1F9AA

Crystal structure analysis of nmn adenylyltransferase from methanococcus jannaschii
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
164
structure length
164
Chain Sequence
LRGFIIGRFQPFHKGHLEVIKKIAEEVDEIIIGIGSAQKSHTLENPFTAGERILMITQSLKDYDLTYYPIPIKDIEFNSIWVSYVESLTPPFDIVYSGNPLVRVLFEERGYEVKRPEMFNRKEYSGTEIRRRMLNGEKWEHLVPKAVVDVIKEIKGVERLRKLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL PROTEIN MJ0541
publication title Structure of nicotinamide mononucleotide adenylyltransferase: a key enzyme in NAD(+) biosynthesis.
pubmed doi rcsb
source organism Methanocaldococcus jannaschii
molecule tags Transferase
total genus 52
structure length 164
sequence length 164
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.7.7.1: Nicotinamide-nucleotide adenylyltransferase.
pdb deposition date 2000-07-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 1f9aA00
3CA8A 2CYCA 4UZFA 5TEWA 2O8VA 1NZJA 1X6VA 2A84A 3KT3A 2X1LA 3IOBA 3CVUA 3LCJA 1FYDA 2RE8A 3DLAA 3KFLA 4QREA 1JMVA 1WJGA 1B6TA 1QRTA 2A86A 3COWA 4DJAA 1KH2A 2XRYA 1KORA 4HJXA 4RUKA 4MVYA 2QJOA 1G8HA 3H97A 3D6UA 1WKBA 2J08A 4PY2A 2PXHA 1T6ZA 4MVWA 1PG0A 3A05A 1YULA 2CFOA 5KHAA 3UK2A 1TYAE 5KWVA 4XFDA 2AZXA 1NI5A 2WSIA 1WZ2A 1JHDA 1YUMA 4MWBA 1U7DA 4YP6A 3ZUGA 1JGTA 4NX2A 2QUKA 5H16A 3G6KA 2VTBB 1Q19A 4KR9A 1V47A 3N9IA 3X1JA 2O5RA 2DPLA 1TEZA 2A4MA 3PNVA 1GAXA 1MC1A 1NP7A 4JXXA 5BNZA 1N2HA 1KP2A 1K4KA 3SZGA 3FOCA 4XFJA 4K0RA 1O95D 1NUPA 1KH3A 4HK4A 4J76A 3CVWA 1NYLA 3CLUD 1M8PA 4I6EA 4CDNA 4CT0A 4EF6A 3IH5A 4MW9A 3K32A 4R2MA 2DLCX 1UFVA 4QRDA 1O94D 3PXUA 4GU5A 4WSOA 4GRIA 2QJTA 3NV7A 3AG5A 4F4HA 2QUIA 1X8XA 2CYAA 1NUTA 1J20A 1D2RA 1WXIA 3IMCA 3L92A 2OQ2A 4R0NA 2HZ7A 1WXEA 1MRZA 1GLNA 1FFYA 2Z3VA 4MUFA 3PRHA 2X1MA 4AS1A 3ELBA 1N2BA 3PNBA 5FO0A 3HV0A 2D5BA 4MUHA 5TEVA 3IDFA 4NAHA 1WOYA 2R5WA 5DB4A 1LI7A 3IODA 1H3EA 1T9GS 2H29A 3E27A 1I6KA 4U7JA 1QQTA 3ND5A 2A7XA 1XNHA 4MUGA 4KPUA 4YP5A 3AG6A 2IELA 4KPUB 2X0KA 4ZT5A 4Q16A 1MOPA 2E21A 3SDBA 2JANA 3KT6A 2VXOA 4MW5A 1N2OA 1OBCA 3H05A 1TQ8A 1U0BB 3TS1A 2GKSA 1KP3A 1K97A 2PZ8A 4UZEA 4G5YA 2CV1A 2NSYA 4KR7A 1O96A 4I6JA 1KQNA 3QTTA 5DK4A 4ZCSA 2BTEA 5HG0A 3IVGA 1RQGA 1GN8A 3ND7A 3RBAA 2JA2A 3FG9A 3UY4A 2PZBA 3AFHA 1WY5A 3ND6A 3X1MA 2V0GA 4S1OA 3FI0A 1KAMA 5F23A 4DDKA 4MQ6A 3X1KA 3COVA 3FY4A 1DNPA 1YI8A 4KR6A 2H2AA 2IP1A 3IMEA 2ZUFA 4ZCPA 3OP1A 3TQIA 2TS1A 3LE8A 2ZP1A 3P52A 3BL5A 1OWPA 1H1TA 4YBRA 3SYTA 3CLTC 1MB9A 4OUDB 2XRZA 1EFPA 1S4MA 1EUQA 5FO1A 4OUDA 1XNJA 4TS1A 4L2IB 2DEUA 1M1ZA 4NDAA 1GTSA 3F3MA 2JAXA 1JZQA 4EG3A 1J09A 2CV0A 2ZUEA 1F7VA 3SEZA 1EJ2A 4EG7A 1WXHA 3GMIA 1JILA 1ZH0A 2PFSA 1KR2A 2QTRA 1HYBA 3LOQA 5J59A 1KAQA 2A1UB 5TS2A 2J07A 4CDMA 1TYDE 1NUSA 4PBRA 1JEEA 4NAUA 1IRXA 2PZAA 1G8FA 1YUNA 1M8GA 1VBKA 4XSVA 3AL0C 2WQ6A 1R6TA 2GM3A 3RK1A 3CVXA 2HGZA 3UC5A 4BWVA 3ILVA 1H3NA 2IJGX 4EGAA 3N05A 3G5AA 5AHWA 2E0IA 2AKEA 3ZXSA 1IQUA 4HPWA 2DR2A 5FNZA 4ZT3A 1ZJWA 4JXZA 3A2KA 1U3DA 1G8GA 1WXFA 4K03A 1G59A 2DXIA 3IMGA 1Y42X 3P0HA 3CVYA 2YY5A 3D6VA 1EUYA 3CR8A 4CQNA 3RHSA 1MB2A 3CLSC 2CV2A 2CSXA 2DERA 3VRHA 4MW0A 1PFUA 3ZJTA 4NATA 2QUJA 4I6GA 1JIIA 3Q10A 3GLVA 3UOWA 1N75A 1O97C 4DE5A 4MLPA 1NUQA 2E18A 3CLRD 2CT8A 2Z09A 3VGJA 1MAUA 5K0SA 1PFWA 1TFUA 1M8JA 1N2JA 3A04A 5TGTA 2DUMA 1QJCA 1IQ0A 1OWLA 1GZUA 4F3RA 2QJFA 1M8KA 1LW7A 1JEDA 4U63A 1R6UA 2WQ7A 3IOEA 4H3SA 1NSYA 1KQOA 4JFAA 4DDHA 2A1UA 5JBNA 3M5WA 4P2BA 3MXTA 3TZLA 1KQPA 3FHJA 5IJXA 2WB2A 3JXEA 3OTWA 3ZIUA 1WQ4A 3AIIA 1Q15A 4ND6A 1N77A 3HZRA 1I6LA 4JZYA 4MUKA 3TZEA 4PBTA 3ZJVA 4RPIA 1ZUNA 3ZXIA 1OBHA 1ULHA 5LLTA 1PFVA 4ZT4A 4NZPA 1OWNA 5IHXA 1VBNA 4FZJA 2D13A 1F9AA 1QRSA 3TNJA 1QRUA 3CLUC 4MWDA 3QTBA 1OWOA 1N2IA 1IHOA 2VTBA 1MBZA 5LFAA 3HFJA 1F7UA 2Z08A 3L93A 1H3FA 3Q12A 1N1DA 3A4IA 5K0TA 3NBKA 1T6YA 3DV2A 2YWCA 1R6XA 4ZT2A 2CUZA 3QE4A 3TQOA 3FH0A 2DETA 1EFPB 1Q77A 5KCMA 1KKUA 3SP1A 4EG1A 2E89A 3GUZA 4ZCTA 1YIDA 1O96B 2QUHA 3IVCA 2YWBA 1IH8A 2V0CA 1J21A 1IVSA 2G36A 4ZCRA 4MW1A 3VU8A 1PFYA 3ZJUA 1I2DA 3H99A 4J75A 1I6MA 5J5AA 1JZSA 3FDXA 2BYTA 1LI5A 2PIDA 3ISJA 1T9GR 1F4LA 2J5BA 1WXGA 3INNA 3PNYA 3U1VA 4A91A 1T6XA 4EG6A 1O0CA 4QBTA 4MVCA 1O5TA 4MW4A 3CVVA 2I1LA 1CT9A 5HUJA 4MWEA 3FNRA 3I05A 3CLSD 1M8FA 3COYA 3FETA 4HJRA 5J58A 2EJCA 2QTMA 4OJMX 3CLRC 1OWMA 4ARCA 3S3TA 3RJZA 1GTRA 4E1AA 3AKZA 2QTNA 1VL2A 1TYCA 4KKVA 2NZ2A 1MAWA 3P0JA 4ZCQA 1XJQA 1SURA 3IUEA 