1F14A

L-3-hydroxyacyl-coa dehydrogenase (apo)
Total Genus 119
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
119
sequence length
291
structure length
291
Chain Sequence
KIIVKHVTVIGGGLMGAGIAQVAAATGHTVVLVDQTEDILAKSKKGIEESLRKVAKKKFAENPKAGDECVEKTLSTIATSTDAASVVHSTDLVVEAIVENLKVKNELFKRLDKFAAEHTIFASNTSSLQITSIANATTRQDRFAGLHFFNPVPVMKLVEVIKTPMTSQKTFESLVDFSKALGKHPVSCKDTPGFIVNRLLVPYLMEAIRLYERGDASKEDIDTAMKLGAGYPMGPFELLDYVGLDTTKFIVDGWHEMDAENPLHQPSPSLNKLVAENKFGKKTGEGFYKYK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords L-3-HYDROXYACYL-COA DEHYDROGENASE
publication title Sequestration of the active site by interdomain shifting. Crystallographic and spectroscopic evidence for distinct conformations of L-3-hydroxyacyl-CoA dehydrogenase.
pubmed rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 119
structure length 291
sequence length 291
chains with identical sequence B
ec nomenclature ec 1.1.1.35: 3-hydroxyacyl-CoA dehydrogenase.
pdb deposition date 2000-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00725 3HCDH 3-hydroxyacyl-CoA dehydrogenase, C-terminal domain
A PF02737 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1f14A02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1f14A01
3DAPA 2R2GA 3S2EA 4W9NA 2I5PO 4JJGA 3BMOB 1J0XO 4J7UA 3CMCO 3I23A 4NFHA 4OKIA 4EBFA 3DWFA 2IODA 4MINA 1YWGO 3Q11A 4CMBA 4ZQHA 4XRGA 4Z0TA 1M6WA 3F4LA 3BMOA 5L4LA 4NBRA 1DOHA 4XKJA 3JQ9C 2EKLA 3ZNNA 3ZWMA 2VHYA 1YRLA 4XYGA 1WZEA 2YJZA 5H83A 4U0KA 3W6UA 5ER6A 4CM6A 3FF4A 1GFSA 3JYQA 4LRSB 1E3SA 1NASA 1LC0A 5ENDA 4NG5A 1RYDA 2I66A 3FR7A 1Y7TA 4YB8A 2UAGA 4Y98A 5T64A 3T4XA 2VT3A 4FIZA 2DQ4A 5JAIA 1SMKA 2CNBA 3DBHA 3G1UA 3NKLA 4CMCA 4BKOA 2WD8A 4CPDA 4EUFA 4JXKA 3UH1A 4CUJA 5IZ4A 1NNUA 1WVGA 4TMFA 4XGNA 1ZMOA 2CF5A 4NR0A 3NT4A 5JO0A 1N1GA 4RF3A 1BG6A 3VAZA 1U8XX 1DB3A 2YHUA 4HNHA 4B3HA 1HYEA 2D0IA 3V2GA 1DHRA 4B7XA 2GN8A 2VHWA 4UULA 1UXIA 1R66A 2ZCVA 2HCTA 4KUHA 1H2HA 4XYLA 3VHRA 5CDUA 3M1AA 3HJAA 4ZD6A 2P9CA 4UUOA 3IKTA 4RJTA 5JDCA 4L4SA 3RC2A 2BFPA 3BTUA 4HFJA 3LK7A 1SB9A 2ZJ1A 3KSDO 1GV1A 2Q99A 3R1IA 4N5LA 4PLPA 2HMVA 1A4UA 1G1AA 2FRDA 3Q6IA 3RWBA 3RU7A 3PQDA 3ZW8A 4EUEA 2FR1A 2JJYA 1KEWA 2GERA 2NU7A 4XQGA 5DZSA 2GF2A 4CMHA 1ZSYA 3W6ZA 3QVTA 2X4GA 4S1VA 1XG5A 4BGIA 4R5MA 3GN1A 4AJLA 4MVJG 2DTXA 2C7GA 3TL2A 4EDFA 5JBIA 3SBOA 1ADBA 3ANMA 4GX1A 1NFRA 3S8MA 4BUCA 1JKIA 4ZU3A 2EV9A 3MWDB 3OECA 3OM9A 2JKVA 5AXDA 4FGWA 5JMPA 3H9JA 5ES3A 4R1UA 4RVSA 3ZHXA 4GX5A 2F1KA 3BZUA 5HM8A 3MEQA 3I1JA 2VTEA 4XR4A 2GYYA 3FBGA 1U3TA 4BQPA 5IDWA 4Y67A 1DO8A 2NU8A 2O2YA 4CM9A 4FFMA 3Q2IA 3H5RA 2YDYA 4BVAA 2FOIA 3NGLA 2B5WA 2D5CA 2VNAA 4Q3CA 4AJEA 1V6AA 2RAFA 4BNYA 1LQTA 5AVOA 4D3SA 4DC1A 1E77A 4C7JA 1BRMA 5TGDA 1EUZA 3UKOA 1PS8A 3QE3A 4Z9FA 3PVZA 2C59A 4IBOA 4Q3DA 1F8GA 2DC1A 4R68A 4GBJA 4A26A 3GEDA 4IS2A 4YJHA 4TROA 3I3OA 4ZRNA 1KBZA 5CP8A 4XCVA 1W0CA 3CE6A 1LDYA 1YDWA 3RUIA 1P0FA 2OO5A 4F46A 4F45A 4OH1A 1SZJG 4RPJA 3TZCA 1IPEA 3C8MA 3GEGA 4AJPA 1CRWG 3A28A 4GL4A 1A7KA 1H2BA 4N7RA 2Q1TA 3VDQA 4JJFA 2JAHA 3BTVA 1JTVA 4DREA 4FPXA 2X86A 4RGBA 1HDXA 4I5EA 5A06A 2PD3A 3PHGA 3UFXA 1H6BA 1P3DA 4YT5A 4II2A 1KEVA 1PJTA 3E5RA 2EG9A 2Y1GA 2Q1SA 3GH3A 1DIHA 3RJ9A 3IQDB 3K2EA 1ZEMA 4OKNA 2Q4BA 2Z1MA 1KIFA 3FNEA 1WLYA 1M6HA 3DB2A 1ORRA 2E49A 4RZIA 1UXGA 2YHIA 3ZV4A 4DWVA 3W4IA 3QWIA 4KWHA 1ONNA 1ULUA 3EHEA 3D64A 3WGQA 3KUXA 4CMGA 4FQ8A 1M67A 1BTOA 2FZEA 3JQ9A 1UDBA 3L6DA 1VJ0A 1OBFO 1Q0QA 1X15A 1Q7CA 4R41A 1U2GA 2QX7A 5CEEA 5FEUA 3QWAA 3I9MA 1J4AA 3GDGA 5HWSA 1Y8RB 4CM3A 4MVJH 2XPCA 4KDEA 2PGJA 2QQ5A 1R6DA 3RFVA 1ENPA 3PYMA 4H16A 1IL0A 3L9XA 5DCUA 2E37A 3HADA 2TMGA 1LJ8A 2DM6A 1EMDA 3O03A 1SEPA 3EMKA 5TJHA 4FCCA 4B4UA 1NVMB 4FC6A 4K6FA 3K6JA 4J3FA 3UGKA 3S2IA 3ANLA 1QKIA 3JQBA 1G0OA 4PLCA 4TWRA 5JPIA 1PWXA 1WPQA 1GUFA 1JVBA 1GYQA 4XDYA 1RM0A 5DOVA 4E0BA 5A03A 4YXFA 4CM4B 2C82A 2DBRA 1ZSNA 4FC7A 4R01A 3VKUA 3GPIA 1EE2A 3WR5A 4B4OA 2YFQA 1JVSA 3KLMX 1LTHR 3HDQA 3QVWA 2FR0A 3ENKA 3GNSA 4OXYA 1XA0A 1LBEA 1BSVA 2O23A 4CUZA 1A71A 3FTPA 5TF4A 3FD8A 2GDZA 1ADCA 2EGGA 4DA9A 5JS6A 5F21A 1LQUA 2DKNA 3N7UA 4U0JA 3V1YA 5A4DA 4NBWA 3DQPA 5CPFA 4GI2A 1ZBQA 2DUUA 1DEHA 4J1QA 1LXCA 1NPYA 1B14A 1UUFA 2BGKA 2PKQO 3TOZA 3DBVO 3PRJA 3WWYA 2DBVO 2YHIB 4KTVE 1JKJA 4IXWA 3DBRB 2YV3A 3ADOA 1KVUA 1IOLA 3UW3A 2Y0CA 3MJEA 2OFPA 1FMCA 1NM5A 1YBVA 3DBRA 4CJXA 3GAFA 1HKUA 4R3WA 1E5QA 2P4QA 2ZTLA 1PJ2A 4NJMB 3JQAA 1DC6A 5FI5A 3PJFA 3W1VA 1VSUA 3GMDA 2F00A 3H7AA 2JD2A 2PH5A 4BKUA 1CDOA 2HJSA 5F5NA 4CMIB 4RORA 4IJKA 5L51A 3SJ7A 4XGIA 1YQDA 3STHA 3BHJA 5TSDA 2X9VA 1AUPA 5LC1A 1GADO 1E3WA 3QWBA 4IJWA 1YH3A 4M55A 3WYBA 3KYDB 5GY7A 1E7WA 4U6SA 2Y67A 4L8VA 3FNGA 3KEQA 1DPGA 4PVCA 2AEFA 1UAYA 1Z45A 5KKAA 2Y05A 2XOXA 1EVZA 4XRRA 3TFOA 3IOYA 3EAGA 5AQ1A 3AY3A 5CHEA 5FFFA 1GZ3A 2WJPA 3H65A 4BNHA 1MXFA 3AWDA 3JD2A 5TJ9A 4CMKA 2PD6A 5JCJA 2BH9A 4R1NA 4MIYA 5A3VA 5TNXA 4I08A 4LCEA 2XAAA 1KC1A 4MVJD 4WOJA 1DXYA 4DUPA 1JAXA 1TA4A 3GF4A 1PS9A 1YBAA 4YRAA 1I24A 6LDHA 2VN8A 5TS3A 5C7OO 3I52A 1M2WA 2OMEA 3AI2A 1W73A 2BI7A 5F3RA 2WE7A 2D2IA 2NVBA 4PLGA 2GZ3A 3EGOA 2OP1A 4N5MA 2OUIA 1N2SA 1GYRA 3S2GA 