA 1LBIA 3PC8C 1O03A 2WD9A 4NESA 2WWWA 5CFZA 2CDAA 2CNOA 1P1IA 3I8XA 3JD4A 5CT4A 2ZYUX 5D7BA 4HRXA 5JMOA 1HMPA 1W46A 4ISBA 3ROPA 2DLDA 3KZOA 1EIZA 1XNQB 1SKAA 4AN4A 1A2BA 4KCGA 4P34A 4UU8A 4FI3F 5I7AA 4R16A 4D45A 5HE8A 4TV8B 3MTGA 1GPUA 1XB2A 2XMSA 1X74A 3UG7A 3RADC 5FWXA 2V1XA 2LVBA 4KU4A 4N5LA 3ZU2A 1KSHA 3K9BA 2IHUA 3LY8A 3VZPA 3FWZA 5KNDA 4BXOA 2B4QA 1P1KA 3OQ6A 1ZY2A 2J9GA 5D6NA 3U56A 2B21A 4TXNA 1AQIA 3D4OA 4O4IA 2P27A 2F1HA 2H2FA 4QA9A 2YFQA 2P9EA 3VC1A 4V2UA 3OTOB 2QRZA 4HX9A 4YNBA 1VHDA 5KMGB 4A15A 2VYCA 1PQWA 3AERA 2OXFA 3D81A 3ZWPA 3BWVA 2AEEA 1M76A 2XUOA 1QR6A 4AXBA 2FV8A 4E09A 3REOA 1DBVO 1R7RA 4L74A 4QUAA 1ZGGA 1FP4B 4OXXA 3ZHXA 4FX2A 2SHKA 1RZUA 2YWGA 621PA 1IY2A 3HYCA 1IM2A 1R8YA 2VZ9A 4OI1A 3RUPA 2PZGA 5FNZA 1L5HA 5KNDD 1Q12A 4EPTA 3HPRA 1ZXLA 2JGDB 4M0CA 3UJ7A 3RARA 3DVLA 4YONB 1DTEA 2VJMB 4Z8XA 1P1CA 4ADSG 3OPNA 4X95A 1J8FA 1PEAA 2WJHA 5IJAA 4BNFA 4EB8A 9GPBA 5P8WA 3WMGA 5B4VA 4FGWA 1MO6A 1T9AA 2E4VA 1GG2A 2QJFA 1H2FA 5KOIA 3WO0A 3RU3A 4A0QA 1RZ3A 2WFLB 4FJ2A 5SYMA 3QKRA 5INTA 3HDGA 3WMEA 1IN4A 3QYJA 3CKKA 2FN9A 1Y80A 1D6SA 2FPSA 1HX7A 4FYPA 2C5LA 1CQZA 2H1LA 4J75A 3U26A 1ID8A 3H5WA 2QD3A 4IZ6A 2DFVA 4LTMA 4NBLA 2O2DA 3UA3A 1EXDA 3C7KA 4N7BA 4BLRA 1X7HA 4LWZA 5I5EA 3U1BA 5CJJA 3SYNA 4GFDA 4XD2A 4PC3A 3DZBA 1E8NA 3OCJA 1BDBA 2WLTA 2ZJAA 4Y9UA 4YCJA 3USCS 3DE4X 5A06A 1AHHA 3L9XA 1ENPA 4FR0A 4Q05A 4Q15A 4BVEA 1TU3A 3COSA 4ZI7A 4P9NA 3DHNA 2JGAA 3FAZA 1E2MA 2NGRA 2AFHB 3GDWA 3LQ1A 3WQRA 3W2GA 5JECA 3HBNA 1C30A 3AHFA 3RAGA 2P1RA 1HLGA 2RGNA 4C20A 3RU9A 2IE8A 2NIPA 1CUZA 4Y2GA 3IDAA 1I2AA 4K6FA 2ARKA 3GJ6A 2Q3DA 3CRMA 4MR9B 1YZGA 2H4JA 3O2NA 2I4OA 4Q6BA 5JZ9A 5KWEA 1QDEA 3QEAZ 2JGFA 3Q11A 5LP6B 1P31A 3JVUA 1TJNA 3OUTA 1LDBA 1YR9A 4Q9IA 1X42A 2GAOA 1GQYA 3CO5A 3VH3A 1CRPA 3I0ZA 5I7HA 1V37A 2JFWA 