1O94C 4MWCA 1J70A 1IFXA 1N2GA 4G6ZA 1TYBE 3N8HA 4YMIA 1BS2A 1YIAA 4WNYA 3HMQA 4MUJA 3CLTD 4DLPA 1IQRA 3KT8A 1N3LA 3K9WA 2RD2A 1O95C 1ILEA 2C5SA 1NUUA 3MLAA 3IVXA 4MUIA 1KH1A 1WQ3A 3G59A 3MLBA 1QU2A 5LM3A 2PG3A 4EG4A 3NBAA 4DNXA 1V8FA 4JYZA 1ZH6A 3C8ZA 3RK0A 5H7XA 4ZT6A 3H9BA 1NURA 1JIKA 3P0IA 1N78A 3H9CA 4U8HA 1EFVB 2A1TS 3SZ3A 2D54A 3IOCA 1N2EA 1U7XA 2A1TR 3ZGZA 1M83A 2CYBA 2EL7A 1EFVA 4EFKA 1EE1A 2YXNA 3RFFA 1A8HA 3HGMA 4L2IA 1J1ZA 2GOYA 2OV4A 4ZT7A 1GPMA 4EG5A 1Q11A 3Q4GA 1EXDA 1J1UA 3IUBA 1COZA 4Q93A 4MAFA 4EG8A 4PBSA 4YP7A 3MMXA 4MULA 1JECA 1O6BA 1VLHA 4MUNA 1OD6A 1PG2A 4MUEA 1JIJA 4MVXA 3UMVA 1U3CA 4MW7A 2J4DA 1K92A 1MJHA 1XNGA 2B7LA 5DEOA 5HUHA 1K4MA 1O97D 4MW6A 1VBMA 5DASA 1QNFA 4ND7A 3DO8A 4AQ7A 2HMAA 2J09A 3MUEA 3FWKA 1O0BA 3COZA 2X3FA 2AG6A 3KT0A 3N2YA 3HL4A 4DDMA 1QTQA 3FIUA 1QU3A 2A88A 4X0EA 4MW2A 4ARIA 1P7PA 4R2LA 4G5FA 5EKDA 3DPIA 3SEQA
chains in the Genus database with same CATH superfamily
2RB4A 4DUGA 1P44A 4JOCA 1KF0A 1S3FA 3CNLA 5TPZA 3WGKA 4YY3B 1FL9A 3EH2A 3QEOA 3WNBA 1OXUA 1PT5A 4L3WA 4J0DA 3K6KA 4CCWA 5KOHA 5E8RA 5A9TA 2F3RA 4IKEA 3DQPA 2XGSA 1GYRA 1Z6YA 4V2UA 3SJAA 5K8UA 3QVSA 2IW3A 1FRVA 2P0YA 4P1ZA 4P36A 3T9BA 4M7OA 2YQZA 3RFUA 2GBCA 4F5ZA 2OFXA 4R2HA 2OCXA 4KXNA 1E96A 1SA0B 3U9LA 1G4HA 1L5RA 2PJDA 4KUGA 2F9FA 2X5NA 3E53A 4MEAA 1HXHA 1Y1SA 4JY7A 4C2TA 1V8BA 4ASUA 1AKYA 1PG0A 1P6UA 1SCIA 2WVJA 3LKZA 4ZVSA 5IT9A 4Q4DA 3GEHA 1ZH4A 3WR5A 4O5AA 3LCRA 4GBJA 4X1YA 5FR2A 4IYRA 5FI0B 2ADFA 2AGVA 4MUYA 2W70A 3U39A 3QLUA 4BQQA 1CZUA 4DAEA 4LFAB 1P5JA 1CETA 4YA6A 4F8JA 1YQTA 3QLTA 3AY7A 4BV9A 2IIBA 1YDWA 4WADA 1P4SA 4D1YA 3LYAA 3I45A 1RRMA 4Y0NA 3T7CA 3KU1A 1NBEA 4M21A 4UAVA 1RP1A 2QGZA 3SZUA 5FLKA 1NFQA 1YD7A 4AY5A 3ILXA 4WLUA 4MPTA 3LF1A 2FEWB 4LXYA 5FOWA 5AVRA 3K71B 1KRWA 1MO5A 3C7CB 2IP4A 4F85A 1V11B 1NVDA 3UXYA 2HF8A 1U0JA 3GF4A 1F20A 1FPMA 1Y48E 2JNWA 4QOHA 1E4VA 3WKDA 4RK4A 2ODEA 3MOGA 3PCRB 3I32A 1NW4A 4I1RA 2EFHB 2MYNA 2R4QA 3C3WA 2AC2A 2Q3EA 3P96A 4I19A 4KLZA 2A9JA 3CLKA 3WLPA 9MHTA 1H23A 1U65A 1XRJA 3LRXA 4Q03A 4K0RA 3V1YA 1O77A 4XSHA 2WC1A 1EVYA 2EGHA 2JFPA 3TEMA 3LY8A 4QYMA 1IHPA 2Q49A 1UOOA 5EYPB 2WG0A 4YB8A 3A28A 5KSYA 5CA0F 1FFXB 5SY6A 2PO5A 3RWBA 4D02A 1HBJA 4WBNA 3O31A 3GCGA 2LZ0A 1TZ2A 2ON6A 3VFDA 1XAIA 4W9MC 3NLLA 4XDZA 1LX7A 2JHPA 3G2NA 4BB0A 2X9LA 1HMPA 4LJYA 3OZRA 1Z4JA 3AVQA 1FP6A 2QUIA 3DQZA 3ITEA 2J3DA 4RTOA 3JD2A 3HVKA 4PLYA 2GCOA 3JWPA 3BRWA 1KY2A 2I4IA 5ALMA 3VOSA 2C57A 4X1KA 3WA6A 4FZVA 4JVLA 5HW0A 3WAJA 2E4WA 4UTZA 4HV4A 3ENQA 2NUPB 1PX0A 2IXTA 4OLAA 5AW0A 2JI6A 4XWOA 3RYHA 3PNBA 2ZU0C 1MT0A 2J3LA 4PNEA 3G2KA 2V7BA 1UZMA 2LRHA 1GNTA 3HRHA 4JXKA 5EUQB 3VYTB 4LV8B 4Q1EA 1ISJA 1XFDA 3AERA 1Y4DE 4YH1A 4HQLA 1GIAA 2PQMA 3R09A 3H2HA 2CXTA 5AW6A 2B3TA 4YYEA 4FILA 4JI0B 4KHPB 3MOIA 1JDJA 4EUHA 3GA7A 4UREA 1Z0FA 4YV7A 4LZAA 1IMJA 1QJ4A 2ODBA 2PKXA 2RAVA 1QCZA 2WPDD 3AUYA 3EAGA 3GRVA 3OT4A 4KP7A 4MUGA 3GB9A 1GITA 2BHLA 3NETA 4R9RA 5IXYA 3SX4A 1T34A 2P4SA 2X0KA 2VZ8A 2FYTA 1OROA 5C0OE 1BCSB 1VMDA 2QTCA 3MC1A 3W7BA 4BQEA 4J0CA 3A1EA 2D2VA 5I47A 3PP8A 5HR5A 2FWJA 5HOQA 2RB5A 2KBFA 1YZNA 3F3KA 1FMCA 3FLBA 5LLSA 1YU9A 3HCEA 1DUSA 3E0QA 4FSDA 2Y0PA 4IV0A 4A2PA 5KCZA 4EGCB 1E66A 2MINA 3PE6A 2Q3CA 4IQFA 5J9FA 4LCEA 4HGNA 3O7MA 3PQFA 4RIFA 2R6GA 3WI7A 2GWRA 1B1AA 2OHVA 2JH8A 2HHAA 3A1TA 3DVAA 4JJGA 1U9YA 3W2GA 4GVXA 4EKYA 2CHQA 3DAHA 5F21A 3M5CA 1JKJA 2BGNA 4NV1A 1A0OA 4UU1A 2F62A 3QVTA 3D8SA 3UWPA 4BYGA 2ZBGA 1ULAA 1VMKA 5CAEB 5CEJA 3QOWA 2PSSA 2WK1A 2JC3A 4PZ9A 1G20B 1TI7A 1YBHA 2NSDA 5FNVF 2R1VB 3OMLA 4QJ5A 4QTXA 1JLSA 2QD2A 2Y4NA 4QPNA 3RYIB 5KVSA 1WUTA 3T7EA 3GLRA 3R6WA 3GEDA 3MCVA 3CNBA 2VTKA 2PFKA 2A0UA 2PRZA 4HLNA 4AZWA 2GZHA 3D4PA 5JAQA 2ZSDA 1N33B 5IULC 5A9RA 1QHHB 1LQ2A 1IXYA 1NLYA 2YVAA 3IQWA 1K68A 3VSCA 3B51X 3I64A 2AMJA 1NJ1A 1NVUQ 1SAYA 3JZFA 4S1PA 5I7UA 5KYYB 1XQYA 4PWYA 4MV0A 1MV5A 3SEZA 4R8MA 1K7CA 3FCYA 4NCBA 2VPXA 1TGVA 2VPPA 5NULA 1TE2A 2C7BA 5J59A 3TKYA 1ORRA 3IR5A 3ZY3A 1GVNB 1QIHA 1JB1A 1G4AE 3OJLA 5BNFA 3ZJ5A 1H5QA 3L7MA 4CDMA 3FMGA 1I80A 2AEMA 3ASUA 3LWDA 1IK4A 2PZAA 4F2HA 5LL6P 1C9KA 1XUOA 2ZB8A 3GARA 3I34X 3TLKA 2NO0A 4IWXA 2GM3A 4PGFA 5MF6A 5D2CA 3BK2A 3HBAA 4RM3A 1FQOA 2B99A 3QXXA 2FJ0A 1RAIA 5G0UA 2JI9A 3CRQA 1Z0JA 4Z9BA 1E69A 4OBXA 3BXOA 2GEVA 4Z9YA 5J5CA 2IZ0A 2BFDB 4AX8A 2HD4A 3ZWQA 4YP1A 4BLQA 5TB5A 2O2XA 1THMA 3Q98A 4ZPXA 5CEEA 4KMOA 1EH5A 