4GKVA 5ILOA 3KRTA 5LDHA 1P1JA 2DVMA 4P4LA 5THQA 4PRKA 1XU9A 3BYZA 1E5LA 4CV1A 3NTOA 3QV1A 3VZRA 4A2CA 5KTKA 1YB5A 1NX6A 2RHRA 3ASUA 3I6QA 4TRMA 2GUGA 3ORFA 4NQZA 1HT0A 2HUNA 2J3KA 2IZZA 4WECA 3PWZA 1GEEA 1R0LA 5JCXA 3VZSA 4ZN6A 4CMEC 1A72A 4PZCA 5IXSA 1DBVO 1JU9A 3PGJA 3ZWOA 1B3RA 3VH3A 3E9NA 3EYWA 3K9QO 1U3UA 1E3LA 3DBLB 4WLVA 4EYEA 1J49A 5JW6A 3FHLA 1P1KA 4AJ1A 1HTBA 4JK3A 3WQSB 3VVCA 3ZWNA 3E6AA 1F12A 4OQZA 1MA0A 2VZ8A 3PFFA 4LGVA 3ZV5A 4Y8VA 3A1NA 3BMCB 2CMDA 4CMEA 3K8ZA 3BXXA 4G5HA 4HUJA 3GNTA 1QYCA 4L76A 3B1FA 4WCFC 4MP6A 4E2YA 1M76A 3ZGYA 1MP0A 4FS3A 3I9JA 1U28A 2AA3A 1SNYA 4P4NA 4ALMA 5AXCA 4BS9A 1UAGA 5CEFA 8ADHA 2C2XA 4GMFA 1IUKA 1DC3A 1ZKMA 4BO4A 3QY9A 3OJ0A 3L9WA 1T2FA 1UP7A 1XGKA 1TLTA 1WXDA 1E3JA 2G1UA 2Q1WA 1UR5A 1TB4A 1LRKA 1FDUA 2Z1NA 1PEDA 2Q2WA 5A5FA 5L95A 4Z0PA 1P0CA 3KLPX 4FGSA 2OL4A 3AY6A 2P5YA 1Z7EA 4J2OA 3GRPA 2O3QA 1LSUA 1DRWA 2NU6A 1PIWA 1EVYA 1HZJA 3IC5A 4ND1A 4WEOA 1UZNA 2EKPA 1DLJA 2AEJA 3GLQA 1X13A 4FJ0A 5CDYA 3PIDA 1T2EA 3GC6A 1D8AA 2PWZA 3ZNOA 4OXNA 1JKFA 3A14A 1WWKA 2ZQZA 2EWMA 1EBFA 1YGYA 3WX0A 3PK0A 1PU2A 1NFFA 3HDHA 4E21A 1T4DA 4RF2A 3VH1A 1BDMA 2V7PA 4ALLA 2CFCA 1TT7A 3LQFA 3OF2A 1XELA 2C7VA 2DPGA 4EGFA 3M1LA 3UCXA 1QLJA 2B69A 1BXGA 1B2LA 2QZ9A 1NR7A 1EUCA 1XYGA 3WSVA 5DOZA 3HZZA 4WLOA 2W90A 3CKYA 2H6EA 4FFOA 2Y68A 1V3VA 3LF1A 4Q39A 1ONPA 3ZHYA 1ZO8A 5G4KB 4GWKA 1LDGA 1YOVB 4BHTA 3H9EO 2FN7A 2EF1A 2UV8A 3EVNA 4YRDA 2V6MA 4CV3A 2I76A 4JBIA 1J6UA 4ILKA 3WXBA 5EMHA 3ZWVA 2IEDA 1SPXA 3ZU2A 5K6AC 4D0SA 3ROPA 4D44A 2RIRA 3NDRA 4ZQEA 2B4QA 3H3JA 3MOIA 3PEFA 3L07A 1PTJA 5CAEA 3BMNA 2QRJA 4FOOA 4HKTA 3AU9A 4PG4A 4PGFA 5EL0A 4N18A 4J49A 3NT5A 1I3LA 2H63A 4LSWA 4CM8A 3V2HA 5I8WA 1ZNQO 3E8XA 3ITDA 1GUYA 4HWKA 1HSOA 1UZMA 5KVSA 3CPSA 2P2SA 3A06A 3HN7A 4UVDA 1I33A 4CLDA 2CDBA 3CZRA 3VZPA 3H3FA 5GZ1A 3SLKA 1LRJA 2GZ2A 1N9GB 5BR7A 3N74A 1N7HA 1VL6A 2B35A 1QV7A 1N92A 2ZQYA 2NSDA 4BNLA 3GFBA 4CR7A 3JSAA 5IG2A 3DAFA 1GQ2A 1ONOA 3DZJA 1VJTA 5HA5A 3WGHA 2JD0A 5A5EA 4MDHA 3ZNQA 4I5GA 5EESA 3PQFA 1I36A 1QR6A 1PZHA 1TI7A 4YDRA 5ILGA 4BNNA 1W8DA 3B20A 5G0TA 2YUTA 2HAEA 4KTTE 4MP8A 5TT1A 4WJZA 5IAAA 1L7EA 5MDHA 3ZHBA 4F6CA 4R51A 3L77A 4E5YA 2J5KA 2QYSA 2DU8A 2VZ0A 4CLOA 4P38A 1YJ8A 2IE0A 1HSZA 2RHCA 4TQGA 4J43A 2NVUB 2LDXA 1YKFA 3DFZA 4K6CA 3RVDA 2C07A 4BKRA 4XD2A 2VZ9A 4GX0A 1LSSA 3DOCA 3F3SA 5ICSA 1TT5A 5B1YA 2E4AA 1WNTA 2I67A 2H9IA 9LDTA 4MP3A 3SC6A 1PX0A 1OAAA 3JQGB 1D3AA 1KVRA 2V65A 4KWIA 5T67A 5GMOA 1ZH8A 3WGZA 1P44A 4DC0A 3I83A 1Z73A 4WLFA 1PR3A 2YQ4A 1QXSA 2GD1O 3CEAA 3WBFA 2NADA 3JYLA 1A9ZA 3ULKA 2I3AA 4YQZA 4HV4A 3UICA 1VM6A 3INRA 1MB4A 1YXMA 2VUSA 4IS3A 3UUWA 3NJ4A 5L4NA 1LA2A 4OSOA 3I9KA 1U7TA 4HADA 1MG5A 4NNJA 1VKOA 2RH8A 1V8BA 4UVGA 1YO6A 1C3VA 5JE8A 3FWZA 4D46A 4IDDA 2X23A 2A4KA 3ASVA 4GLOA 5JYEA 4G65A 2UYYA 3EC7A 5TT0A 1T4BA 1O0SA 4YCAA 3E82A 1WDMA 3MCVA 2FZWA 4MPDA 2VOEA 3WGOA 4ZHSA 3CUKA 4OSPA 1XSEA 4O0LA 1P77A 3HDYA 4GSLA 1Y8QB 3WJAA 4RZHA 4BO7A 2C2YA 2HKIA 5I8ZA 3DXFA 3HFSA 3ZCXA 4BO1A 4JNKA 3WOHA 2VHVA 3B1JA 2IEBA 4WCDA 1ENOA 1HE5A 4E4YA 4EZBA 1EK6A 3LYLA 1GZ6A 1HXHA 2WM3A 4I9HA 4OO3A 1FDVA 1MFPA 4J9UE 2H5LA 1RM5A 1R0KA 5JXWA 2ZTMA 1C1XA 2E48A 3RI3A 4DIFA 5BSHA 1K6XA 4NJMA 3FPCA 3T7CA 1N7GA 2TMDA 3PZBA 3RUDA 1ZJZA 1JW9B 4FSHA 4LISA 3COSA 3RKRA 4BNZA 3CZMA 1BHSA 2C5EA 5DCWA 5KKCA 2O7QA 3ZWWA 4WOKA 4ND4A 5G0VA 4XYBA 4BO9A 1PGOA 2IZ1A 2GZ1A 2YQ5A 4PLHA 4IPTA 1AE1A 3VKVA 4JBHA 3O38A 1PL7A 3WMXA 3KBOA 2BI8A 4QECA 3UHAA 1PL8A 2WWRA 4BO0A 3M2PA 3OH8A 4BOYA 3MJTA 4WCFB 3INGA 2NQ8A 1KVQA 3TZKA 5KJ1A 3D1LA 3OETA 4PIVA 1C0KA 1T24A 3Q9UA 1RM4A 1KY5A 4B4WA 1V0JA 1X7HA 3G49A 4W4TA 3PFWO 4NH4A 3KVOA 4BNFA 4S3MA 3WDSA 1H6DA 4A5OA 1KVTA 1IB6A 1T26A 1EFLA 2CZCA 2RCYA 3OJOA 1LLDA 2GRAA 1SBYA 2PH3A 1ENYA 4YAEA 1HE4A 1Q0LA 1GYPA 4X54A 4UVEA 4XX0A 4D41A 1H94A 4PN3A 3HB5X 1YB4A 5JYDA 1H6AA 1H93A 3RAJA 1S6YA 5DBFA 5THKA 4CL8A 3OFSA 5EINA 1U7HA 4LMPA 2B83A 1NVTA 4DMLA 1Y8QA 5AXAA 3PXXA 3GHHA 2VYND 3I9OA 4MVJE 3D7LA 1Q1NA 1NXQA 2VCYA 4JP3A 4B8ZA 6ADHA 3AY7A 1V3TA 3GMSA 2AG8A 2GN4A 1XQ6A 3DR3A 3I4FA 3ITKA 3E9QA 3O8QB 3TFQA 3DONA 1QV6A 4WNIA 1E6WA 2JFHA 1KY4A 5C7IO 4WUVA 1C14A 1HE2A 4K9DA 5C7LO 1ISJA 3QWFA 5G0SA 3U3XA 3DMTC 1EQUA 4EI2A 1C1XB 3CINA 3EZLA 3NUGA 4XJSA 2D4AA 3D4OA 3INTA 3OQBA 4LRTB 4E3ZA 1ISGA 1IHXA 1Z6ZA 4RLSA 4AJ2A 4QUKA 3I9LA 1HDGO 1PJSA 1MFZA 2GR9A 2R6JA 1CERA 1GZ4A 1QYWA 2C54A 4HFRA 3NAQA 3ZDFA 4DIOA 3BAZA 3RC7A 4YRBA 4Z9XA 3M6IA 4OL9A 3RJ5A 1GTMA 1E7QA 3RD5A 3KZVA 1C1DB 3JYPA 2PLAA 1B8PA 4EJ6A 3DOOA 4PLVA 3O26A 4YAGA 3B6ZA 5A9SB 3PWSA 3FI9A 1V9LA 4ESOA 1H5QA 4FDAA 2YV1A 5CPBA 1K0UA 4B3JA 4EITA 3L4SO 4W9NC 3JTMA 3TRIA 2BFMA 5B4UA 4AJOA 1EDZA 4I8XA 4ND5A 4YJGB 1YJQA 3F47A 2P5UA 2W8ZA 1ZZEA 4O6VA 3MJVA 4RVHA 5IF3A 3TDKA 3RFTA 4PFJA 1AGNA 3EK2A 3GGGA 4XDZA 1B26A 4P8RA 3VPGA 2NNLD 3H5NA 3DBHB 1CETA 3W8FA 5I9MA 3DMYA 1R12A 2QRKA 2AG5A 4E5MA 4KUGA 5BT9A 5A02A 4D3DA 2ZB4A 3KETA 1HDZA 1PR9A 4CQLB 4ZJUA 4AJIA 2DTEA 2X0JA 2X0RA 2QHXA 4RPHA 4JGBA 1HE3A 1UXKA 5IFLA 2BD0A 1FXSA 4FJ1A 4FB5A 3DZHA 3WS7A 4CQLA 4QXMA 3PGXA 5IDXA 4EJ0A 2AQ8A 4BO3A 2YZ7A 3W8DA 5L53A 1T2DA 5KOIA 1LLUA 1LLCA 2EP7A 1E1NA 