4RK5A 3FWPA 5KQSA 1TM2A 2IP2A 2SCUB 3LOQA 4HAVA 1X2EA 4B2PA 5J4YA 5AKJA 3UJ8A 5G53C 1BC5A 2BMFA 1VL5A 3CF6R 1FTGA 3D2CA 4U7WA 3ZW7A 1LDMA 3X0DA 2OCXA 4N1AA 3VNSA 1N6RA 3CH5A 5AM3A 2JI6A 2QS9A 4HAXA 3WV4A 4B33A 4HDKA 5TE9A 1FRFS 4RA9B 5FL7D 1Z8FA 2D2IA 2AN3A 1UQUA 5EJMA 4IDBA 5LM3A 4R1TA 4Y6GB 1KF0A 3BA1A 1LC0A 2I8AA 2PQ6A 2CB9A 4H7DA 3K9WA 3M5PA 1OIXA 5K3OA 3NM5A 5CD9A 1CEYA 5GZ1A 2XF8A 4IIUA 3TLZA 1PG5A 2GS9A 2R47A 2SKDA 4ZT4A 3I05A 3RUAA 2ES4A 2JHAA 1PJCA 1JNYA 1SBNE 3AVOA 1AMOA 4AZ3B 5T3YA 2GZHA 3I5AA 3O21A 1XEAA 1GQOA 1WW2A 1NVKA 4GH5A 3T99A 1YMVA 4Q39A 5ARDA 4B3IA 4B74A 2VSFA 4ND7A 3TAXA 3B2NA 1E6WA 1ZNXA 2HH9A 5K8TA 5L40A 4B6FA 4BEJA 2CHFA 1MORA 3GNQA 3NZEA 2H8KA 5DYIA 3M6VA 4Q3DA 4EJ0A 1EFPB 1ZQ1A 2RHTA 2V3VA 3RFUA 5A9SA 5JLJA 2XNHA 2G77B 1ZKDA 1PJLA 2KLBA 5HZHA 5SYNA 3S2YA 2O0LA 2UDPA 4ZAWA 2B0JA 3Q9LA 1EA7A 4YH1A 4HH0A 2DUWA 1I3OA 4H6XA 2CLEB 2P40A 2NU8B 3JAMA 2AB0A 1SK8A 4MUJA 1WS6A 4ZHQB 5B30A 1GCGA 1K5DA 1K3TA 1YASA 4MUIA 3I4CA 4HO1X 1MIOB 4CLDA 7ABPA 2PR7A 1I4LD 3AXSA 3E9DA 5LLTA 3DZGA 4O4LB 4QBFA 1KS9A 5IJWA 3CZPA 2I1LA 1QG0A 3KJGA 3F1LA 5BSUA 1RBZA 4GR4A 2HPAA 3DMHA 4W5WA 2GFQA 2PRKA 1QAOA 2A9QA 4LBZA 4KG7A 3FOBA 4AZ0A 1ZNQO 2NVBA 2Y99A 1IIBA 4D25A 4W5JA 4HUQA 1KJNA 4BNVA 3AF1A 1E6LA 3QUBA 1ZOPA 4ZYTA 1AO3A 1AK2A 3BRQA 1LV7A 4D9BA 1WABA 2A86A 4OQPA 2PG3A 4D8WA 4OP2A 3KSUA 5LWHA 3H9CA 2NTEA 4LCBA 2OAEA 3KUCA 4TUYA 2QD2A 3IR6A 3EZLA 5B53A 1P6QA 2H0QA 1MZVA 1RYMA 3EVGA 3I34X 4JSRA 3I5YA 4TYWA 3IHTA 1HV8A 3QKWA 4NCXA 4BKMA 3NHRA 5E4YA 4D9JA 4TV9A 4TTPA 1S3FA 3T95A 2ZXEA 4TLCA 1EUCB 4P4GA 5CW1A 1KZ6A 3TW6A 5CVVA 3ZY5A 4YRZA 2GEBA 2XB4A 4C7XA 2QU7A 1W1IA 3N0VA 1SURA 4Y9TA 5KNDH 3RJTA 1C0PA 4TS9A 1M7HA 2WQ7A 4LOKA 2PTGA 5GONB 1QHEA 3KU1A 4KQIA 3KOYA 1GV0A 2C8JA 2FMFA 3ZD7A 1C41A 1SKUA 4EZIA 2ZSBA 5BSMA 