1KYQA 5KNCH 1RLIA 1T4MA 4IOKA 2QVXX 1GD1O 1Y42X 3SE7A 4B3TB 4X45A 2JFUA 4ER5A 1T9ZA 1XELA 2VHQA 2R1ZA 5CHEA 1FQKA 4MQMA 3VBEA 3ABQB 1G2QA 5KO2A 3A06A 1MG0A 4U02A 5GTDA 1E61A 1Y6QA 3GNLA 1BOFA 3QU9A 4H08A 3Q10A 3AP1A 4MS3B 1R27A 1LF0A 5J63A 1UDAA 1UMCA 3WL4A 4U3JB 1RI1A 5LMZA 2PX3A 5B1EA 3S1SA 2F67A 3OT1A 4G0XA 2GK4A 3TQFA 2NV6A 4B33A 4NV0A 4X95A 3RIGA 3OSZA 1I7SB 3AEKB 1NZDA 1JN0A 2FAXA 1A5BB 4FGLA 3FLAA 1HTBA 1UBUS 4EBBA 1ZD2P 1NHGA 4MZDA 1IJEA 2QM8A 1PJRA 4R31A 3WQHA 3R7WB 1X1BA 3G9ZA 3IOEA 4YRQA 1PV4A 3PFFA 4YWJA 2Q1YA 3BXZA 2IYNA 3C4JA 2Q5FA 3F3SA 4CMIB 1RZRD 1CR6A 4EA7A 1S7CA 2ZWVA 2X4LA 3MXTA 3FHJA 3PCTA 4AG5A 1FNMA 1IATA 2R3SA 4P7KA 4PSDA 1A9PA 4YUZA 4H6VA 1A5SB 2HA7A 2XDYA 4BNFA 3QW4B 1LS6A 1ENYA 1XK6A 2QD4A 4A7PA 2VQDA 4TSFA 1HORA 2YV3A 2PS0A 1W6RA 4W8GA 5KYXB 4IAOA 4L5IA 4PBTA 4N48A 2C9MA 4RPIA 1J97A 1KYIA 4EI9A 3DL7A 2JLBA 2G28A 2HQRA 1GTJ1 3QEMA 3A2NA 2WKQA 3F9RA 3GVHA 2F43B 3OOSA 4EHFA 5BV1A 4BN0A 1Z4LA 4ZRNA 4N5HX 5GJCA 5C35A 3TNJA 2ZSBA 3EA5A 3AIOA 1BEUB 1IL0A 1EPUA 2P5TB 2IWRA 3EMBA 3TIIA 4HH3C 1W0KA 2C2ZA 3T34A 4BMPB 2A5FA 3A7DA 3SR0A 2VJQA 2VJCA 2JZOA 1GFIA 5ARBA 2HHJA 4C1BA 2HJ9A 4O2BB 2WVGA 2BMEA 2V6GA 5FBZA 1QKJA 5HTKA 3ZGYA 1MHPA 1L5GB 5BWLA 1SC3A 2G3YA 3DOFA 2BUCA 3RE1A 1E63A 3D9QX 1QRDA 4FU0A 2CUZA 4F2GA 4HDNA 4MKXA 2VDRB 3TO5A 1AV7A 1KA9H 2FPUA 4FFOA 2PMKA 1QZ3A 3T7TA 1OPRA 4CM9D 4EG1A 4DHEA 2GCGA 1XRPA 4BU1A 2HQ1A 2IV7A 2QUHA 2CLEB 3IVCA 3OCCA 1JALA 3HA5A 4PNPA 4IRXA 4RJJA 5DGIA 4KV7A 3LTNC 2VBGA 1BGVA 1M74A 3QK7A 4MQFA 2R87A 3DEAA 3D8UA 3ZZ0A 2H9IA 1N4AA 2I80A 1LVHA 3H99A 5EQTA 3REOA 4CZ2A 3T5PA 1OIXA 4IWNA 5G0VA 1IOZA 2JBAA 3C3YA 1YI0A 3JZDA 1RSZA 3UCFA 4N6NA 2ZT7A 3AOEA 1E92A 4OQFA 5LBUA 3SF8A 2GEJA 2A2ZA 5E7JA 3ISJA 3L2OB 4H31A 5EZYF 1F4LA 4HZUB 1ABFA 1PCXA 4JQZA 2QORA 4A91A 1GKUB 4ZHQA 4KR2A 4Z53A 3RYCA 1WSDA 1O5TA 5KTKA 3DHVA 3P2JA 2OUKA 3FNRA 4CTJA 2C94A 4P3XA 2NXJA 4ZV4A 5KJ6A 3LWBA 4R1MA 3UJDA 3NCTA 2J0UA 2VBFA 1ZMBA 4HDRB 3BA1A 5EEGA 4Z8XA 3R24A 3VKUA 3G0BA 4FCVA 2NNLD 1C9YA 2FOXA 3DZJA 5B1DA 3DEIA 3RJZA 4BCDA 2Q50A 4BE4A 5ARDA 1XTZA 1SIOA 4LBZA 3Q1LA 4RZ3A 2VO1A 1UWCA 5KB3A 1ENZA 3NDIA 1T43A 4BV3A 1F2VA 3IAXA 1KK3A 1H2XA 5HS6A 2Y1GA 2YQ5A 3PHBE 4P08A 3W5BA 2RH9B 3OAAA 1CEYA 4UTXA 4WQMA 5CTAA 4KOEC 5YASA 3V8QA 3UPTA 2VHWA 3AC0A 2H4XA 2Y9PB 2REXB 2NADA 3GFGA 3Q85A 4G86A 1YH3A 1G21E 4I1VA 3KLBA 5AJTA 2FWAA 1M6VB 2GPNA 4FT2A 4NBNA 1W49A 3MWJA 1A1SA 2L69A 3H5AA 3MSCA 5GWXA 3AKYA 4LYAA 1KYVA 4MTLA 3P2EA 5K8JB 3NIWA 2RD2A 1YL5A 2H2HA 4OM8A 4N7MA 3LIIA 5IC5A 4GQIA 2PU5A 1WA5A 4J29A 4OGGA 3V1UA 1Z0SA 2NAPA 2B5OA 2VZ9A 2O52A 4CRWB 3GOQA 4GEGA 1TMOA 3QXJA 1S0UA 1MT3A 3WZMA 2XT6A 2YZ7A 3OM0A 2ZJBA 3R40A 4GP9A 3VR4D 2CLMB 5F1PA 4QE3A 1T2UA 3Q88A 1EFRA 1RCFA 3UK0A 3RTBA 3BXFA 3QNWA 5L3SB 2VYNA 2J3HA 3LWZA 1BFDA 3GW8A 3RSFA 3ABSB 3A0RB 4NYMR 2WHPA 1OHHD 2WFLB 2Y1XA 1D0SA 3C0KA 5JSQA 4JI7B 3IEVA 1MLDA 1Q14A 4MAMA 1DBPA 1NV9A 1XD8A 4UNNA 3Q9UA 4P7GA 4UQPA 4RH1A 3HUFA 1RMTA 2ECOA 4EITA 2P6RA 1M83A 3GGJA 1K6XA 1S5PA 1W29A 4WK2B 5MFZA 2HSWA 2YXNA 3CXRA 3FSEA 2VDWA 3LRPA 4KO4S 2Z8ZA 4G5SA 4QQRA 4TLCA 5BWBA 3MRXA 5I7HA 2P75A 5K2OA 2GHQA 1J1ZA 4A3SA 4CKWA 1FNDA 1RU3A 1DKQA 3HGQA 4MR9A 3QELA 4YAEA 4ALIA 4QOGA 1DQSA 3KKPA 1OGJA 1RKBA 2P11A 4AYXA 3T5AA 3I5YA 3JVVA 3HY6A 3H2SA 4PIMA 5IX8A 2COKA 3VSDA 1TGYA 1CDDA 3ZGVA 3L6OO 5BV2P 2CEAA 1OH7A 1NKVA 3B2NA 1S6YA 4PBSA 3ORRA 1NIJA 3G0GA 1XXLA 2R9VA 1OT5A 4JOQA 1SXJD 4TZKA 1QE3A 5DTEA 1L5NA 2C2KA 3MWFA 4TMWA 1ORHA 4XPZA 1ZVVA 3VVLA 3CUWA 3MS4A 4W4TA 1AGXA 4GC5A 1AN0A 2XAUA 3P2IA 1FDTA 3THOA 3U3XA 2ASEA 4D8VA 5AM3A 3LUBA 4GOJA 4D46A 1Z2NX 2V5AA 4AZTA 3LW7A 2ES4A 3SXJA 3RVJA 5B57C 3NHSA 2ECPA 1AMOA 1DAKA 1SVIA 1PZGA 2QX9A 7ADHA 5JJCA 4PX5A 2BR4A 3KRTA 5BQFA 2H4ZA 3VYSB 5JNUA 2HJSA 4IJWA 2R1VA 2FZWA 2Q27A 4JLSA 1JHUA 2W2NA 4LXTA 2QWXA 3JARA 4X1IB 4AYTA 1IVYA 4E94A 3T99A 3VR5D 4HYYA 2YWJA 4JUIA 3OQJA 1VP3A 2W37A 4X0EA 4RH3A 5ALZA 5AWFC 5BWOA 5KDOA 1L4YA 2QSZA 4IIJB 1GQSA 3RIXA 4E6EA 2V7PA 4UDNA 2LP4Y 4JBHA 5TEWA 3EYWA 3EVZA 3O1LA 2ZZNA 3R5JA 5IJWA 4BTVA 4AMUA 1K5GA 3DLAA 1T4DA 4BS9A 1X1RA 2CXPA 1EM8B 2D3TA 3P2KA 4M0FA 2UVQA 1Q2XA 2DT8A 3ZH2A 4TYPA 3ZYCA 4D92A 5JEDA 2AHOA 2EP8A 3J81A 5E6RA 1DQRA 3PC3A 2FSHA 3C2QA 4IMPA 4XQ9A 5BQXA 3QA3E 2B21A 4K5QA 4JLDA 2A0KA 4XE5A 1FLVA 2GBLC 5H68A 3WIOA 3D0QA 4V38A 2H6EA 1F2DA 4Q9NA 3ZWWA 3DR5A 4UAUA 3B1WA 1GPJA 2VF5X 