1ZUD1 4TKLA 4CLRA 1E1MA 3ABIA 3JV7A 4MKRA 1YL5A 3TZ6A 3FSRA 1XU7A 3W4JA 2Y1OA 4RVDA 2Y0EA 1SEVA 1WAMA 2VYVA 3QVSA 2PZJA 4LCJA 2JFFA 3F5QA 5BNIA 4EJMA 2IDZA 3QLJA 2BHLA 4J4TA 3ANNA 3ZV3A 5L40A 1JQBA 3JD1A 3G0OA 1O94A 1X0XA 2GCGA 3WTCA 3DBLA 3S55A 2GO1A 1RKXA 2AQIA 4JX8A 2VHZA 3T7EA 2VWQA 2VWPA 2GN9A 4FFRA 3UAGA 1E1KA 1NTOA 4Z9YA 4YT2A 3LT1A 3GVPA 2C20A 1YB1A 2WE8A 2OP0A 3IJPA 4TSKA 2ET6A 4CM1A 4CQMA 4DLAA 3RC1A 1VC2A 2YY7A 2GN6A 4J16A 1BGVA 3VTZA 3AI1A 2VQ3A 5DULA 3SC4A 4YJDA 4E13A 3OQ6A 1EK5A 3LLVA 3R3JA 1P33A 2X9GA 4Q9NA 3IP1A 1PZEA 1PQPA 1KC3A 4PLFA 3B1KA 5T5QA 1Y6JA 3AM5A 1WZIA 3VPXA 3H9UA 3H9GA 1E7YA 4BO8A 1JLLA 1U4SA 1EQ2A 3E1KA 5F1OA 1H0KA 3IKVA 3OEYA 1P9LA 5JC8A 5FYDA 3WMWA 4DQUA 3EUWA 1H9BA 1OFGA 3U0BA 5DP2A 4IY1A 4M1QA 3X2EA 2EP5A 2G76A 4IGFA 3WLEA 5K0ZA 4CM8B 3GNQA 1ZVMA 3KO8A 1N8KA 4OM8A 1LSJA 3GVIA 4JCOA 3F46A 5B4VA 4ZRMA 3NYWA 3KXDA 1SAYA 3RUHA 2X9NA 2J8ZA 4XYEA 4CR8A 2P91A 3F9IA 1K6JA 2CDAA 4E12A 3ZWCA 5ICMA 4DPLA 2HK7A 3EY4A 3F4BA 3FN4A 3JQBC 3JQ8A 3OICA 4BMSA 3DO5A 1XCBA 4PG5A 4CLXA 4ITUA 1NPDA 2CF6A 4BNUA 1BXGB 1T1RA 1U1IA 5G0WA 2NVUA 3RBVA 3OA2A 4CQMD 1TT5B 2BGMA 3DHNA 1NFQA 3L4BA 3NT2A 3QP9A 2Q49A 4D43A 2W2KB 2O4UX 3GAZA 4CQMB 4D7AA 4ZGWA 1IPFA 2ZATA 4GAEA 3VC7A 1NAHA 4I5FA 4AL4A 3VPHA 4YEDA 2PFGA 2A92A 3U5TA 2FR8A 2J6IA 1YONA 4MJLA 3GVXA 1BXZA 1A4IA 3JYOA 4W7HA 1O8CA 1GV0A 4FJ2A 4MVJF 1MGOA 3D3WA 4NU5A 4BO6A 3I9NA 2HO5A 2X8LA 4E6PA 3NX4A 5TLSA 5I9LA 4PG8A 3GGOA 3VOSA 4NFYA 3C7AA 3U4DA 4K28A 2UDPA 2NUAA 2OOSA 2DUWA 3AM4A 3D5QA 4HY3A 4LMRA 1B3BA 1PJCA 1HDOA 3LZ6A 3RROA 4C4OA 1VSVA 2Q46A 4MKXA 1Z7BA 1P1FA 3MOGA 2AW5A 3WICA 1D1TA 1RJWA 3OMLA 1NWHA 5COBA 2G17A 4GH5A 3GA0A 5U4QA 3BTSA 2NWQA 3GY0A 3H9QA 5L9AA 2J5RA 3KV3O 3DDNA 5TRTA 5JCJD 4IDAA 1ZXBA 2G82A 2D5AA 4TVBA 1P31A 1I0ZA 1AN9A 5FI3A 2EHDA 4IMRA 2VUTA 4JP2A 4RF4A 5IN5A 3HQ4O 4MVJA 1CEQA 1P74A 3S2FA 5BSEA 4IDGA 4E2ZA 1YBMA 3IUPA 4YTEA 3CMMA 3M2TA 1MC4A 1QRRA 2ZB7A 3PZRA 4NHEA 3GQVA 4YACA 3GDOA 4A03A 2R00C 3RSHA 4E33A 2D3TA 4XWYA 5GZ3A 8LDHA 5L7TA 1X14A 4RVUA 3OJEA 4ALNA 5KWEA 2OORA 2PZKA 4LVCA 4XB1A 4FW8A 4QTZA 2B5VA 3TNLA 3ONFA 2B36A 3UCFA 3VZQA 4FFPA 4BMVA 3DAGA 2ZTUA 5ITVA 3V2UA 2BFAA 2X6TA 4BNMA 1XWFA 3IJRA 4IMPA 3IMFA 3P2OA 3PPIA 4L0QA 4O59O 2D8AA 3WIDA 3JQFC 2X0IA 2OGUA 3C3XA 4XA8A 4I1IA 5CDGA 3T4EA 1UXJA 5EERA 2JD1A 3V1UA 5IDYA 4IXTA 4WLEA 4ID9A 3ADPA 1B0AA 2O3JA 3NTQA 4IDFA 4C7KA 4AJNA 5HRUA 1VRWA 3FNHA 4NIMA 2PY6A 4DTIA 3P7MA 1E7RA 1BW9B 3L6EA 4Y6SA 4GGPA 2X5OA 2X7HA 3GG2A 2VRCA 4KDFA 4MVJM 5JC1A 5BSFA 4YPOA 4RDIA 2Y0DA 3C85A 3DFUA 4URFA 1P45A 3RIHA 4A73A 4QSMA 2R00A 2AE2A 4ROSA 3H6KA 4MVJP 3KYBA 5U1PA 3Q1LA 4ND2A 1UP4A 4PG7A 3TL3A 2CDCA 2CUKA 3BMQB 5EIOA 5L45A 3D5TA 1PJLA 2B4RO 1DDOA 1DIRA 3IDSA 4FBGA 1B8UA 3GDFA 2Y1CA 4HXYA 4OXKA 1Q7GA 4K26A 4J1SA 2OXIA 3Q9NA 5KJ6A 1S7CA 5MGBA 3BMQA 3NGXA 4DLLA 4WNCA 3IP3A 2JCXA 2ZIZA 1E1LA 2Y93A 1TEHA 3GUCA 3RASA 2CVZA 1FDWA 4Y6RA 4ONEA 3H8VA 3MJ4A 4GKBA 2J3IA 4INAA 4U8GA 4IQ0A 4UUMA 3K96A 2FPGA 2DLDA 1ZXLA 3KYCB 4DYVA 3NJ8A 5I7EA 1I2ZA 3U4IA 4ALJA 4Z6KA 3DHEA 1AHIA 1XQ1A 1PGNA 3AI3A 4J7XA 1V35A 3Q2KA 4BO2A 2O7SA 1CYDA 1CF2O 1X7DA 2JCVA 3AUAA 4RVFA 1LI4A 2O50A 2IZ0A 5COAA 3TPCA 1HLDA 1M66A 2UVDA 3L4BC 3MJCA 4ALIA 2EIHA 1E92A 1E7SA 2DTDA 4CM5A 1X1EA 3TSCA 4NBVA 3JD4A 2V6GA 1OMOA 1KOLA 1C1DA 1DFHA 1Y5MA 4NBTA 3RUFA 3OEWA 3ONDA 3JQCA 3DZGA 3WGIA 5F1KA 5A05A 1QP8A 2GNAA 5BNFA 4W99A 3LU1A 1NAIA 2PR2A 3QSGA 1AXEA 2QZZA 4QFCA 4DBVO 2QW8A 1BW9A 4DGSA 2VT2A 4J4HA 4PVDA 2EW8A 1GDHA 4YJGA 1R4NB 5HS6A 3ZHZA 1CQIA 1GR0A 2G5CA 1U5CA 3QVXA 5JSFA 4RO0A 3BHIA 2EERA 3WFIA 4D3FA 4M86A 4E2XA 4B3IA 5JAZA 1ZMTA 4OQYA 1N5DA 3VH4A 4PCVA 3WIEA 5LCXA 3FRJA 3LT4A 1A27A 3CTVA 4M89A 4BQRA 1CJCA 4M8SA 4PG6A 5C37A 3C7DB 1KETA 4KQWA 2HDHA 1KYQA 2PV7A 3E5MA 4RPKA 4U6QA 3MWEB 5L7YA 4DL9A 2A9FA 3PYXA 3F5SA 3CSDA 3AOEA 3ON5A 4B8WA 4BL5A 3ICCA 3O8QA 3IIEA 1LSOA 1IYZA 4TRNA 1YQGA 3GVCA 2PZLA 1EBUA 1I2CA 5JLAA 1XR3A 4II3A 1R0SA 1Q2XA 2BKAA 4O5OA 4PRLA 4Q3EA 4AJKA 4OMUA 4XJTA 1OC4A 4YWJA 5T8KA 4HX5A 5L4SA 1TVEA 4RDHA 2AQKA 2Z5LA 1HDYA 1D1SA 5J23A 3KSZO 4RV9A 1ENZA 5KIAA 3GR6A 1K5HA 2OZPA 1C0PA 1ZEJA 4IZIA 3KEOA 1RM3A 2C29D 1QSGA 2HLPA 3PHIA 4FD3A 2Q2VA 3K2BA 2WEKA 3AUTA 2ZB3A 3GZNB 5JDCC 3JQ6A 4R1TA 5EPOA 4J7CA 2FP4A 2ZYAA 3G17A 2PA3A 4LW8A 1ZK1A 4XIYA 1ML3A 3PJDA 4DVJA 3OBBA 2EJWA 1MC5A 2DPHA 3ZN2A 1U9JA 1CWUA 1NQ5A 2O48X 3OIGA 5JAMA 1JDJA 4M49A 2O4CA 2G0TA 5AOVA 5JMWA 5EQDA 4PZEA 4WLUA 4F3YA 2HK9A 5JY6A 3L0DA 1UXHA 1BDBA 4M87A 4RL6A 5C3MA 4UREA 4CUKA 9LDBA 4IQGA 3WGTA 1ISFA 3D3EA 2ZCUA 5DBGA 1VI2A 4IIVA 2BFOA 1O6ZA 3ETGA 4L74A 3C7CB 4BV9A 1R4MA 3KHUA 3AJRA 1LU9A 3ICPA 3QIVA 4KMSA 5B4TA 1NQOA 1KERA 5I9NA 2WMDA 3NDJA 1GEGA 5K9ZA 1AXGA 5KVVA 1LEHA 3QW2A 1Y9AA 4D0RA 5A3JA 3RQSA 2BELA 3FCOA 1ISHA 1GAEO 2CD9A 4YAJA 3WNQA 2C5AA 3JYNA 3TWOA 4IUYA 4XQEA 4ZQFA 1LDNA 1XHLA 4YJHB 3OIFA 2POQX 4CV2A 5IXYA 1OOEA 1I3MA 2AHRA 3GUYA 4CLRB 3SEFA 2QYTA 1N9GA 1ZIDA 4RCVA 4DPMA 3QJ5A 3O4RA 4D45A 1LUAA 2HMWA 4YAKA 3GOHA 3UN1A 5CDSA 3EDMA 3KOUA 4OOFA 3FTNA 5CDTA 5KNLA 1PJ4A 2WD7A 2Q3EA 1GQQA 1XIVA 3PLRA 4FR5A 4OGWA 5AXBA 2ZKLA 3TZHA 4R9RA 1U8FO 1H6CA 