3S2ZA 4RPGA 2JFHA 4NOJA 5AK3A 5EPOA 1RYDA 3ESCA 3TW8A 1HQDA 2WJJA 4HEA1 4GP9A 5TPZA 4F06A 3KO8A 3EPJA 1ZNZA 2HC9A 4IH1A 1KFEB 2QL9A 1NW5A 2OG2A 3O3MB 1VCMA 1Z0KA 2VCYA 3E03A 1S1CA 5BV0A 1OT3A 1X7GA 4C4YA 2W58A 5IJ9A 2QP3A 5F4ZA 4Y6QA 4PAGA 1GFIA 4Y2JA 2RIPA 3OZFA 2FPGA 3TOCA 5E4FA 5ALPA 2D0PB 2C92A 4BRSA 4KNWA 5FOTA 2BEUB 3WRXC 5G3ZA 1R9MA 4BBPA 3RT7A 1QU3A 1NU6A 1B2LA 3EZ9A 4M87A 5J4HA 4YQZA 4FOLA 1YO6A 2FZLA 5BUZA 1ECGA 3HBFA 4IDHA 3FBGA 3PRHA 3WNZA 3VSDA 2UVQA 3Q5EA 4N3NA 3DKIA 3ZV3A 1Y37A 5L3QB 4JXXA 1Y3CE 4JI0B 3T7RA 3MJDA 4BB0A 4J0KA 1E9RA 1CDEA 2BZGA 2XZPA 4LXYA 3WLTA 1P62B 1T4MA 1UM9B 2FEOA 3ICCA 2XB9A 5EPEA 2D0IA 1JZQA 3HXLA 3A4IA 2PT5A 5AVUA 1QO0D 3NVDA 5AHWA 1SU7A 2GF0A 2MINA 4KOEC 4HWSA 2HQSA 2WJPA 4GKVA 1J9ZA 1I13A 1U2EA 2J4CA 1YQEA 3D43A 3NV9A 3RRBA 1LX6A 1U7ZA 4M1TA 1C8LA 2AOTB 3PGA1 4UM9D 3U7HB 1T6XA 5A1JA 1W75A 4OBXA 3KB2A 2ERXA 2XF2A 2WMDA 4L8GA 3ZZMA 5JBQA 1TMKA 5EXDA 4U2CA 4NTZA 3KWLA 1EG7A 1ZBDA 3GBVA 4UVGA 3M2TA 1CQJB 5JC8A 2J6IA 4QU0A 2A3NA 3O7MA 3HUEA 2FEPA 3STHA 1QRRA 2DJIA 3I73A 5EP2A 3TN7A 2Z57A 2AN1A 3N59A 3P45A 4XIIA 5BV2P 3C98A 4Q24A 1FK8A 3IYLW 3NKFA 3VDMA 2HR1A 5HKBA 2OQRA 3BK7A 1UJ4A 3BB4A 3DMTC 2VTDA 1ONOA 3DVAB 4KSYA 4OKNA 4PPQA 1GQSA 1H9AA 5I47A 3I9JA 1NNEA 4MR7A 2IZ1A 4JLBA 1M1YE 4JOSA 2B1IA 3DH0A 3LD9A 2OXEA 3UYLA 4ZVSA 3TW0A 1GAWA 4RSHA 3NTOA 2RGEA 1QB8A 2CB0A 3A05A 3ABZA 3AR5A 2OEPA 4KRXA 3LCUA 3SSAA 3GJSA 1L1FA 1E69A 1TTTA 1LF0A 1SXJA 3B1WA 3IRUA 1R0ZA 3PNBA 3E5NA 5AJXA 4W5NA 2A88A 1YRBA 5CT8A 1SQ5A 3W34A 4NYMR 3V80A 2JZOA 2EHJA 1Y7PA 3KKOA 3SGLA 3IIEA 3TZQA 1IZZA 2OHXA 1GQRA 4IM7A 4MWDA 2PBLA 5EHGA 4JJEA 3WBFA 3E15A 5E2BA 4OGGA 4L8WB 1U04A 4RBNA 5JAQA 2ZIAA 3UB2A 5ED4A 5EJIA 1C0KA 5I8PA 3UFXA 3E5HA 3PC6A 3AEQB 2BFCA 1XTSA 4ZVUA 1B2RA 1VSQA 3PL1A 3WGJA 3AM4A 2EZTA 3QKSB