2C2YA 2CE7A 2GVZC 4H1VA 1AXRA 4L08A 4RETA 4C30A 3ZBTA 2H1CA 4AD8A 2V3VA 3I39X 3OHPA 1C3VA 1N6HA 3HY4A 3HCDA 1Z5OA 1H6BA 1LWNA 2PX2A 2XPCA 4NVRA 4WZBB 3SQNA 3VPXA 4RTLA 2ZVJA 1EFHA 1N2SA 2QVBA 5K09A 5KYNA 1R0LA 1EK2A 1ODLA 1XU4A 4XXHA 4BQNA 4CV0A 2FPPB 1VI5A 4NX2A 1KBQA 1DIBA 1CEQA 1XI2A 1YRBA 3DE2X 2PGNA 2ZYAA 4L73A 4AZ3A 2W2MA 1Z6XA 4V3CA 2JIMA 4CMCA 2O5RA 2BFAA 5IJ0B 3SZMA 2GLUA 3HH8A 3GR6A 1U7TA 1THTA 4NBTA 2CUTA 3KYIB 1TKAA 3FYHA 5TF0A 1IBCA 3IPCA 1K2VN 2G67A 4JZKA 5M3BA 4AZVA 3V1NA 4X1KB 1X1SA 3CB4A 3EQ6A 1N2HA 1UM9A 2Z4RA 2V9CA 4D9HA 4UW9A 1XWWA 2BM0A 1OX4B 4K05A 2ZXFA 3MWGA 1NKSA 4WD3A 2QVCA 3TZKA 1LUAA 4QQFA 4MGEA 4AKEA 5B7GA 4EP1A 3BORA 4F7DA 2CJYA 1C0IA 4NZ9A 2BV3A 4DLXA 1YVEI 3L0IB 4URFA 1H94A 3NOXA 2ENWA 1BVHA 2OD7A 4J6EA 5LWQA 2UAGA 3IAAA 1FP4A 4EB0A 1RHQA 1JH9A 3K32A 3ZU3A 1V8PA 2VS1A 3W5SA 3JRNA 2EF0A 2GNAA 3EIQA 4XLZA 3PXUA 4ZAFA 3B6MA 4WBSA 5CXQA 4ECEA 1UPBA 4HATA 4M0PA 5E2AA 4F96A 1N5JA 3AG5A 1PTJA 4B7ZA 3EGEA 3OSUA 5KTTA 4WN3A 2XF8A 2B8TA 3H9EO 4F97A 2PZFA 1I3OA 1MO2A 3L92A 3ESQA 3AW8A 3FA2A 4I5DA 4RDXA 1RAHA 3NTUA 3T3PB 4IEFB 5LBIA 4RTJA 1LQUA 4BO0A 1RYEA 3A9SA 5CB4F 3NDJA 1JTVA 1GGKA 1KK2A 3G89A 4FIDA 3ZD6A 1IEQA 3FB4A 6AT1A 3GGGA 5ALOA 2PUEA 2REQB 3K0AB 4N82A 3G5TA 4PW0A 1OZAA 2QY6A 2D5BA 1IYZA 2DJIA 3M6WA 4BLPA 1FEZA 5JECA 2N9UA 3FPKA 1HTTA 1A5AB 4WN9A 3RIEA 2OO5A 1U7OA 3JZIA 3FSRA 3MAJA 5KKAA 2QZZA 1KEKA 3D3WA 5KC8A 2BEWA 3TL2A 4GYKA 1F4PA 2H29A 5AP9A 5I9TA 2XF2A 1SY7A 4NWIA 1NUHA 4WWHA 1GL3A 1QB8A 4HUTA 3FYCA 3ESRA 3RODA 3X1XA 5C1BA 3H83A 3HYLA 5DI3A 2C97A 2J9XB 3A4TA 5AVUA 5JH7F 1JS1X 4NOLA 1AUXA 4Z3OA 1F9EA 2Q0QA 3KT6A 3RS7A 3AR5A 4UNRA 3I42A 3BVPA 4PC1A 3JQGA 3RUHA 5HPYB 1YB1A 1SXPA 3U31A 2RK6A 4DZTA 3V46A 4EKGA 1PV2A 1I4DD 1P9RA 3PGMA 1TK3A 3PFHA 3GJ4A 1XZIA 1QFSA 2D1FA 2NSYA 2PCLA 3FPFA 4GW3A 1PEKE 3PUKA 4S0XA 3CRNA 3F47A 4TQ9A 2YMLA 3UPUA 5HG0A 3CO0S 3M81A 3ND7A 4YT5A 3T4EA 3DCNA 3T38A 1H42A 3NM4A 4Y6RA 2B0CA 3ZS8A 4V2IA 2RJ3A 3BS4A 5DWDA 3OWXA 1QV7A 3R0VA 2V0GA 3WLIA 4I9FA 2W4MA 3M3PA 1PVOA 1I94B 4JDPA 4BNIA 1ZO8A 2IKQA 5EMNA 2R60A 4Q39A 1XZDA 5B1HA 3TB6A 3UBTA 3G2IA 1GGVA 1ECPA 4I1IA 4MI1A 5TPWA 3U0BA 3BAFA 4M1SA 3VPHA 3KZXA 3V9PA 3FUVA 3OFJA 4M0UA 3BL5A 5BYAA 1AGRA 3UOGA 2GCEA 3A6JA 4HDMA 3IUSA 3HKCA 4IW3B 1S02A 4TRRA 3IBYA 2BHTA 5CGQB 2OAQ1 4R54A 2FRDA 5KVAA 5EWMA 3E5MA 4GG1A 2EFJA 3AU9A 4HWKA 2BOVA 4Z86A 2ZGVA 4DIFA 3ZK9A 5AHOA 1BW9B 4A6EA 4C7VA 1KWKA 1IQPA 4KVAA 4FDLA 2YOGA 1NN0A 5JNWA 2P4HX 3ETHA 5LXTA 5EJGA 3VDXA 1T4BA 1N7IA 4OHWA 4DB4A 3LGAA 2PX4A 1RM0A 1Y3CE 2QTRA 5AUPB 1IZZA 2WA2A 4H7KA 1P2GA 3GLTA 5JCJD 3QYAA 5CA1B 3WWCA 3KNZA 4DIKA 2XIQA 1BRTA 1Q0ZA 4B3HA 1ESZA 1TCAA 2E1RA 4QWWA 4BFLA 4OY3A 4ZKDA 1AE1A 1QYRA 2BGMA 4IIEA 1NTRA 1R9MA 2W2KA 4H7DA 2XQGA 5HJEA 2OY0A 1R6TA 3WNCA 2HW8A 1JEQA 1W5BA 3L46A 4EARA 2J8ZA 3TQQA 4FR2A 4E11A 5FHQA 1RJFA 4ZVTA 3MWLA 5D3ZA 5HFNA 5TQ0B 2F6RA 1HKUA 3OIUA 2ZIAA 1ZH2A 1Q7TA 1Z39A 4LWPA 3AB3A 5DYNA 4UC0A 4X5OA 4V0RA 4RLHA 2ZOSA 1XPJA 1DIAA 2FK8A 3EVFA 4EZIA 4F93B 3RJ5A 3EZXA 4L8WB 1GRQA 4NCAA 1G8PA 3E2PA 2E5WA 2DKFA 2IHUA 5EIHA 4D44A 2P5YA 3U09A 2NYRA 1NVKA 4KX3A 4ZIRA 4JENA 3SS7X 4U6QA 2WAAA 4CODB 1U3GA 4YUXA 1JHMA 1RYZA 2ADOA 3O2SB 1NASA 2JCGA 2ZKIA 4QUIA 1DKPA 4DADA 3RU9A 2D7JA 3KUDA 1SQFA 2C5EA 1GZDA 1IPHA 1HE8B 2XMCA 3EJ6A 4H2DA 3VRHA 4JJKA 2ZRCA 2GSDA 3ZDDA 2A9FA 3KXDA 1F60A 1O97C 1VI2A 4NBVA 1CF4A 2A5LA 2JARA 4NF2A 1NUQA 1YK1A 1NX9A 4B45A 4CE6A 5CDSA 1MGOA 5JAZA 1CUSA 1CV2A 1ZEMA 2ZRKA 3C1OA 3IQDB 1U28A 1F06A 4IIJA 4OP2A 3DFKA 3DZCA 5F4ZA 5FA6A 2D0PB 4GF5A 3UWKA 4DQ0A 5IEJA 2Z57A 3N75A 2AX3A 4BVJA 4HADA 3I9NA 1H69A 5C31A 4GSKA 2NSLA 4KXMA 2C61A 2Q7DA 3AKCA 4PYMA 2RGYA 3B1XA 1NN3A 2P5SA 4QUBA 5KTSA 5HKBA 1KQOA 4MKFA 5DIZA 3BZWA 1PR4A 1OTHA 1OTYA 1U1FA 4P2BA 2IV2X 4JV5B 4LSGA 4JR0A 3TMYA 3JAKA 5KJ1A 2ZRBA 4CCYB 4XWWA 4JT4A 1X13A 4ND6A 2A5DA 4TT3D 3ZH9B 1N77A 5CDFA 3O0TA 2XX3A 2V6FA 3L77A 3DBLB 3KYCB 3MW8A 8ATCA 1T2CA 4KDCA 3TOZA 1I7QB 1TM7E 2OCPA 2WIKA 3DZIA 1KYZA 2PAAA 1BD3A 2ZJ0A 4EATA 3V55A 2GJ9A 4H7HA 3R3WA 2BMJA 4HZIA 3WIVA 1BD4A 3NVDA 3AB8A 5E8JA 4YP9A 1LTQA 1UPUA 3M3DA 3W05A 4LQCA 5EUBA 3R9XB 1WABA 4YO7A 5IW8A 5TGZA 2VJAA 2WG2A 3K2QA 2E6UX 1LRLA 1EUCB 2V4ZA 1ZICA 3RABA 2XYRA 1OZHA 1V35A 3RV3A 1TK2A 2YTZA 3Q12A 3EYAA 1D03A 1KYWA 1ONOA 4XZ3A 4YASA 5CA1A 3THWA 2Z4SA 2IX9A 3MRTA 1C9JA 2HNKA 5DULA 3JQBC 1GXSA 4MVJF 3SVLA 