3ZU4A 3DZIA 1GCUA 1PWZA 4IINA 1NHGA 4QT0A 1SOWA 4JROA 4CLHA 4FOSA 4HFMA 1LRLA 3DOJA 1G0NA 5JDIA 4F6LA 1ADFA 4E31A 1YOVA 3OQ1A 3PDUA 1LDMA 1D7OA 3ROQA 4TZTA 4CLOB 4NDNE 1NR1A 3WSWA 3SX2A 3GZ4A 1IZ0A 3MZ0A 1MG0A 2FY8A 4UEJA 4BGVA 4BNVA 1K89A 2CY0A 3TF5A 3PIIA 1SO8A 2X1HA 3ZU3A 3IL2A 4RLHA 1F8FA 1GPDG 1K3TA 1U3WA 3JD3A 5KJCA 2AMFA 3D0OA 4XZ3A 1A9YA 2AEMA 2ZTVA 3JQFA 5B12A 1FJHA 3VPFA 3GG9A 3GPDG 1HYGA 2HU2A 3DZKA 4Z0HO 1HDRA 3PHJA 4AFNA 4JBGA 4L9RA 3ZWPA 3S1LA 5I7SA 2H1SA 1LNQA 3C1AA 5KVCA 5H82A 4MIOA 4NBUA 4G81A 3JQ7A 2NTJA 4NI5A 3NRCA 4OAQA 1ZK0A 4UUPA 2HMUA 1W6UA 2VYVD 1NBOA 3JQ7B 4PLWA 2EEZA 3FR8A 4KOAA 1EUDA 4AVYA 1QYVA 1A5ZA 4WKGA 3V5NA 4CM4A 3ZU5A 2O2SA 3G3EA 4BGEA 3VH2A 4J0FA 3NDIA 3GRKA 4BO5A 3JQ8B 1MV8A 4BKQA 4BNXA 5LDGA 3GEMA 1F06A 2QG4A 2WD7B 3LVFO 4KP7A 1KS9A 2IYPA 5IZCA 1U2DA 4YAIA 3AU8A 3U4HA 1NPTO 5G0UA 1O95A 1NYTA 4BGUA 2D1YA 2BRUA 2NTVA 4K1LA 3WWZA 2AXQA 1Z75A 1EDOA 2J5QA 4GPD1 5FWNA 3JQAD 1YQXA 3LC2O 2O3TA 4XYMA 5CG2A 1F0YA 1DAPA 1I3KA 1VKNA 4BKPA 1J5PA 3KSUA 4J0EA 3D3WB 2JCYA 4U5QA 5F1PA 1EVIA 3ENNA 3LSYA 4AICA 5JAQA 4M54A 4WGGA 2I6TA 3TJRA 3OIDA 4RQUA 3HG7A 1F17A 5JNLA 5H81A 3U4CA 3Q3CA 1GL3A 2C0CA 4WCFA 5BNTA 4KUEA 2Q4EA 4JLWA 2HQ1A 4HP8A 2VRCD 5HTOA 3F1KA 3WYCA 5HS4A 4OJNA 5IZCC 2P9GA 3FNFA 1I10A 4H7PA 2I9PA 1JAYA 3RUCA 3TN7A 3BHMA 2EXXA 3V8BA 1PQUA 2X0NA 4ZICA 2X5KO 2I99A 3P2YA 3K73O 1IZ9A 1F14A 3LF2A 4Z3DA 4TKMA 3AW9A 4E2WA 1DAOA 2WYVA 4HFNA 1HRDA 2IXAA 1CQJA 4GQAA 1L1FA 4CODB 4J4BA 5JY1A 1U5AA 4YR9A 4WPGA 3EZYA 1ISMA 3N58A 5A1TA 4AG3A 5G2OA 2AE1A 4Q3BA 3IAHA 1BXKA 1MXHA 1B16A 4UEKA 4BMNA 4JN6B 3H2ZA 3PYLA 1WDLA 1CIVA 1XKQA 3DEYX 1MX3A 1A7AA 2A94A 2YDXA 5I7FA 2ZJ0A 3MJSA 3ZV6A 3AM3A 3D4NA 4G2NA 4GSKA 4E32A 2LDBA 2EGHA 5F5LA 3UVEA 3PLNA 3U62A 1EZ4A 1WMAA 3ROMA 1SCUA 4R16A 2PGLA 1GQYA 2DFDA 3NV9A 1BWSA 1OZAA 2RBEA 3WQQA 1UZLA 1PQWA 3LDHA 1QG6A 5A04A 4YT8A 4ND3A 5IDQA 2ZYDA 2EKQA 3WB9A 2X22A 4Y9DA 4MO2A 4Q3NA 2NQTA 1HDCA 4RVGA 4XIJA 4ZA2A 1P1HA 2PGDA 3ZWXA 4IDCA 2DBQA 4PLZA 1JWBB 1O5IA 3HFGA 1ISIA 3HUDA 1QLHA 1RWBA 3IUSA 4MKZA 5U9CA 3CXRA 4OYRA 3RCBA 4J1TA 4PLYA 4UVHA 2YYYA 2A35A 1P1IA 4DBZA 1SOVA 2O3UA 2J3HA 3QHAA 1KEPA 3CH6A 4DYDA 3ZW9A 4BNWA 5TC4A 4JIGA 1QMGA 1JWAB 3VVBA 2GSDA 5DCYA 2W2LD 3TZQA 2JHGA 1LDBA 2YV2A 4MVJI 2P9EA 2W98A 3ZWBA 5L7WA 2VNSA 5EN4A 1T1SA 1Z82A 3JQDA 3R3SA 3HDJA 5G4LA 3WG9A 2W4QA 1PGPA 2HK8A 4U7WA 3E18A 3ZH2A 1HLPA 3E48A 3PHHA 4AJHA 4AJ4A 4AJJA 4YJFB 1C0IA 2HJRA 3UCEA 3P19A 1E0DA 1RPNA 3HSKA 2NV6A 4XQCA 2J3JA 4GLLA 3GHYA 3LT0A 5KJFA 5A9RA 4BV8A 5TIIA 3R0IA 5JO9A 4IQ8A 1EFKA 3P5SA 4KZPA 4WASA 3K30A 2UUOA 3U49A 2ZB8A 1U3VA 1Y5RA 4RF5A 4QO8A 5CEJA 2O3SA 2VTDA 5B37A 1VL0A 2QIOA 2NLOA 1KEUA 5JDIC 1GCOA 1FDSA 1VE9A 2FSSA 4DRYA 5BSGA 3UXYA 7MDHA 3LLSA 1LX6A 4GWGA 4L73A 4HNGA 3AFMA 1U4OA 1JN0A 1H9AA 4EUHA 1BVUA 1BVRA 4FFLA 3SLGA 5DT9A 5KVQA 3W8EA 4EEXA 1GPJA 2WYUA 3JQEA 4J6FA 1K2WA 4DIBA 1R4NA 3KTDA 4YT4A 4O63O 2Y1EA 1DFIA 4PZDA 4BB6A 1DC4A 4WEQA 3WYEA 2W2LA 1YVEI 1R16A 4BNJA 3K5PA 1ARZA 4QEDA 4DMMA 4KQXA 1T2AA 1DHTA 7ADHA 3PTZA 3AFNA 4UUNA 3EVTA 4I9UA 3DL2A 4W6ZA 3KM0A 2FMUA 4BNTA 2ZYGA 2NTNA 3CTMA 4LN1A 3L6OO 4XB2A 1B7GO 1R4MB 3GT0A 1XEAA 3CIFA 1GU7A 5FF9A 4IGEA 4N5NA 1MLDA 3ETEA 1B15A 4CMJA 1FDTA 1K6IA 5JFOA 5TQVA 3R6DA 2FHSA 1GY8A 4J90A 1WP4A 2IRWA 3AUSA 2HSDA 4LK3A 3AK4A 4WE3A 3WGGA 3WLFA 4B4VA 4DXHA 2ILTA 1R37A 5EJ2A 4DPKA 4ALKA 4EEZA 2GGSA 4PLTA 2HRZA 4GVLA 2NU9A 4A7PA 1I8TA 1SB8A 5AYVA 3VTFA 1GD1O 1ZFNA 2UUPA 3WQRA 2EJVA 5IJZA 1L7DA 1FK8A 1I32A 1X0VA 3I6IA 2FWMX 4NFSA 4R5HA 1R15A 2NM0A 4IDEA 3VDRA 2O3RA 1I30A 2JAPA 3UOGA 2WYWA 2OBNA 2OBYA 4IJVA 1BMDA 3GZNA 5K6AA 3QVOA 4NJOA 4ZQGA 5G4KA 4Y6PA 3BA1A 1X7GA 3DZBA 2DBZA 4IIUA 4E5KA 1PZFA 3UF0A 2GASA 1XLTA 4CM7A 2BGLA 2HMTA 3GGPA 4FFNA 1WDKA 3WNVA 1UP6A 5T6BA 2VUUA 4DQVA 4QFDA 4J9VA 4NZ9A 4I9NA 3U09A 4MIEA 1DRVA 3PQEA 4IZHA 2XF8A 2ZK7A 3I4CA 1DJNA 1G6KA 1UDAA 1YS4A 2FPPA 3E9MA 1PJQA 2I65A 2D59A 2VRBA 3WGYA 4BIIA 3QRWA 2VWGA 1D4FA 4P4GA 3D4PA 4CM9D 4HBGA 3RFXA 3BMNB 1DSSG 1E3IA 4QQRA 3H5AA 4R3NA 3GK3A 5COQA 2PNFA 4YVFA 3MTGA 4OOEA 3HN2A 1DLIA 4XEHA 2PD4A 1ZCJA 3AOGA 3NEPX 4B7UA 3W4KA 4DQXA 3BIOA 4B7CA 1M75A 2PTGA 2RH4A 1ADGA 3QWHA 4LSMA 3RUEA 1Y9EA 1ID1A 1E3EA 3JD0A 4BB5A 1NWCA 1HL3A 2X58A 4IJUA 1DC5A 3JCZA 4NK5A 1T25A 4JQCA 1E7MA 2EW2A 3TQHA 5IN4A 2IYOA 2AQHA 4R4JA 1DIBA 1PGQA 3RUAA 1V3UA 4CMAA 1HEUA 3C1TA 3F1LA 1VJ1A 2Y99A 3QA9A 2BLLA 4YQYA 5DF1A 3V1TC 3ETDA 2IXBA 4R1SA 3RU9A 3ST7A 1NP3A 2P68A 1HETA 3DMTA 1YE3A 4CLEA 2V6BA 3OHSX 5TX7A 3X2FA 1DRUA 3PJGA 5KJEA 4L4XA 4UEOA 5CG1A 4XR9A 2W2KA 4H3VA 1Q7BA 1N1EA 5BQFA 2FSVA 5KCZA 1T2CA 3H4VA 3ZI0A 1LDEA 1E6UA 1I01A 2CSUA 2PZMA 4GVXA 1Z74A 3TOXA 3RBXA 2NACA 3I5MA 1Y8RA 5ADHA 1Y1PA 3WFJA 4E5PA 3MTJA 4IM7A 1ZK4A 1FF9A 4ZQBA 2Z95A 1HWYA 2DT5A 1DJQA 4A0SA 4A27A 3E03A 3GFGA 1HF3A 2OHXA 4WLNA 1YDEA 2VOJA 1PZGA 2BF7A 3ROKA 1O89A 3QQPA 3K92A 4GMGA 1ZK2A 4NPCA 1VL8A 3RC9A 2Y1FA 1TXGA 1C0LA 2V6FA 4O1MA 2PKQP 4YYZA 3PHLA 3JQGA 4YBZA 3C24A 1NHWA 3OSUA 1I5RA 3DTTA 4B79A 4RQTA 3OA0A 3ONEA 2Y66A 1I3NA 1O9BA 4QO7A 1IY8A 1IE3A 2P4HX 4IDBA 2CVOA 4BNKA 3LC1O 4N54A 1ZK3A 4TRRA 4TZKA 3SXPA 2CVQA 5C5IA 1IHYA 1XDWA 4UVIA 2WTBA 1WMBA 2HMSA 4UAGA 3BTOA 5L3ZA 4L75A 4GX2A 2VHXA 1QYDA 2Q2QA 1UH5A 2WSBA 1ZJYA 3IS3A 3LC7O 2XXJA 2FPIA 2XXBA 4R54A 1MUUA 1OI7A 2GPTA 3SVTA 3G79A 3OJLA 3LT2A 2I3GA 1NQTA 2JL1A 4H15A 5DDIP 2DAPA 1VLLA 2WDZA 3NTRA 1PJBA 3A4VA 3AUUA 1Q0HA 4XGKA 1ULSA 5ITWA 4CL3A 4BNIA 2B0JA 3EW7A 3C1OA 2VYNA 3PI7A 3OP4A 2Q50A 2JHFA 1PGJA 1WW8A 2Q45A 1P1RA 3SJUA 4GGOA 1ZW1A 4CR6A 3OJFA 1UJMA 2JFGA 4Q3AA 4JJIA 1SC6A 3GVHA 4QX6A 4XQ9A 4A10A 4D79A 4J2HA 3KB6A 1JA9A 2VWHA 4R9SA 5ENVA 4E5NA 3RBZA 1E6EA 4P22A 4DLBA 3H2SA 4NK4A 3WJ7A 4W7IA 4CMIA 3HB4X 3ZNPA 3HHPA 4Z3KA 2SCUA 2Y1DA 4NU6A 3G1TA 2B37A 1KVSA 3GN2A 4L4RA 3WBBA 2X5JO 3HWRA 1LC3A 3DZFA 4WK6A 3RKUA 3DC2A 3KYCA 3Q0EA 3JQAB 1I2BA 2YW9A 5DBIA 5DN9A 3PDJA 3AOEC 1RYEA 2BMAA 1GUZA 4J91A 2B4TO 1IULA 2GLXA 2YFHA 4ZVVA 3ZZNA 1PS0A 1OC2A 3HE3A 4OIMA 1EEHA 1VPDA 1W4ZA 3DHYA 1QORA 3PWKA 2NVWA 1HYHA 2E6UX 3DTYA 5ER9A 1B8VA 4FN4A 1E3WB 3O9ZA 4J1NA 4TVOA 1DFGA 3F6YA 1YL7A 5T8KC 3U9LA 5A9TA 3KYDA 4LVUA 4RPLA 2QRLA 1EE9A 1PJ3A 4W82A 2DFVA 4R69A 4D42A 5A9SA 3ZWAA 1X1TA 4YA6A 3B70A 1UDCA 4E30A 1DIGA 1LLQA 3K31A 4EW6A 4NMHA 5T57A 1Y81A 3ZWYA 4MOWA 2HRBA 4YJFA 5CFZA 1NQAO 3BMCA 2Q1UA 2E82A 3PP8A 5EQFA 3WTBA 5I7VA 1QYXA 3FWNA 4OHUA 1AHHA 1NVGA 3VPSA 3HNPA 4RPGA 1EVJA 1HZZA 5HBRA 1PL6A 2PK3A 3FBTA 5DP1A 1YL6A 5GZ6A 1PSDA 3A9WA 4I5DA 5DNAA 4TRJA 1ZSVA 2PKRA 1DIAA 3PJEA 4BNGA 4CV0A 3FPLA
chains in the Genus database with same CATH superfamily
2JFWA 4W9NA 2I5PO 4AURA 1PV1A 1J0DA 1M2HA 1NBEA 2OV4A 3M3HA 1K08A 2VSOA 4OKIA 1YS1X 2AJLI 2Q62A 3IIMA 1ETHA 5DXFA 1WUJS 2E89A 1Z6GA 4P3YA 3OVMA 2WVAA 4G63A 5IFKA 3R0JA 4ZQHA 4Z0TA 5IUNC 1E8DA 3F4LA 4ZDKA 5L4LA 3HGMA 3CW9A 5F76A 4BVBA 2O0KA 1E3MA 3DA8A 1BE8A 3AUYA 1JG4A 1O2DA 3JQ9C 3EOZA 1E79A 2VK1A 4FE7A 4PYJA 5ED0A 3WK5A 1ZH2A 1AIPA 4AP9A 4ZVNA 5K8JB 4NE9A 2VHYA 3EAFA 1YS7A 1VHDA 3R4CA 4XYGA 2YJZA 3FCYA 1NQUA 3PDIB 3W6UA 5ER6A 1BN7A 1QWOA 1XZIA 5JISA 1FQOA 3RYHB 4ZO8A 4TUYA 2Q07A 3JYQA 1GG9A 1N6KA 2VXCA 4WXHA 3ORSA 5CK4A 4NG5A 4BECA 3FR7A 1IATA 1MX9A 1ZUNB 3E8SA 4FP9A 4YB8A 2VDJA 4TUYB 5A2QA 4HNSA 4D1YA 1UPFA 4G8DA 4QDXA 5EAIA 2VPTA 1SMKA 2CNBA 2EDAA 2RGEA 3DBHA 3WLAA 3NHRA 3HL4A 1X2BA 4OHFA 5L40A 3GZTB 1ZRSA 2WD8A 1EFUA 1PW7A 2BUAA 4Y9TA 1PFKA 5H4HA 1KHHA 1NNUA 3D7MA 3TAXA 4TMFA 421PA 4XGNA 1ZMOA 3O8DA 5AW2A 4WA8A 1XA4A 3DXZA 4U2EA 2G88A 4QYWA 1QVWA 3V42A 1P6QA 4AP5A 4BMOB 1I1OA 4LY0A 4BQOA 2P1ZA 2O2JA 4FZRA 4QVGA 1G291 3P9XA 2JS7A 3FH0A 1HYEA 4NQRA 3HLYA 4S1NA 1I1QB 3T34A 4C89A 2VHWA 4D98A 1YVRA 1U3GA 1D5CA 1ZS9A 2ZCVA 3LUAA 2PMEA 3OOHA 4PZUA 1ZVKA 4PX2A 3ZUGA 2XE4A 4XYLA 1SUCA 3R3ZA 4MUEA 1TMGE 3BWBA 3WB1A 1TPZA 2QUKA 2AKYA 2PU7A 1XJ5A 2ONKA 5DYYA 5JSYA 5IAKA 2IF2A 5J2TA 1C7QA 4NZZA 3Q7QA 2ZJ1A 3KSDO 4N41A 3QMMA 5AW7A 3OFJA 4JU9A 2C2BA 2V9PA 4TWBA 4NABA 1XX6A 1I9CA 3RU7A 2EJBA 3RANA 4DNFA 3HEBA 1BS2A 2HA0A 1P7VA 1BS9A 2JJYA 1KEWA 2GERA 1FPMA 2P3LA 1ZSYA 1L4BA 2QPAA 2X4GA 3DL0A 3IOCA 4S1VA 3ELWA 4S0ZA 4BGIA 1YZ3A 4A8TA 2OHFA 4OUKX 2PXXA 4CTMA 5BV0A 2LKDA 5K3EA 4RK7A 5I4CA 3NBFA 1GPNA 2HGZA 1KO1A 1KQNA 2B1RA 4TQ9A 2HMAA 3A3PA 4JC0A 4GX1A 5E95A 3U7FB 5KU7A 2EV9A 1TMKA 5AXDA 4FGWA 4BE7B 3H9JA 1DTWB 4EWLA 3GLRA 1Z4QA 3A1SA 1Z06A 1UF9A 2GX6A 4ZRDA 5FI0B 1V48A 2WFLB 4W8OA 3RRNA 2HU7A 2F1KA 5HM8A 4C7BA 2VVTA 3H13A 1DWOA 1UPXA 3AR8A 3DOFA 3QUCA 2WG0A 4GRDA 1HMPA 4ID3A 2PLFA 2Y9MB 2NU8A 3WL6A 4QC2A 3WQBA 1XQXA 1PNRA 4CM9A 4P3XA 3BULA 1VIDA 4G97A 3R75A 1AKRA 2ZJ8A 1A76A 3BGIA 4BVAA 2B5WA 4AYXA 4NLLA 5DB4A 1XMJA 2F59A 5CT9A 1V6AA 5JZMA 4PYKA 2I71A 4ECEA 2KBEA 3F98A 3ZCUA 5J59A 3NI2A 4YIKA 3MAGA 3Q7TA 1WBDA 4B2LA 4C14A 1G6HA 1LF5A 4Z9FA 3PVZA 4Q3DA 4BLVA 3TTSA 3EY9A 2DC1A 3V1KA 4FVTA 4R68A 2QVXX 4PBTA 4A26A 1Q1QA 3GEDA 3LKDA 4LYEA 4W8HA 3NLLA 4W1RA 3EXIB 4YJ2F 1G3IA 4UDXX 4TROA 4EB0A 2EEPA 4ZRNA 5BN3A 3CXUA 4D4MA 3TVYA 1WLSA 3LHFA 1W0CA 5HUJA 1YDWA 3HBJA 4AS2A 4F45A 4OHKA 3PHBE 1N3BA 4RPJA 2HO4A 3L7MA 4EF5A 3TZCA 3HFJA 5JD5A 3R40A 2EJTA 3FKSD 5AJXA 5HXAA 2IKSA 3K5IA 4HVCA 2O2EA 5AOBA 2B2NA 3KWFA 1E2PA 2XTNA 4DCVA 2OGTA 3KUKA 4FMPA 1AV6A 5CVUA 3C4JA 3EYAA 2JAHA 1LS1A 3JU3A 3OU2A 3SY8A 1GOTA 4O4IF 1AKUA 2H5IA 5A06A 1VE1A 1RJFA 2I6SA 3PHGA 5IVKA 4FMDF 1P3DA 4UEWA 2ZYWX 1V16B 2VBCA 3NCHA 5KNBD 1PJTA 2XDWA 3AO0B 3E5RA 4H1VA 5TS2A 3EGDA 4UUQA 5K0LA 4ZARA 2PO7A 3MRSA 5M29A 3K4PA 5TF0A 1ZEMA 3WLLA 5EJ4A 2Q4BA 3DVAA 1ORRA 3S27A 2E49A 3ZCVA 4L0DA 5JSZA 2EZ9A 3A6PC 4YJ2A 5BW8A 1F8UA 1ONNA 2GBFA 3JZFA 3D64A 3WGQA 3KUXA 1S0UA 5H3CA 3U1BA 2AG6A 2BMJA 1PJRA 2O2ZA 2VHCA 1OGYA 4FQ8A 4PONA 1UDBA 4R41A 1Q0QA 1X15A 5JSZB 4QYTA 1OFCX 1BD3A 5BSMA 1R6TA 3QQ5A 4JI5B 5FEUA 3RV3A 3GDGA 1DADA 2CLFB 4RK6A 1UBLS 3RG8A 2WNSA 2WWYA 2SBTA 4U6NA 4ND8B 1PLLA 2QG6A 4JJ4A 4D4KA 4O3MA 2PGJA 3FXAA 2QQ5A 1TCVA 3RV4A 4QJ5A 1ZR2A 1V1JA 1ENPA 3R6GA 3IEVA 4H16A 5LBTA 3ZDRA 1E8MA 4YMTA 5BXYA 5FBVB 2CLEB 3MCZA 3HADA 1XP8A 4YCLA 5IWCA 1CQZA 2IP2A 1SEPA 3H17A 3JPYA 5F3RA 4TMKA 1HG0A 5IH3A 5KHAA 4K6FA 5TJHA 4BU0A 2C8JA 2E6KA 4C78A 1ND6A 4DSAA 3FKQA 4IJQA 1FB5A 2N9UA 4J3FA 5ALDA 2V7EA 3THYB 3PQ5A 1FTQA 1FU7A 1R6BX 3G59A 1NMYA 2JPDA 4TWRA 4R9NA 1MJNA 3JYHA 4QNRA 3UHPA 3L18A 1GYQA 3R44A 4LC1A 