4ZT2A 2PNJA 4DKXA 3WLJA 4ERXA 5ICSA 2KW5A 2Q99A 3ANSA 2DFDA 4FCWA 1N5RA 1E3DA 3TQOA 4EJ0A 3DM5A 1KPGA 1TADA 1WCV1 2JIZD 3F7TA 3QE2A 3CY6A 4HB0A 5TT1A 2K7FA 2FNAA 4MR9B 2H9YA 2XTMA 3M3HA 4OGLA 2GAOA 3OKAA 3WICA 4HOYA 3NAQA 4RCZA 1DFHA 1UMDB 4FFBA 3B3JA 3TLYA 1PJ4A 4TMVA 3ZK8A 4WZ6A 3JQRA 4AX4A 4Z0NA 2F59A 1F6WA 1CRZA 1NY6A 2VDMB 4D41A 4GPIB 2Q5LA 3OKFA 5IK2A 5JYEA 3IJPA 2OVFA 2GEUA 5ERXA 2XUQA 3ZWNA 1XCBA 3THXA 3A6DA 1LSUA 1WZEA 2HWKA 2HXSA 4G8BA 1T9GR 2OYRA 4YV0A 2GM9A 3P9KA 3AEUB 3ZW7A 2PV0A 4HMOA 4WDQA 3CH7A 1SK9A 1XPUA 2GYUA 3W9UA 1KO1A 4WCFA 3FKSD 4UM7A 1CT9A 4J07A 3VNRA 2BCJQ 2B9EA 3OPMA 4WECA 4H4DA 4G0WA 1IY1A 4OYLA 4AIRA 1DI0A 2QOEA 1OBFO 3PWZA 5HIJA 2JGIA 4Z2YA 3B48A 2GXUA 2IU4A 3I5UA 1FA9A 5A3SA 5T6BA 5CDTA 2AOUA 2YY7A 3WXBA 4TLLB 2O7RA 3W7AA 1VLMA 1KEPA 3N0TA 1I36A 4EUSA 4KMMA 2CL7X 3Q7SA 3LO5A 2BM1A 1UM9B 3GPDG 3HB1A 4OEHA 3K0SA 1JHYA 2HR1A 5JYDA 1KK0A 3SQWA 3M83A 5J3JA 1QC5A 2CBZA 3D2CA 1REQB 3FZEA 3G0OA 2AFHB 4XUCA 2HJHA 1IXKA 3OPYA 2V6JA 5ICEA 3A3PA 3FUCA 2PYIA 3MTJA 4U2BA 1Y9ZA 2E4UA 2JFWA 2KB0A 2O0HA 3DEKA 1GYPA 3DCYA 2QXYA 4BZPA 2ZJAA 3OECA 4YAWA 4Q9DA 1KZ6A 4WASA 1D4AA 4IXMA 2J48A 2ZJ8A 4JC8A 4TS4A 4EEZA 1LS1A 1AKNA 3IUYA 3FTEA 1TLLA 1WMEA 2AI1A 3FYUC 4IPTA 1USGA 3RVDA 3O1JC 4Y8VA 4DR5B 3BGOS 1QMGA 2IGTA 4UNPA 5EKXA 4EW1A 4YRBA 5FD8A 2OPHA 5T57A 4WXPA 1DPGA 1N3LA 1K3UB 1Q0RA 4E31A 3KYDB 5C5DA 1ESEA 2R68A 3AL3A 1CB0A 2GO7A 2J9FA 4MV1A 4ZRDA 1EAYA 1NUUA 5DXFA 5TGDA 1KH1A 2DJ5A 2NXNA 4J91A 3MLBA 4GMKA 5K3CA 3RJTA 1NLUA 2AL7A 3OICA 3TQRA 4CR6A 4WXYB 2GILA 2O7SA 2X8AA 4ZO6A 3ZI7A 3KD3A 4RHTA 2GCPA 3OIWA 3RKUA 3DOJA 2CJWB 4RFSB 5CT5A 1ZH6A 4YRIA 1NOJA 5BSUA 2PUGA 2J9YB 1JHQA 4KXYA 1A5ZA 3CWCA 2DFKB 4Q7JB 1YHZA 2EKZA 3IQHX 2PT9A 3KCNA 3KLPX 4DNQA 1ZC4A 3KR2A 3U3JA 5FV4A 3LUPA 4CI0B 3DGFC 1W4AA 4P54A 1GL9B 3I04A 1MNAA 5JANA 2EGGA 2F64A 3S2GA 2F90A 2G8LA 3KQOA 4FBMA 4G1MB 2NVOA 4HI0E 1RTKA 3U44A 2D54A 1MR3F 1F0YA 4HNHA 2HO4A 3LL4A 2Z9BA 3DOUA 2Z2XA 2UYOA 3FZYA 5IDWA 2AN1A 2Q6VA 4L72A 4I4CA 2F1HA 4BX3A 3IHLA 1LKZA 3C3EA 2OYCA 2I33A 3A36A 2FMHA 2I1VB 1NMEA 1OZ0A 4GX5A 4XR9A 4RULA 2BGKA 5IKMA 1UMDA 3PEWA 1K7EB 2CL0X 2PKQO 1CG6A 2BY4A 3Q4GA 2JLAA 3STVA 4BJ5A 1J0CA 1DCTA 2ZJ5A 2W2LA 2GEBA 2O4UX 3NHLA 4IJ5A 4Q93A 1MXHA 4MAFA 1JHPA 2XIJA 2DHEA 3N0RA 1CJKC 5CD1A 1B8OA 1VLHA 2NP7A 3S29A 3UH0A 1ZW1A 4F9FA 1XRRA 4DQXA 1G3MA 2ZI3A 2X6RA 3K53A 3OLQA 5DGXA 3VU3A 4RVHA 3WO0A 1TZMA 1P0QA 3EARA 4EA9A 5IASA 2WIJA 1RQLA 4CR7A 2H4HA 4BMDA 1E64A 2QBYA 2FW8A 4IGKA 4D4LA 1Q17A 1T25A 4JJEA 1HKHA 3BJRA 3PNKA 3MT8A 1KMHA 4MW6A 4ONEA 4WKGA 1L7PA 2NU7B 1M0TA 3HUEA 3IA2A 3HBLA 1J22A 1SJ9A 4QHTA 1ZM3A 2J09A 4E32A 2C00A 2NUAB 4F45A 4BBAA 3N2NA 4JMLA 1I2ZA 3PZBA 4N47A 4M22A 1SRRA 4MRPA 5D8DA 4DJEC 3T9FA 1N1EA 3PX2A 1DAOA 1D8AA 1YQEA 1QTQA 3ROKA 3VH1A 5JSFA 1APBA 5CYGA 3HM9A 1SCUB 3OZWA 1P7PA 4X9XA 2OBBA 1EVZA 3MN1A 4QDKA 2RJNA 2OBLA 5I9BA 1V3QE 4DSTA 5J4YA 2CYCA 1X7ZA 1NZJA 1X6VA 2NSJA 3I3OA 3OE7D 4DLTA 4HRYA 4TWJA 4F1WA 1FYDA 1NVEA 2R7AA 4QREA 3DTYA 3O74A 4Y3UA 5B64A 5L7TA 3RUCA 1L7BA 2DOKA 1XMVA 4HX5A 3C7TA 4KZPA 4ATNA 2G8NA 3QY9A 1HQKA 3T4UA 1BSVA 1QF7A 3VBCA 1ZQ9A 1YL6A 3Q8MA 1KORA 4AJ2A 1P18A 2X7HA 4QUDA 4RUKA 4Z6KA 3H6HA 3NHAA 4GPEA 4MRSA 1HFWA 1CLEA 4EELA 2XVAA 2P6PA 1PL8A 3MUOA 1FDIA 2R8XA 5FB3A 4CQMD 1QLJA 5A6VA 2GF2A 3NCHA 3BD9A 3LXUX 1OR8A 3D6UA 3FAKA 1WVIA 4JC4A 4YCJA 5DP2A 3GLFB 3A9RA 1OLXB 3OEYA 4PY2A 5KNDH 1HRKA 3OLZA 3MFYA 4WOBA 1ATIA 2R4TA 3WWOA 5KHOC 3AWDA 2H2IA 3SMVA 1OI2A 3CEPB 1LQTA 1CW2B 1XF1A 3EXHC 3KHUA 3C6QA 4OCZA 4UM8B 2FN8A 3VDNB 4EENA 1G4UR 2J0EA 4HH0A 3O8OA 1FS4A 5LYJA 2G82A 4TV9B 3WLLA 3E61A 3FW1A 3LWNA 4LE2A 4N8EA 4P86A 3T12A 3VOBA 1CQJB 4NCIA 4QUGA 2DLDA 3UICA 3WKAA 1EDBA 1SB8A 5GPBA 4GWLA 2ZIUB 3HCAA 3HQ4O 4QJ4A 5FTNA 4Z3DA 1ARZA 4BX9A 2P9CA 1RWWA 5CURA 3IR6A 3UATA 1CBUA 3W8FA 1I3NA 3QKUA 1Z0DA 2MYTA 3NTXA 4CIBA 1JKIA 3FPGA 3L4JA 1TT5A 2FY8A 5BQOA 3QPBA 2NTEA 3WWZA 4MV4A 1RDFA 4N5LA 2Q7OE 1KP2A 2R7LA 3MUFA 3PLRA 2KYRA 2DFLA 4QOSA 4RD6A 3KQWA 4YUVA 1QVAA 5ULLA 3DBIA 4PPQA 4XFJA 5G4KA 4BLTA 1JPNA 5J2TA 4CT4B 3PGXA 5KQLA 2ZKLA 3DCJA 3PKJA 5LLDA 1E0JA 1AOXA 2B92A 4RMIA 1DAHA 1F8XA 4BFUA 3OPQA 1EXMA 4JOSA 4WBNF 4PFSA 4CXMA 2J3QA 2LIPA 3QUCA 3B9QA 3VJRA 4CT0A 3ZHZA 2AUMA 2VG8A 5K0JA 3WLEA 3U17A 4N7RA 1UWVA 3V6MA 2H1SA 3N07A 1J2TA 5AM4A 1QDEA 5JSHA 2WVAA 3X1DA 2CFTA 5BV7A 1AQYA 1L7MA 1W88A 1ZCBA 3F71A 