4YRJA 2WAYA 4FIDA 2YXLA 2P7HA 2QGNA 4ZAYA 1N2CE 1X9HA 3QU5A 1N33B 2DBRA 1ZSNA 4DCGA 1AD2A 2CB9A 2XWQA 1W93A 1KMIY 3I6MA 4R01A 5KYKA 1EE2A 1S2GA 3AQ4A 2YFQA 2Y4NA 2DF8A 5KYUA 3HDQA 4IL5A 3PRKE 4DXAA 3QVWA 1PV4A 3S40A 4DR7B 2RHLA 3GNSA 1FYVA 4OXYA 1GGVA 2P30A 1BSVA 1XK7A 1QGAA 1C8LA 2IHTA 1Z8DA 3AP3A 2XB4A 4YN3A 3FD8A 2GARA 1I7NA 4OMCA 3DLAA 3O83A 1G8MA 1YDGA 1LQUA 2VRNA 3N7UA 4U0JA 4FEEA 3V1YA 1RHUA 4JUFA 1JJBA 2NNWB 3GBPA 2ERXA 1SG6A 5I7UA 1ZBQA 2BGIA 2Q6TA 2DUUA 1L3IA 1UUFA 1X3LA 5CFRA 3DBVO 4AK9A 2FW9A 1MEEA 1GPKA 2YHIB 3AVQA 3PRJA 3QI7A 4OP1A 3WWYA 1NJ6A 3UUGA 4IXWA 2MOKA 5JXGA 4OGKA 1JFTA 1K6EA 3LS2A 2EZUA 3SOPA 1IWOA 1MABA 3EZNA 3W7VA 4K6KA 2C5LA 4DA8A 1XQVA 3L8ZA 3KKNA 3QMWA 4DW8A 1HKUA 2XADA 4R3WA 3FDFA 2WVHA 1DJPA 2VDVE 1G4AE 3JQAA 2WKWA 1DC6A 2YMPA 3P9PA 5FI5A 4X65B 1VYHA 3M6MD 4DXDA 4RMHA 5E2BA 2BBSA 1YRAA 2JFNA 4GP6A 5A6VA 3D6VA 2PH5A 2HCRA 2ZSUA 2FPGB 4U8HA 1WUYA 4D4GA 4IJKA 3DQQA 2OCGA 2WZDA 3DKRA 4ZAWA 4XGIA 4BRWA 3STHA 1KY2A 1L3BA 5TSDA 2ILVA 2K7ZA 4KX5A 3FJ1A 1IAQA 1MDFA 1E3WA 1B6TA 3L0IB 1FTNA 5AVRA 2F3SA 3BS4A 1NU6A 1YGPA 2IDJA 1W30A 4ZOLA 4QPCA 3HXOA 2XGOA 3IQIX 4LC9A 4WXMA 4WZAB 4LFBB 4PQGA 4BMCA 4RENA 1ZGZA 5J5AA 4DCSA 3X1XA 4PNEA 1CSEE 2ZUTA 3EAGA 1JHZA 1QNFA 3KPYA 3UATA 2PXCA 3JR3A 4YRPA 4ES6A 1M2OA 2P9YA 2ZRLA 3H65A 3K0AA 4WZBB 3LM8A 5FUVA 4BNHA 1MXFA 2CMKA 4IIFA 2OB1A 4RA9A 5JCJA 1CQJB 1TTHA 4R1NA 5A3VA 1PR2A 2D00A 5TNXA 1L9XA 2C3OA 3QH4A 4HQKA 4PX5A 4RDCA 4LVOA 4LDZA 4DUPA 2BEVB 1TA4A 3FHCB 3GF4A 2A1IA 4G4JA 3FF1A 4URWR 5DHRA 1Q12A 2WBLC 4PCAA 1I24A 2I1QA 1N6RA 2NW6A 1K0FA 1W85B 2VN8A 5TS3A 4W5OA 1G20A 4B32A 1JHXA 3I52A 4LJRA 4PZPA 1FDIA 2D5LA 5C4GB 3GROA 1Q0TA 4ZYYA 2FPKA 2AUTA 5M5BA 3OU7A 4KNWA 4UHFA 3F6CA 4X1YB 1Y9ZA 1HM5A 3OCZA 1A2QA 2NPFA 1QFSA 4AZVA 1KJYA 4EA9A 3EGOA 2A5FA 1V2HE 3AB3A 2OP1A 2FQQA 1A5TA 4RAQA 5EGNA 5CIQA 3ZQKA 2JGNA 2O8NA 1QTIA 3L01A 1KZ4A 1L5ZA 1U1DA 2WHEA 3O8LA 1S2IA 1FP4A 3FMIA 1R1DA 4H7FA 1P1JA 3B5JA 4JLNA 4B48A 1GZHB 3O3MB 2Q3FA 3CX4A 1EFAA 3B1ZA 4AN0A 3COJA 1DWQA 1VMKA 4PRKA 4FI3F 1XU9A 2DZDA 1NBAA 1YIDA 5LN1A 2P11A 2VI5A 4LIPD 3FCSB 4WTOA 3ASUA 4ZVLA 4NQZA 3DB1A 5K0SA 2JIZD 3PWZA 4KN6A 4P35A 5EZQA 1KSFX 2BFDB 3SR4A 5B5SA 2VDQB 2XKAA 2YRWA 2VK2A 1A72A 2BV3A 1BHO1 2G70A 2H2AA 3DCYA 3LBHA 4FR0A 1HKHA 3OTIA 4F3RA 3ED1A 2YY5A 4RMJA 1QGUA 4U9UA 5DYWA 1HR0B 3UJ7A 4FOLA 2CLOB 2PJUA 2V98A 4UU7A 3UKJA 3ZWOA 1PT7A 2RD2A 3VH3A 1DQYA 2C7BA 2RK3A 4I46A 1P75A 3HBAA 1GGNA 5AVVA 1J97A 2GJ9A 1ZJJA 4WLVA 3VR5D 3K0HA 3ACDA 1USUA 5JW6A 3ZZTA 2P9FA 2JC3A 1HTBA 2QAJA 2IZOA 4ACAA 5IS2A 2SKEA 1AKEA 2HFJA 2HRCA 4FSXA 3IV7A 3IESA 3QY0A 3E6AA 1F12A 2Z8XA 4LAFA 4KQCA 4BCDA 3JARA 3ZJ5A 1IHDA 4AO8A 3KFXA 3DLHA 3L49A 4HWRA 4ER5A 2CBXA 2FETA 2XRMA 3Q7IA 3HPQA 3A1NA 4IR7A 4KXWA 1NBMA 4S1OA 5LLTA 1F60A 3BXXA 3E23A 3HVUA 4G5HA 2E4YA 4G0VA 2IL1A 2R44A 4MZDA 2GAFA 4Q21A 2XWSA 3F2IA 5DWDA 3ZGYA 2QN9A 2GJKA 3FYUC 4MRNA 3E22A 1NMEA 4ALMA 4YXWD 4Y18A 1LK7A 1UAGA 1KZ7B 1U02A 4CYMA 4NAHA 4KMRA 5K6RA 2FZVA 2OBMA 1ZKMA 2ZI6A 4BO4A 1G7TA 2JAOA 5B58C 8OHMA 3IMKA 4S24A 5ADVA 4MRMA 1JR2A 5DXJA 3N86A 3G0CA 4LWZA 3IUBA 2Q1WA 4HDMB 4BKMA 3KWLA 3UHFA 2IW3A 4WY8A 3UWDA 1PEDA 3QKUA 3TTVA 2JA1A 4FGSA 2PUFA 3AY6A 3DPIA 3MNFA 1QVRA 1Z7EA 3H97A 2NO9A 2O3QA 5J4VA 4CQNA 1LSUA 3PUJA 2UZ1A 4C7VA 4GC5A 5ICGA 1ZUIA 2A33A 3SWWA 2C9ZA 1FFSA 1PIWA 1EVYA 1HZJA 2C4HA 3IC5A 3MAAC 3P52A 1RZRA 2XUDA 1DLJA 1VP3A 4G5XA 1X13A 4L8GA 4KFTA 4WK0B 3CRQA 5AJUA 5ESWA 2Y0BA 4RM3A 5K3DA 3ZBPA 5CDYA 3GC6A 1D8AA 5BMOA 2C9BA 4AUNA 1G8JA 4UQPA 1W2GA 3Q7EA 3A2KA 1JKFA 4BVKA 1OZFA 3ZU6A 4DILA 2EWMA 1EBFA 1N6IA 1DMRA 1GU1A 1SU8A 1JZTA 1M5UA 2D1RA 3AFIA 4JR2A 5E7IA 4QKQA 1JAHA 3UPTA 1HK7A 1TA9A 2IYWA 1TT7A 4ALLA 4OATA 1G5FA 2FMFA 3AEYA 4DA7A 1LH0A 1VB3A 1Y6RA 3PSAA 4LXHA 5ICFA 2A1UB 4DLTA 3SVZA 5SZKB 4N0EA 1MC8A 1XRPA 2G4CA 5CXXA 5ISMA 4YRGA 4Q7LA 1PNOA 4EGSA 2XNDA 1EUCA 2WPNA 3DMGA 3HGTA 2XUZA 3IODA 5CBPB 2FE4A 3X1WA 1C7FA 3RVKA 2VTKA 5DKFA 1YF3A 2H6EA 4FFOA 1QQBA 4NICA 4Y30A 5ARCA 1J2YA 3RIMA 2XODA 2OQIA 2C9OA 1EK2A 4Y2TA 1J1IA 1ZO8A 2FEOA 4I3FA 4JFRA 3ZE0B 3BJZA 5G4KB 3ZHYA 1YOVB 3KKLA 4WCVA 3IILA 3T5CA 4N9QA 1V1RB 2WV7A 1MB0A 1M8PA 2X1VA 4PQEA 1PWYE 1TIPA 1W4CA 2H8KA 5B3AA 3VZCA 4DCNA 4RQBA 3V7NA 4LZNA 5JVDA 1USKA 4YRKA 3C43A 1NDQA 1U0HC 4N5DA 5EMLA 1NNEA 3H6GA 2VSQA 4ILKA 1T10A 3TD6A 4F9EA 1SZCA 5EMHA 1ZMBA 3CVVA 1E2FA 3ZWVA 3OZCA 5M7EA 1R8JA 2HA6A 2H4JA 3HI6A 3AEUA 3GIWA 4F4UA 3VJMA 4D0SA 1G7CA 1P2UA 2IHYA 2RIRA 2W2MA 2ATXA 1Y1KE 1R0XA 2E5LB 1G21B 3OO1A 5AJYA 5AKEA 3RS5A 3I37X 3KLBA 5JCOC 3L07A 1FSPA 1PTJA 2CZGA 2I6XA 4PSKA 3BMNA 4ER0A 2XE6A 2ZDGA 3HTXA 4HKTA 3WK9A 3MBIA 3O5AA 2GD2A 4N18A 1W1WA 2VL7A 1XKXA 4E5UA 4PAGA 4TN5A 3ITDA 1T5HX 4GOXA 1GUYA 4HWKA 1HSOA 1NUPA 4K9NA 2FW0A 4R84A 2IPXA 5CGQB 2AVNA 5C7YA 1X7WA 5IBPA 3HN7A 1QR2A 4WOCA 1H42A 1VZ3A 3OP1A 4LRWA 2CDBA 2IYQA 3CZRA 5TV2A 1OIXA 3EEOA 2ZOSA 1U11A 1LRJA 3F8SA 4JA2A 2W42A 3FB1A 3N74A 3UBMA 3L4JA 1VL6A 2QTWB 3I5UA 1NRJB 2B35A 1QV7A 1KEKA 3I05A 2GO7A 3GFBA 4DZRA 1V7QA 1EH5A 4CR7A 4IKPA 3JSAA 4PZLA 3W78A 1BDHA 2RIPA 3HCEA 5LP1A 2BE9A 3WGHA 4N0DA 1NVUQ 4I5GA 3ZNQA 1ZITA 4MX8A 5EESA 4EB3A 4DWJA 3CC8A 1CK4A 1PZHA 4B87A 1OT3A 3KVNA 1TI7A 4YDRA 4I1YA 4BNDB 4QOFA 3EQ7A 1M1NA 1W8DA 3B20A 2IE8A 2L17A 2HAEA 3J80A 3G5AA 3FCAA 2VT7A 4RGYA 4WJZA 1QO7A 1L7EA 4D6XA 3TI9A 1KK0A 3ZHBA 3C8ZA 3MTEA 2HIMA 4E5YA 2CWWA 4NY1A 2QX4A 4BYMA 3U4QA 5HVNA 3RYIA 3ZLVA 5D6OA 2FEKA 2RHCA 3C5HA 3ZCPA 1RCTE 9MHTA 4JYMA 4K6CA 2P6UA 2QZPA 3EAQA 1D2EA 3F3SA 3C3AA 4XDHA 2JEYA 3CVUA 2V0GA 4TLMB 1SXJC 4KVAA 1WNTA 2Y0PA 4DG8A 2HI0A 1HT2E 5C2JB 1A9RA 5FOVA 1D2HA 2V65A 3KSMA 3OE7D 2JCGA 4HNAB 4KWIA 1ZH8A 4L0MA 5T67A 4MMYB 4MYDA 3UY4A 2C9MA 3MJHA 4WLFA 2PCJA 1QX3A 5HDBB 3N53A 4TPKA 3F6BX 4O2BB 1G63A 2GJ8A 4JR0A 4TLCA 1PYOA 2QLJA 4KWTA 1TEXA 4YQZA 1EDEA 2LW7A 3HKBA 1XNGA 2MMGA 1N7JA 1MB4A 1O03A 3GRRA 2R1VA 3NJ4A 3TMYA 5L4NA 4OU5A 1N2HA 5KQMA 2QGFA 4ZT3A 1F7VA 1I2AA 2BGRA 1O54A 1F2DA 2QT9A 1MG5A 4HADA 1VKOA 2GZRA 3LCMA 4KN5A 4BATA 1YO6A 2R1VB 1C3VA 4MEJA 2Q5HA 3HBMA 4BFYA 4D46A 3K6SB 4JT9A 1TTPB 3HDGA 1FC0A 3ODGA 4JXJA 1XDZA 4IH9A 2UYYA 4M2LA 3W3AH 3GWGA 3EC7A 3EMVA 5TT0A 1T4BA 2WR8A 1JXMA 1RYYA 2G9ZA 2W0MA 3E82A 1OLUB 3MCVA 4MPDA 4U00A 5TEVA 3ZWWA 2ZQ5A 2YZNA 5F52A 4ZHSA 3X1ZA 1SGWA 3A6HA 5H9WA 2HU8A 4C4PA 5KQRA 3CUKA 3OFKA 2FMXA 4OSPA 1XSEA 3EGXA 4D0NA 4GSLA 1EIZA 1CUYA 2GEBA 2ZSAA 4RZHA 4ZV7A 3H1GA 5JQGB 4QVKA 5I8ZA 1KDYA 2O1EA 1Z0FA 3DXFA 3HFSA 4QAJA 1R8SA 4QICA 5BSUA 3WOHA 2VHVA 3B1JA 3CZPA 2IEBA 3I8SA 4O4HF 2DKFA 1P2SA 4GP9A 4LNHA 5BW6B 1HE5A 4RUKA 3LYLA 1GZ6A 4FHGA 4PHGA 1XLTC 2PBRA 1MDBA 5KSYA 3VM6A 4S35A 1FDVA 3R77A 2HDNB 2HA3A 3N1UA 4RVCA 2H5LA 1RM5A 1RW4A 3NUQA 4YH1A 3ROTA 4JBWA 4TMYA 1JH9A 1ZOSA 4DIFA 3FPCA 1WHTA 3D6UA 3T7CA 2TMDA 3DFFA 2ZAMA 1L3CA 2IU3A 4R2MA 3OTHA 4B43A 3AEZA 2HT1A 2OFXA 1BHSA 3T7IA 2GZDA 1IDOA 1I6MA 4WOKA 4B0OA 4WHMA 3B48A 4BO9A 1PGOA 4NAVA 5IBCA 2IZ1A 2GZ1A 2ZIVB 2YQ5A 4PLHA 4U1RA 1VL2A 4AQ7A 3K0SA 1UFKA 2I7CA 2WJZB 3BDVA 1YI0A 3U44B 3LK6A 3TTWA 4AP6A 3HK2A 3A1EA 3WMXA 2BI8A 1RXVA 2HWYA 1Q3TA 5KZMB 2GM3A 5AQ1A 4P7KA 2NXWA 2OVFA 1U3FA 3MJTA 4F8EA 5K7SA 5BR1A 4UMDA 3WMFA 5AT1A 1RAGA 3TZKA 1HV8A 2IDKA 2IU4A 3BE4A 4FLMA 5GV8A 4WZ6A 5FFNA 1G59A 1F20A 1RI2A 1L8OA 1RAFA 1SPBS 1W7AA 1ODFA 1CDZA 3NWPA 1I2MA 1WTCA 5PNTA 3G49A 2DUJA 4W5WA 5JTTA 3L7CA 1KVTA 4P0TA 3TLGA 4L3VA 1EFLA 2CZCA 3CZAA 4O5AA 3OJOA 1LLDA 4XFDA 4PC7A 1SBYA 1ENYA 1U5BA 1W2HA 2QNBA 3M9XA 4LOHA 4X54A 5B7GA 2JGKA 3LBNA 4QXAA 4FYMA 4KWCA 2OFFA 1YB4A 3WK4A 4PN3A 1H93A 4Z4FA 4DLSA 1VG8A 3ASYA 2GBLA 1KYVA 4TM8A 2QPLA 5EKTA 1QHGA 4AG5A 5HP4A 3W5AA 3GIDA 5IABA 2X1LA 1NVTA 1N75A 1FVHA 4ZKDA 2OK8A 2DLNA 5K4HA 4R7GA 4OQXA 2R8RA 2BGWA 4JP3A 1XZBA 5F7JA 3KVYA 1XVTA 6ADHA 4P0QB 3F6RA 1ZM7A 2IUFA 3PVSA 5C80A 4EY8A 4A23A 2WMYA 4BZZA 1B41A 4Q9DA 2AG8A 5G02A 4IG9A 1XMPA 1XQ6A 3I4FA 3HR7A 1J8MF 1BDJA 4TS1A 5AK3A 1KY4A 4MB0A 1C14A 4GW3A 4K9DA 4WKOA 1G5IA 1J7KA 3R3HA 4N01A 1H8EA 3E9ZA 4EMBA 1RJDA 2HLNA 2Z3WA 4H17A 4GOKA 3SSMA 2PL1A 3F97A 4H1TA 3AIKA 4Q4HA 5KHLB 1TFRA 2D4AA 3HS3A 4ITVA 3INTA 1TPYA 2PUVA 1UOQA 2WSLA 1Y63A 2V7QD 1ISGA 3QBJA 1G8SA 2OORC 4EMTA 1PJSA 1SC9A 2CNWD 2AI2A 3A2NA 3RLFA 2G36A 4JBNA 1DOZA 2C54A 4HFRA 4NCAA 1T6NA 4DIOA 4K1XA 3NEAA 2OCXA 1LPAB 3KZKA 3HUFA 4JB3A 1GTMA 1E7QA 4Z9XA 3RJ5A 1ZNYA 2I2CA 4ZXPA 2GBGA 1C1DB 3AV3A 1X8KA 2GK6A 4RY2A 3GLIE 4UE3S 4PLVA 4DSNA 2YHBA 3M3PA 4FFWA 3VGJA 4AZTA 3B6ZA 1VKZA 3EPLA 1Q77A 5CNMA 3ESXA 4IVNA 1MVOA 4EG4A 4FGUA 1H5QA 1DGQA 4WXYB 2PMFA 2JBAA 1GGMA 5CPBA 4EITA 4YP9A 3TQRA 3TRIA 5B6IA 1HNNA 4ND5A 1J23A 3LY5A 5T4BA 4RHTA 2X7XA 2XYRA 1C5KA 3F47A 1VSTA 3DMFA 4O6VA 1SBZA 3OTQA 4NH0A 4IDHA 2YVLA 4DDTA 1C50A 1R0RE 2JI7A 3ZJVA 4GEKA 4AMUA 4M1SA 3THWA 4JI4B 3AG6A 4IRMA 1YT5A 3ABQB 1AGYA 5EWLB 1Z8HA 2AXNA 1FRQA 4D97A 4Q1EA 5TVGA 4EP1A 3PC3A 5IX8A 4P8RA 3SBEA 3L7LA 1EZ1A 2NNLD 3H5NA 3U39A 5ALUA 3VPGA 1CJBA 4E3WA 5I9MA 1TJPB 2G8NA 5IT9A 5K3SA 5KVAA 2FZCA 2QRKA 1L5QA 2O1WA 3QE9Y 3GLFE 3Q3HA 4LBYA 1F3LA 2J0UB 4R8MA 4EHIA 5A02A 1VIMA 2CJPA 1Y37A 4JT2A 4CQLB 3EEFA 3T6KA 3VR6A 3UO8B 2J4FA 5K01A 4Y9RA 2WSMA 2Q1YA 2XYVA 2X0RA 2QHXA 5B58T 2YNMC 4RD0A 1EESA 1DRKA 2DWCA 2E5FA 2BD0A 3AVVA 4CQLA 4QXMA 4EJ0A 2EATA 2HNBA 4BNXA 1NW9B 2OO3A 3NAMA 3P9CA 4UNNA 2DFNA 1RWWA 2QAGB 5L53A 4XVHA 2YJNA 4IF6A 2X4IA 1IOWA 1SUDA 3U80A 1LLCA 3WWEA 5FLXA 4TKLA 3KR1A 3VKHA 5FX2A 3S7ZA 1E1MA 3JV7A 1UK8A 3QXXA 4GICA 4MW5A 3VO8A 3ERCA 3IVXA 2Y1OA 4RVDA 4GMDA 3DG9A 2VNJA 2WIFA 3VISA 1JVNA 1U90A 1XMOB 1QZXA 1T3HA 3QVSA 4GF5A 3ZPXA 1M1ZA 3B2EA 3ZS9A 3SEQA 4Q47A 4H4EA 3QX7A 4J4TA 5K4GA 1GZUA 2AX3A 4FI3C 1JQBA 1P1BA 3JD1A 1O94A 3VV2A 4PWYA 2GCGA 5LQSA 5KTRA 3L4KA 1X1SA 2UZAA 3LRTA 1T43A 2QAGC 1RKXA 2C42A 1TW2A 5EXXA 1MO3A 2H65A 1NXXA 1QQ7A 1NTOA 2W6ZA 1XRMA 2IYUA 4NECA 3CNHA 3C74A 3FYHA 5CA1A 4AY6A 1W4AA 2CJWB 1YJBA 2F64A 2YNMD 4YT2A 1BVYF 3QX9A 4MHOA 4LC0A 1RRGA 3A58B 1KDVA 3MXTA 1A3CA 2ET6A 2ZLBA 5FNVA 5GADl 2WU0A 2CUZA 3MWKA 5CA1B 3KKKA 1VC2A 1DEOA 1UINA 2GN6A 4KEAA 2RSLA 4LI0A 4FKZA 2W22A 3WWCA 3GLKA 5DULA 1RP1A 2PX0A 2RGXA 2EG5A 2W7TA 1TLLA 1EK5A 1U7DA 2H1FA 1IXRC 3K0CC 4QNMA 1CUZA 4QQNA 4A4DA 3C8UA 1P33A 5DH9A 1DP4A 1PFUA 1RHKA 3IP1A 4TYYA 2PBZA 3IB6A 4FR2A 1RPTA 3ASZA 4DA6A 1HNWB 5L3VA 2OD7A 2QLTA 4HRVA 4WSOA 3KZCA 4D56A 4DDMA 4X62B 1E7YA 1EWVA 