1NXQA 4MJLA 2YWGA 5H81A 1IUOA 1JQBA 4JU9A 3K15A 1ORVA 4F4HA 5B4UA 2WWYA 5K51A 3JPWA 2PUBA 2CYAA 2XUJA 4FX2A 1Q0PA 2JCXA 1DHRA 2P65A 4ZA2A 3RYFA 5SZHB 3LLSA 5MGNA 4RJTA 1OV4A 1KRHA 1WXEA 3EF3A 4INJA 1G19A 2BFBA 2C5AA 3ETLA 3NHKA 1P0MA 2WHQA 1V39A 2Z3VA 3NFRA 4KBGA 5E9WA 3V32A 3THYA 2QYTA 1ZGZA 1C1YA 2Y1EA 3HP1A 3MTEA 4TVOA 4DV4B 1B4DA 2QLFA 1NRXA 3ELBA 1U2TA 4XYEA 6PFKA 3OPYI 4JCOA 4S35A 2FPGA 5FO0A 4I1PA 5DJ5A 1W85A 1ADGA 1ZGCA 3AUAA 4JJ6A 3SGLA 4GPZA 5DSZA 1XVUA 5IT4A 3AI7A 4U6NA 2AD5A 4NAHA 2R86A 1EJBA 1XEAA 1KIFA 5LQNA 4XQEA 3B20A 1ZU4A 1S3SA 1Z2PX 2ONCA 3N8IA 5IG2A 2Y27A 1ZNXA 2I1QA 2PUHA 3I6IA 1U1EA 3LD9A 4TV9F 3QKSA 4RD0A 4U7JA 5JQWA 3CEMA 2Z98A 3IIKA 4GBED 1PDVA 1E0KA 5AQEA 5IBQA 4X7MA 4ABTA 4NL4H 4ZT5A 1TM3E 2A0XA 3C6MA 4J3NA 5KMGA 5LCXA 3V3TA 2XCRB 1XJ5A 4MGKR 1D6MA 1NFRA 1V5FA 3MRSA 4LJ4A 1DOZA 2VYND 5FPYA 1Z4KA 2CVHA 2HYDA 3HBNA 5PNTA 3TS1A 2C1XA 1WKCA 1KP3A 1VQ1A 4U7WA 2H18A 4J0FA 3UH1A 4YRZA 4BYMA 5DNDA 4DQLA 1XPOA 1DBSA 1V5EA 2Z1MA 2C96A 1QKIA 2DQSA 2VWPA 3OZGA 4K9DA 2BBWA 2HTEA 2ZYTX 4PGGA 2Z8XA 2OM6A 2Y92A 3A1VA 1IN4A 1DRUA 4FEAA 2PZBA 1W2HA 1PTJC 5EY5B 4MB6A 3I9V1 2BP7A 2KSQA 4IMRA 1XKTA 4D0SA 5GY7A 2CKDA 4PICA 4IFIA 2RGGA 4HZUA 4B6EA 1KQ3A 2AR7A 1XOIA 3W0LB 1ZOOA 2I5PO 1KXZA 4XGKA 3WGUA 5GVSA 4TLBA 4L7QA 4F4JA 1FBNA 3IMEA 5LQCA 1SHLA 3V7WA 1QR6A 3LE8A 5DNCA 3H5IA 3BL8A 2DSNA 3I1JA 3OLWA 2JASA 2VXYA 4LRUA 5JWOA 2OR3A 2ACKA 1BE0A 4IR7A 3CG0A 4BX0A 2BGLA 1EUQA 1SKQA 5EQDA 4KMSA 2QI9C 1KDTA 3RASA 4PZAA 3ZDXB 1ZD5A 4ARUA 4ESHA 3F3MA 3HNRA 4AY2A 1IHUA 1Z29A 3ZU5A 2GXQA 3PQDA 4F6RB 1ZVMA 2Q8QA 3HYCA 3ZDYB 2XB6A 5BVGB 2PWZA 2YOHA 1OYWA 3N8NA 4ED9A 1GP2A 2AEEA 5AJZA 1GZVA 1CHNA 1QG0A 1P0FA 2UUBB 3TLAA 3KOMA 3DMFA 2JCVA 2DTXA 3ZI0A 4O4JF 3TECE 4J3FA 4UQOA 1W47A 3LPMA 1HYBA 1N8TA 2IEBA 3C70A 3GLGE 1UXJA 121PA 2OD9A 4OA5A 1CPYA 1V95A 4W1PA 5H9VA 5JW6A 3KC2A 1STOA 4C0KA 1X7DA 1N9KA 4D8YA 2E49A 1MP0A 1MVLA 3TZQA 3UUWA 3VVBA 3W3AD 2VJNA 5JAPA 2I7DA 4FJ0A 4V0MA 3AH8A 3ITKA 2AN3A 2OXRA 4C9BA 5HJ2A 3IHTA 4ZAZA 3OOEA 3BB3A 5CJ2A 2AD1A 2IJGX 4WINA 4NYMQ 3TK1A 1A50B 1D6JA 2EQAA 1NF8A 3VKFA 1TUIA 3QI7A 2P2YA 2WUVA 3WGQA 3DE0X 2FI1A 2PLFA 3G5AA 4C7XA 4NZYA 4RK1A 5LP6C 4JLBA 4XVHA 2J9FB 3DW3X 2AKEA 1Z6ZA 2KWIA 4LYGA 1DBVO 1BH2A 2GLXA 8MHTA 4QUJA 2R8OA 1XF9A 1L5HA 5F12A 4BWGA 4MVJG 3KVNA 1F8FA 1HZJA 4DV7B 4EX6A 1A27A 3BMNB 1RPZA 1J42A 1JWBB 4PC6A 1VL5A 3KU4A 4B71A 2W58A 1EA7A 2X76A 3EDYA 1WPQA 3WLOA 4XJVA 4IZIA 1LX6A 3ASVA 1RQNA 3E9YA 3RHSA 3GAZA 3YASA 3SI7A 4GC9A 1PJQA 1IE3A 3GMDA 3ZJTA 2XDQB 1T8RA 4FMDF 1VB5A 1OVGA 3TAHA 4MQBA 1TIBA 1FJ2A 4G8JA 1BS1A 5AKYA 4YGYA 1F2TA 1L7RA 4S1NA 4YYZA 4KLNA 4LTNA 5E0KB 1OXTA 4MP8A 3W7VA 3I9FA 5BNTA 3ABOB 3KQYA 4DJ5X 1NOKA 1TYEB 2VP2A 3UB2A 1M2OA 3EGOA 3UIEA 2WIDA 5FTJA 1KZGB 1OWLA 3UJ7A 1G41A 1S9DA 2M98A 5ECYA 1QE0A 3EOAI 2R00A 3W34A 5JAHA 4L02A 5CVEA 2Q9UA 4QOIA 1OXSC 4C2AA 2I66A 3OIYA 3VNVA 4YXWD 4JBLA 4H3VA 1ORWA 3A9WA 3CRZA 4EZBA 3KAJA 3N0WA 5ECGC 5KOIA 4K6HA 5HGJA 3SYNA 1XEXA 4BN5A 3RT9A 5A4AA 4ODIA 1PUJA 1FQJA 3GJ0A 3T1OA 2H1VA 5H8WA 1NW9B 3PYXA 3VR6H 1U8ZA 3KKKA 5AKJA 3UAXA 5FT9A 2F17A 3GLSA 3PHJA 4DLAA 3ZJVA 3L3BA 4MK4A 4BV8A 1JFSA 2NO6A 1J8FA 2NT3A 3BD6A 1EWVA 3FHOA 4NEGA 3TRDA 5AKZA 3RVSA 3IIEA 1T8WA 2FQXA 4ZT4A 2BMVA 2IGBA 5CH5A 3UA3A 5GMOA 4FFBB 3KHSA 4FZJA 1FFHA 1RCTE 1Y7IA 4OD0A 4U0KA 4S1WA 1UFRA 1DC6A 1VMIA 5EJFA 2AG8A 2R48A 5K3BA 2M1XA 1WU7A 3DONA 1II9A 2XAAA 4XYMA 2DFNA 1B8PA 1JE0A 1QHIA 4JNKA 2WG1A 4FC7A 3VV2A 4P2GA 2P68A 4M2LA 3WB0A 2YHUA 5L4SA 4KSBA 3WGNA 4ZCMA 4YUAA 5JXHA 4MDYA 3IP5A 1FY2A 1DV1A 1U0EA 3B12A 3TI9A 3RSOA 2C7GA 4RKFA 3UJBA 4D4KA 1H9AA 3L1VA 3NS7A 3E3MA 5GZ1A 4G1BA 2C4TA 3OX1A 5KQPA 5SZKB 2DETA 1GQYA 1H85A 1U63A 1MC4A 3L7BA 4Z4IA 5DMXA 1I4WA 4IZHA 4IKPA 4YJ3F 2L19A 3UHAA 3W8NA 1YIDA 3H4VA 1D1QA 3N2IA 2Y77A 3O2NA 4MWGA 2LIVA 2RAFA 3UKJA 2C7QA 4EJMA 4FTWA 3KO8A 3BWMA 1J21A 3R5XA 4NS1A 4BAUA 4BKRA 5A2QA 4NIMA 3U7FB 2EW2A 1IVSA 2IYWA 1G8JA 2BT4A 4O02B 4KPFC 3ZLBA 2FE4A 1I2DA 4XM0A 3P8ZA 1U0LA 5FWXA 3TVYA 5AO9A 2JLWA 4HGRA 4N5MA 4PQEA 1L7NA 5JT1A 3FPEA 4MCHA 2JH3A 2ORVA 5IAEA 3ZCXA 2F48A 3BHNA 3DE6X 2WTEA 2QTVB 4OQZA 3TH5A 2JEZA 3KZNA 2JIRA 4ILEA 4LDJA 4ZZIA 4JLAA 5CITA 4CM6A 3UKDA 2IS1A 4KU4A 2VSOA 4NK5A 4BBZA 4EG6A 4H6PA 5F3DA 4WFJA 4ETMA 2IYZA 4XGIA 1W4LA 2I1LA 2AYYA 3UT5B 5A5FA 4N41A 4QGGA 4UKDA 1NJ5A 2IXBA 4WJKB 1BS9A 1CQJA 1RE0A 1VHDA 4CM1A 3SPXA 4XVCA 2X8JB 1NNLA 3LCUA 1WNTA 4JUFA 4X6UA 1TAQA 1YQQA 1YXMA 3L9WA 3VA7A 1KI6B 2FN3A 4IIGA 3PVCA 4QNRA 1EBFA 5BVHA 4FYVA 3X1YA 3LJKA 4YMTA 4QXOA 3FTDA 5A4KA 4LXGA 1IC6A 4NNJA 4NE7A 4X8OA 5A02A 1DFGA 2GD2A 3TOSA 4KQFA 2Q6KA 3I8SA 4DSUA 1T3GA 3IE1A 4P93A 1WPRA 2FZ5A 2OGTA 4I8XA 1FJHA 2ZRIA 2ZE6A 1Q95A 3GEMA 4UU7A 4EI2A 3NC4A 3V4LA 3LFTA 2QTAA 4LBWA 3JQQA 1M0SA 1T2EA 2YJGA 4Z4HA 2GM4A 4Z7NB 2O8DA 4TV8F 1HF3A 2CN1A 3I2JA 3L41A 3QGMA 4W7SA 4JUCA 4WKNA 1Q1NA 4O4IB 1ADFA 3BMOB 3CW9A 4MUJA 3DA8A 4JYBA 5EA2A 1F48A 3SIRA 1J9ZA 2RBGA 3EB9A 1C41A 3U0VA 4CG3A 2GRUA 2SKCA 2YXLA 5D3MA 2J67A 3ZWMA 4EPYA 2B2CA 3IPAA 3M4YA 3H75A 1L5OA 4M7WA 1R0KA 4Q4JB 3M9LA 2J46A 4QGSA 3TSCA 2YHAA 3VC1A 1RPJA 5HZGA 3VJKA 3I9MA 1AV6A 4F6RA 1W5TA 4COKA 4F7WA 3L8MA 5AVOA 2VP0A 5IYZA 1VKRA 1JP7A 3C8ZA 2XHEA 5DNUA 4LGMA 2AEFA 1PL7A 1XJ0A 3BCUA 4Y2XA 1DTEA 6CHYA 3UXHA 4BVBA 2FR8A 3HG7A 1QSGA 2BEVA 4GOLD 4RWZA 4TL8A 3W5JA 5TC4A 4EO7A 2NXWA 1Y33E 5JXWA 4EMUA 1JU9A 4LQ4A 3QXSA 4ZDIA 5CBPB 4KE8A 4C4PA 1CS4C 1XQVA 3PEFA 2A1TS 5IUJC 3G9XA 5JEEA 1N1GA 1ZWKA 2CHGA 3OCZA 2OV2A 3M0EA 4BBPA 5C4IA 1KAGA 3GLGA 2AK3A 3OPXA 4DAOA 4LI0A 4EZEA 3VC3A 5B3KA 5J5VA 3TPFA 4RORA 2IS2A 2IUSA 1UBRS 4IDGA 4R2KA 1NBMD 4YC7A 4Z4GA 3WLRA 1HFKA 4Q3EA 2IXAA 4HNGA 1MABB 1ZUHA 3SVZA 1CS0A 2G5PA 4ZT7A 4NONA 4R2JA 5KQMA 5GGXA 1Z7BA 5TS3A 4DG9A 4CU5A 1EXDA 1RAEA 3LC2O 1BKDR 2XUAA 3KKNA 2QNIA 3FRJA 3MWDB 1IN5A 1E7RA 2QSJA 3PDCA 2AF3C 1JYEA 3PUZA 3UYKA 3LC1O 3WQSB 2GETA 4Q9LA 2AW3A 3B1JA 2B5VA 3EHEA 1ORIA 1A9SA 1JXMA 2P6MA 4ZZ2A 1TUBB 3L6CA 1DCFA 3V34A 2D62A 2R6DA 1ZOIA 3H8VA 3KSAC 1NHWA 5A7FA 4HRVA 4H0NA 1SZPA 5B53A 4CMHA 2FG6C 4GS5A 1YS9A 4JHXA 4QYWA 1Q3KA 1IEVA 1CYDA 1SPXA 2ZBVA 4KGXA 5EMHA 5DASA 5HIKA 5C52B 2VP5A 1JLHA 1O0SA 3STHA 3MUEA 4A8JC 1CQWA 2DY1A 2M9MA 1KY3A 1TF2A 2I6GA 3IAHA 3GRKA 3LQQA 3Q7IA 4V39A 3REFA 3W6OA 1V2HE 2EEZA 4KO3S 1FFDA 1ULSA 3FI9A 3FIUA 4FMCB 4PLFA 2QD3A 4ZO7A 3H2JA 3V4RA 1DO8A 4MW2A 3DMTA 2D5AA 3FUWA 3OG9A 3VYVA 3KDPA 1II8B 1CZKA 1GCGA 5CLIA 3BIXA 3O8QB 5C34B 5HBRA 1C7EA 1X8JA 3HXLA 3JQ8B 4HXYA 3RT7A 3WLNA 3QBEA 1HDRA 1T5IA 5F2KA 3MQFA 1FNSA 2ID7A 1G0NA 3UM9A 4UHJA 1E1YA 4H7EA 3RVRA 2IEZA 4OAOA 4D99A 4X94A 2WWWA 3BMOA 2BL4A 2VHZA 2PYZA 3DG9A 3QF4A 4HJXA 4HNQA 1YZHA 3UAWA 1V37A 2ZI5A 2NTYC 4MVYA 1TYZA 4UHKA 4B6PA 1ZJJA 3NUQA 4AT1A 2JF0A 3G68A 4W5HA 3FHLA 5CYFA 1J1IA 1QRRA 2GN4A 2FQQA 3QBVA 4RC9A 3RS4A 3WYDA 1Z4NA 4S3MA 5EIEA 1I51A 3DNPA 3KZ1E 5KYWB 1JG2A 1DXYA 2WTBA 1QHFA 2LTAA 3OZ7A 3ZD8A 4ZOCA 1XHFA 2NO4A 4N3BA 3D1LA 4GNRA 3K4PA 4LSMA 2PH5A 3OHMA 5CM9C 1AY0A 4UAGA 4INOA 3BSYA 3D1VA 1J9EA 4KTTE 2I71A 5FF9A 4ENPA 2Z3ZA 3B1YA 1HYEA 2WSIA 5TMBA 1QGAA 1N0WA 3WSVA 1TCCA 4YP6A 5FBVB 3AF2A 1HG1A 1QHGA 4K7JA 1NA5A 1NPDA 4OFWA 3LUGA 4F11A 3RH0A 2C2OA 3E3OA 1H5UA 1M6WA 3N9IA 4G1CA 4XH9B 5SV2A 2NG1A 4CFSA 1Q0TA 3ESXA 2O19A 4R7ZA 3P9ZA 3PNVA 4I14A 2PJUA 3A3NA 4BIIA 2PN1A 2F3TA 1GFZA 1X2BA 2HQBA 2YBDA 5ILOA 4FNMA 4QFMA 1T4GA 5AJHA 3R75A 4YLYA 1BE1A 1Z5GA 5KSWB 1T5DX 1CUCA 3IP9A 1CE8B 2V96A 2VSYA 3OTQA 4OUKX 4F4FA 4BWFB 1CWUA 1V1MA 1ZZGA 2POCA 3R3HA 1JT9A 2OMKA 1W34A 3MTDA 4RXTA 5HK8A 5AW2A 5C5IA 3P9NA 2J1LA 2G5GX 3OFSA 4QOEA 4X66B 3HDGA 1L8LA 5BY2A 3UMYA 3IBSA 4F2PA 3A4MA 2K7ZA 2ERXA 4HLUC 2QZPA 5JPIA 1CY6A 2ZQYA 3PNPA 2PU7A 5A7HA 4EW6A 3F1KA 2B8WA 4JKOA 3HLYA 5HNKA 2FX3A 4GU5A 4DFDA 4Z51A 1UMBA 4OMFG 3ZZNA 5FFMA 4RTPA 2AC7A 3WSTA 2I3BA 1OA1A 2OSVA 2VSFA 2X6TA 2P79A 1KEEB 1ZUNB 2WM2A 4J90A 1Y3HA 4JN6B 4ROSA 4TMYA 5CB4A 1ES9A 4MICA 5TIIA 3ABZA 3QLEA 3ID6C 4IXTA 2BTQA 4B4VA 4R8SA 5JY6A 1GFWA 4W5JA 4UE2A 4F3YA 2C9DA 2PJZA 4PXAA 1MF7A 3AKDA 3U80A 1N2BA 4LQDA 3QFHA 1L5FA 1JI3A 1Q1GA 2XDAA 4TMKA 1A7JA 1DWPA 4ZVPA 1MDFA 1MJGA 1R37A 3FDFA 1S1CA 2QLLA 3R9KA 2R5WA 2VPQA 2ZR7A 1LI7A 5DB4A 4HAZA 1R2QA 4U5QA 3ZLTA 1BFKA 1N3BA 2IHTA 3HZZA 5TPWB 5EIOA 4CM4A 4HVLA 1FW6A 4BNHA 1TT7A 5TXGA 3KP1A 4GKVA 4LQLA 4ETIA 3TIVA 1JVNA 1MOSA 4OQDA 1BHO1 4XQ0A 2X4IA 2FEXA 3AG6A 4KRXA 5BRNA 3SR3A 3QUBA 1Z8FA 1MOPA 4Q16A 1RC1A 1K8QA 3HL0A 3HXPA 4JJ8A 5FNVA 2GZ3A 4ZRMA 3TTWA 3WIBA 2MHCA 3GQBB 1G9SA 1YBFA 1C3EA 1OFVA 1ZSYA 1VHLA 2ENUA 2JLSA 1W1WA 4FYKA 1D6NA 4P4GA 5G40A 3UTDA 4BP1A 2I2FA 3ZY6A 2Q6OA 4J43A 5EEHA 3L6RA 4TTAA 4HXEB 1MZVA 1UXOA 3CR7A 5FPKA 1AMNA 2CV1A 3PUJA 1IHXA 2W8BB 3MJTA 1KQNA 2I6SA 4QGBA 1WCWA 4TVSA 1J8MF 1AS0A 3L0SA 2QAIA 1E8NA 3AR3A 1ZHOA 1GUDA 4LZJA 4PU0A 4DA9A 4PG8A 