5DEIA 3P4XA 5K0NA 1JBQA 1EINA 1WRBA 1BXRA 1EK0A 1LBIA 1Y4DE 3CLSC 3E1KA 1H0KA 3IKVA 5DFAA 3TIFA 3EUAA 2W2PA 1VBMA 3BD8A 1ZNWA 1DUSA 3PNVA 1T5TA 4KGDA 5F2OA 4B8YA 4BLQA 1NW5A 1OFGA 3H75A 2HIAA 5DP2A 4DT1B 5BVHB 4AZSA 4CDMA 2WWHA 4QU0A 2G76A 3SU8A 3BE5A 4IOLA 1IPHA 1YS9A 3EXHC 3QEMA 5C8DA 3ZY4A 3QX3A 4OM8A 1LSJA 3BORA 2IHNA 3F46A 3T38A 1DBQA 5B4VA 1Y82A 3GFSA 4Q4JA 5IC5A 3DMHA 5FWXA 1A9OA 2CL6X 1SAYA 1LVGA 2ZYSA 2OV6A 3LKVA 3UWOA 3EB9A 5AHWA 2J8ZA 4DG5A 3AVXA 5A5VA 1A4RA 2XH8A 3F9IA 5B64A 1E64A 1ZJ6A 5ICMA 4E1BA 4N6GA 4DLWA 2ISSD 5HZMA 3A6ZA 3LPNA 3CR3C 3RAEC 4C1BA 5BSWA 3FN4A 1KY3A 3JQ8A 3OICA 1XMXA 3C3WA 4MGIR 4YJ2B 3GU3A 1N5OX 1XCBA 2HXGA 2WHXA 2XOEA 4PW0A 3RFUA 3IAM1 4ITUA 3HCWA 4CLXA 1TZBA 3R76A 2PSFA 2WUVA 3JRNA 5KPJA 2GRUA 3A6JA 2NVUA 4NTZA 1HI9A 5CA1F 1SHZA 3RIEA 3HL0A 5JWRA 4LWQA 3K9HA 3E1SA 1PWEA 4E08A 2P9BA 4MLCA 1W5FA 2BSXA 2FPUA 2C94A 2JCBA 3W9YA 3TUJC 1NFQA 1EG2A 3HO6A 4JLPA 4MYTA 5CIYA 4UDOA 1GGFA 3KNZA 3I64A 3NT2A 2W5UA 3TDNA 4WNYA 2A5GA 3HJBA 4CQMB 1A97A 1QGZA 1ZISA 3S68A 5LMCA 5TMPA 3W2GA 2WYIA 4MCAA 4YMWA 2VP2A 4E07A 5CCXA 3S2SA 4L1KA 1FNSA 3U5TA 1W1IA 2FR8A 4MJLA 1XV5A 3JALA 1E2BA 1WX1A 3BSFA 1OHHA 3ADDA 3KOMA 2B2XA 1TMYA 4KCGA 1AX9A 4TTIA 2PKEA 5C3UA 1XNRB 1WU8A 5BYAA 4WDRA 1FFGA 3LWDA 3GPLA 4JBLA 4CW7A 1RBYA 1MO5A 2X8LA 2D2XA 3B6KA 2FKNA 2WKPA 3DVQX 3LGSA 4K6MA 4E6PA 5IHPA 3W06A 2UYHA 2VBGA 3F5DA 3RIXA 2FMHA 2H07A 1Z5VA 2K6GA 3U4DA 3GAMA 1KQ3A 2YUIA 3HR4A 2ZT6A 1OWMA 3NHYA 2NUAA 3CR8A 4XM2A 2OOSA 3AM4A 3DFIA 4RELA 1N0UA 4HY3A 4DFDA 1B3BA 3LZ6A 3FUVA 3GI1A 2CMHA 4MK4A 1GQRA 5DX0A 5EY5B 3PJRA 4MQEB 1HYBA 1DC7A 2OSVA 1SZDA 1QG4A 3OZRA 1XTUA 3KE9A 3KPUA 2R5WA 2YFYA 2D0PB 4AX8A 2V7VA 2QRPA 4P08A 2G9QA 3HB0A 3HKEB 2MTBA 3PQ4A 4QYIA 5L6LB 3N9IA 1JLSA 1N6LA 3L7YA 3AERA 3V4ZA 5I51A 3L0PA 5COBA 3V9AA 3WB0A 5CFOA 1T3SA 4KXUA 4TLDA 4B7AA 4GH5A 3GA0A 2YIJA 4EJMA 3KJZA 3BTSA 5BWCA 5L9AA 5BP7A 1A77A 3HJHA 2NMVA 2C1ZA 1C9MA 1MB3A 3TIXB 5IK2D 3QTBA 5KC9A 4PF1A 2QM7A 1P31A 5FI3A 1TAUA 2I34A 4Z8YA 4IMRA 1L4EA 4JP2A 2WILA 4MS1B 3EEQA 4E1VA 5LXTA 4H3SA 2A67A 3BOSA 5DT2A 4JV5B 2J5BA 2XQGA 3CBQA 2GKSA 5BSEA 2OCPA 1POWA 3DEKA 4IDGA 4FMDB 2I8CA 1JEQB 4DR2B 5HK8A 1OFUX 3CMMA 4P86A 1MC4A 5AI5A 4P3NA 3HKDB 3VJKA 1CUCA 3RVPA 1Z6TA 4NHEA 4BX9A 2VJLA 1U1EA 3GQVA 5EUCA 1RIIA 5JXIA 4UCFA 1OX6A 1DKLA 3HYSA 1FVXA 3RSHA 3C41J 4NJEB 4QOSA 8LDHA 3N2GA 4U9IS 3T5TA 1X14A 4RVUA 5AUNB 5FPTA 5KWEA 1EGQA 2HUPA 2PZKA 3FSEA 1ZN8A 4J8PA 4QTZA 3IJ5A 1M5RA 1PD1A 2B36A 2X2PA 3QFSA 3L8DA 4NZPA 4FFPA 4TMXA 3S2ZA 1X1QA 4ZHQB 3QA3E 4D81A 1CY4A 1CY8A 3SKYA 1EM8B 1GILA 1GPMA 2IGBA 4PQYA 5HIIA 4H0NA 3IJRA 2JKYA 3L4EA 3PPIA 3I1IA 2E85A 4G09A 3AONB 2VHQA 5J40A 3OHMA 1QKJA 2OGUA 4F8JA 5J4KA 2VCEA 3MFQA 3ZK7A 5CDGA 4EATA 2I91A 3DP9A 4Y6GB 2QTZA 4UBJA 2JD1A 3MSCA 5F64A 5JSKA 1YI1A 4BBAA 2VJMB 4ID9A 4C7KA 3GV0A 2O3JA 2ZITA 2P0YA 4AZ0A 2AC7A 3I5XA 4OB8A 3AM1A 1EDBA 1VRWA 1RJEA 3FNHA 2CLLB 4NIMA 2YYSA 4DTIA 1BW9B 2IBSA 1GNPA 3I32A 4Y6SA 1HY3A 4HNVA 4B3MB 1VJCA 2VRCA 4KDFA 4LOKA 4I4TB 1G3MA 2HHAA 2IV7A 2DLCX 4BC0A 1V47A 2BJHA 4W5HA 2VF2A 3K15A 1F2TA 1IZYA 4KPGA 1O1YA 4X1KB 1RYFA 2CXRA 1L7QA 4YGXB 3RIHA 2FWRA 1FYXA 1GSHA 3DDOA 4O2AB 4A73A 1G5TA 1CUVA 2AE2A 4Y3UA 4EX7A 5HZHA 4AN4A 4MVJP 4PTLA 3T9FA 4Q03A 4ND2A 1K7XB 1V41E 3TL3A 3TECE 4X1KA 3C3CA 1DL5A 2ZWVA 1PJLA 2VKQA 3D5TA 1VPWA 1VGQA 1DDOA 3IDSA 4FBGA 4INPA 2ORIA 4GDFA 5IAGA 2V7BA 1XZPA 1IBCA 4J1SA 1ZIYA 1H85A 1UBGA 3EN0A 3Q9NA 1DKQA 1FP7A 5KJ6A 3GLTA 2WSYB 4DSZA 4GKAA 4H4DA 1ODKA 1T4CA 1NJGA 1XN4A 2EFEB 3LLCA 1E1LA 1MO4A 3Q40A 3UMBA 4BCCA 2Q3DA 4ADSG 4TYWA 2Q28A 1INLA 2YV4A 3KOXA 1GTL1 1QP4A 4KR3A 2QL7A 2AB0A 4LXGA 4N8EA 2Z04A 3U7JA 1LVUA 2DLDA 5FWYA 3O3OB 4IIEA 3NJ8A 1BYIA 5I7EA 2A3NA 3ZW7A 3I2HA 3ILXA 5AW9A 3R6WA 4AM8A 1YAJA 4BBZA 1W59A 2A9VA 4CEIB 1A1SA 2CNKA 4PR3A 4R2KA 1V35A 4OFXA 3OWXA 1YU6A 4IFEA 1KR5A 3U7HB 4LQLA 1CF2O 2WRZA 1XU4A 1Q11A 1ZICA 2G1JA 2JGMA 4R0MA 3L46A 1JFFA 2JCVA 3MTBA 4RVFA 5E3HA 2O50A 4C4XA 3B36A 2IZ0A 2CXUA 2DJ5A 6Q21A 3RF7A 1USWA 5EXEA 2ODEA 3UM9A 1R3DA 1Q1BA 1SUEA 3D7NA 3L4BC 3MJCA 3PC4A 2EIHA 2R65A 1E92A 3GBSA 2DTDA 1HZZC 1L6RA 2W43A 3GFTA 1PYGA 2G4LA 2OQRA 3JD4A 4NL4H 3MFYA 4ZVRA 3L8CA 4D74A 1TW3A 3LZCA 1KOLA 3FIUA 3T9BA 2WM9B 3D2BA 1V8ZA 2P3QA 2FPLA 4IHJA 2N1BA 1YASA 3WGIA 4R0VA 3HO1A 2IPAB 2WFZA 3LY7A 4QVIA 4OHZA 2GNAA 2NAFA 1SR8A 3QTLA 2QW1A 5HW0A 3LU1A 4JC4A 1AXEA 4QFCA 2QW8A 2WPDA 1TD9A 4J4HA 4YK7A 3RDPA 2EW8A 4OJTA 1R4NB 1UMBA 1CQIA 4YRRA 3HNOA 4RO0A 4ITRC 2WOOA 1B4DA 4ZWNA 5CB4B 5LNK6 3KUDA 5BPHA 1V9CA 3ZTTA 1IFXA 1U9CA 1UWKA 3UKDA 4KO2S 3BXGA 1N5DA 3LBFA 5CRIA 3ZE7A 2ONZA 1AZTA 4PCVA 3TSWA 1KIAA 5ADUS 4HI0E 2X0EA 2X6RA 3FRJA 3NBZC 3L0SA 3H0EA 3T3NA 1VJDA 3IPAA 3FOCA 3BFVA 4ANFA 4QUGA 4M89A 3C7DB 2X0FA 4TWIA 2J7PA 2CXXA 2GBIA 3O0TA 4HDMA 2H00A 3X1JA 2O8CB 1OSNA 3E5MA 4MPPA 2GHQA 4RPKA 4ZPJA 5HYVA 1K7SN 2A9FA 3PYXA 4FTWA 3CSDA 1F0NA 3BIXA 1SIOA 3ICCA 1E32A 3O8QA 1LSOA 1IYZA 1SWVA 3N2NA 3RTDA 1YQGA 3VX4A 1JQEA 2O8CA 1XR3A 4CF5A 1R0SA 1Q2XA 2BKAA 4PRLA 2P6PA 3X1KA 3WRXC 4O2AF 4OF4A 5EJFA 2QT0A 3T0GA 1C9JA 1T1GA 4AJKA 1W2WB 1KL7A 4XJTA 3F9CA 1XTKA 3QYAA 2II6A 4HX5A