3THXB 2W71A 2D1RA 2OXIA 2PA3A 1AZTA 3KJFA 5EGSA 1P1HA 1V6SA 1HG0A 2QR5A 4HXFB 2NAFA 2QX8A 4EJSA 4HNTA 3C6KA 5F7OA 4IGIA 4J49A 1T5LA 2KE5A 3R6LA 4D8XA 3IAFA 2EU8A 1DQPA 2AN4A 1MN6A 4IH9A 4Z54A 1PNQA 3OP1A 4HVTA 5HZKA 2YFHA 1VCHA 1RWNA 2A9QA 1N4DA 2RDMA 1KO5A 2WU0A 3FR7A 3LUJA 4RE6A 4P0QB 4P35A 2JLVA 2RCNA 3FFAA 5HILA 3O84A 3MS2A 1PRYA 1QO9A 1SCBA 4X63A 1Y7HA 3G7UA 1A8PA 4OUDA 4YJGA 1NZFA 2YZGA 4CBVA 2YWRA 1GTSA 4JP1A 4HZGA 4N54A 3RSHA 1DEHA 2QW1A 2P4UA 2W48A 5BMVF 5C8DA 3N2KA 1ZHFA 3T5MA 1U2QA 1E5DA 3FN4A 3ZYZA 3JQPA 1EJ2A 3MSXA 4LRXA 3MWDA 1QRAA 3OBBA 5CGZA 5L53A 1XD9A 1U8CB 1CJTC 1JILA 1I2CA 1II0A 1O8CA 3EIXA 3PJFA 3ZNQA 4J16C 2I4RA 1ZP6A 3IQIX 4W6QA 3PQ7A 4AURA 4EY4A 4RTKA 3THWB 4LF7B 1ZIOA 4ZO8A 1B8UA 3VGPA 3HC7A 1WMSA 4YCNA 1I1HA 2PSHA 3INGA 3BHIA 3GFSA 1ZNWA 2C3OA 3QVWA 5IVIA 4AJJA 4CG2A 5C7YA 3QUAA 3AJRA 3V42A 2OZEA 2Q5HA 2WWHA 4H1WA 3ZCQA 3HLTA 2FZCA 3HFRA 3HUUA 1PD1A 3M1LA 4EGAA 4DM4A 3GJ3A 3NWOA 3HLKA 1QR2A 3PA8A 3ETCA 4JITA 2EZTA 2E0IA 1U7PA 2IDKA 2PGAA 4WNAB 4AZ0B 4WXMA 1X7XB 3QTLA 3UWDA 3M4ZA 1NRWA 5F9HA 1NBOA 1BXKA 2PLAA 3RTDA 1C4KA 3ZUPA 3F5MA 2FLWA 4XPIB 4CQJA 3EIOA 2BI7A 3S99A 1G59A 1PNOA 2YW9A 2WILA 3KJXA 3WK5A 2YY5A 2ATIA 3JQ7A 3BT7A 2CJPA 2RKWA 1EUYA 2R6HA 2VPWA 5FEUA 2ETXA 2PRKA 2X6QA 4PVCA 4CEHA 3S8MA 3H1AA 2JIOA 1E59A 3KYCA 1MB2A 4XEHA 4XR4A 5EP2A 2GJKA 3H2IA 1WTCA 3Q72A 2XUGA 5FOXA 4B4WA 4C89A 1J0EA 2J9GA 2ZIVB 3HA2A 4NI5A 1K9VF 2ZSEA 4F86A 1Y8AA 5AXDA 1K0UA 3K70B 2YZMA 1BN6A 1Z0AA 2PANA 1WWKA 1EVQA 4IJVA 4NJMB 2XJ9A 4TKUB 2GERA 1F38A 1RWKA 4X90A 1EP2B 4DY6A 5EHIA 5JRZA 4TLMB 5GV8A 3AVTA 1PFWA 1VG0B 4HMPA 3O1HB 4KI7A 2A3RA 1CVIA 1JTEA 3VH4A 4II2A 2WWFA 2DUMA 3SIWA 1L5YA 4HB2A 4YEDA 1GZUA 3B8EA 6Q21A 1UK6A 2WU3A 5DM1A 1RHMA 4RSHA 4XJSA 3ZX5A 5BV8A 4KIJA 1NVFA 2D1SA 1EYZA 1ZU5A 3LMKA 5ALRA 4E5YA 4X00A 5TMDA 4F38A 4JC0A 2YYZA 5ESDA 5FAXA 4IHJF 5LUAA 4X64B 1M1UA 4UM9D 3QWAA 1UBMS 4NJEB 2F8TA 3LYHA 4PO3X 1TEXA 1R8JA 1M5RA 2DBZA 2HA2A 3C4QA 2C5FA 2J31A 1DP4A 3T5CA 4KO1S 3N6XA 4EJ6A 2O7NA 1JEYA 4GM4A 2W5UA 4Q82A 5I01A 1Q5PA 1MA3A 3BRCA 1VBNA 5JHGB 3PC6A 4W99A 2A67A 2FETA 1NBMA 1WMAA 4R1QA 4UPVA 5LQSA 1X87A 5F3WB 2GHTA 1VPEA 2X14A 2DH6A 2YNMD 4FK8A 5HZMA 3B9PA 5GJWC 1Z4PX 1MBZA 2E85A 1IWPB 3FGPA 4PFQA 4Q34A 3TBHA 1BVRA 3RW9A 4ZYUA 4DB2A 1JPUA 3G9TA 3W5IA 4DPLA 1KAEA 2L0XA 3GBSA 1A97A 4EFDA 3GEBA 3IUNA 1T6YA 3GP5A 3V4FA 3NAMA 4GYJA 3UYLA 3EVDA 1R6XA 3R3JA 4V03A 3A58B 5HM8A 4GX1A 4IIUA 4Q1DA 1FSZA 1TU3A 4IINA 3OTHA 2Q0HA 3QE4A 4M37A 3ZWDA 4BUZA 2D00A 5AKGA 4M0KA 3O4RA 1IVNA 4TKMA 1MABA 2E4YA 4TQGA 4US2R 2B6NA 2JGRA 3J7AC 2BTQB 3NPMA 4WA7A 5DOVA 5TT0A 4TRJA 5JS7A 2NT4A 4LXXA 3SYRA 3DBRB 1YZFA 3B1KA 4KFTA 1Y9DA 1Y98A 5A62A 4B3BA 4P32A 1UXIA 4FNAA 4NQZA 4Z9XA 1EUZA 1O9BA 1PJSA 2P3OA 1ODFA 1OBOA 3QVGB 5T5QA 3S0JA 3UK6A 5A3JA 2J5BA 3MHPA 4P0PB 5HMMA 2VJBA 3MWKA 3OZEA 4LC9A 4CGZA 1Z5VA 3KM0A 1IG0A 2JIQA 4X8HA 4Z8YA 1XZHA 4C4AA 1QS0A 1M67A 2J87A 3H19A 2EKLA 3ISVA 1OU0A 5B1IA 3WGZA 1U4NA 3AMVA 1U2PA 4IGAA 1XSEA 2O3RA 2ZYWX 3O9ZA 2I8CA 4NH4A 1H2BA 4XWTA 1A76A 1BHSA 3AUTA 3TLCA 3L82B 3BFKA 3N5KA 4R68A 4KITB 2Q6IA 4Y2PA 5FWAA 1M7HA 2QQFA 1YCHA 4QATA 3MJEA 1CQXA 5C8ZA 1ZYUA 2QTFA 1A04A 1NF3A 1PGJA 2LDXA 5JD4A 3N8GA 3CH6A 3EVGA 3TE7A 3USCS 3BFPA 3FKJA 4X3OA 1ZGHA 3K6SA 2IYOA 1EJ0A 2R1TA 1I0IA 2HH9A 1HMYA 4L07A 3U7QB 1EVIA 6REQA 1Z25A 1J70A 2J0VA 5B7QA 2C31A 1RZRA 2K2QB 1XTSA 3QF4B 1HI9A 4TLDA 3R2JA 4TL9A 4MA5A 3GPLA 1LWOA 4PZEA 4FMPA 2KX7A 1OH5A 3OIDA 3B82A 3B38A 1YAJA 3BGWA 5DGTA 3RUIA 4BEJA 5IM4F 3MTQA 1PGQA 2I4TA 4C4SA 3SC2A 1LPSA 2HCBA 3HJNA 4E2WA 3GYGA 3DMYA 3URKA 4BB6A 4Q37A 2J3IA 1QH8A 4PG6A 3EN0A 5CB4B 3KPWA 3SZLA 5EHXA 3BMQB 5LM3A 5TJHA 4CMBA 1XWIA 5DM70 4EG4A 4GZ6A 1U90A 5JV5A 2YNMA 4BNYA 4DNXA 3RTEA 3MOSA 4PCVA 1FX0B 3IRUA 1IRIA 5ALUA 1BYUA 1AJEA 1RADA 3RK0A 5CLFA 3TFWA 4OJKA 1Y5MA 3ILYA 4G26A 3EZ2A 4DMGA 4PGAA 4ZIRB 5DX0A 4QVIA 2OLJA 4XLLA 2HDOA 3DAYA 2EFDB 1N78A 3WRYA 4C14A 2Q07A 1DARA 2NXCA 2OT3B 4KLRA 4OQMA 4U8HA 5AVVA 3AETB 1WR8A 4PM4A 3N2ZB 4YJFB 2YIJA 2HO5A 1SXJE 4ZAWA 4BNMA 2IDJA 2V5VA 2DPXA 2B78A 2W6QA 2D3WA 3DTVA 2X5JO 1YT5A 4RWEA 3EPJA 1FP1D 1O03A 2BW0A 3JTMA 1KSHA 5DLPA 4TS9A 4C2BA 4OB6A 2QSYA 3HGMA 1FLNA 4H7IA 3DDWA 4KVFA 4RENA 5BSRA 3SM9A 3U1TA 4LTMA 1GTVA 2FVXA 1ENOA 4JP8A 4QBKA 5TMEA 5JNTA 5D5PA 3TMAA 1Q11A 1QGED 3ONWA 5BURA 1DIGA 5KQRA 2HIGA 2QF7A 2P91A 1WCXA 2QP3A 5DNWA 3ZZ1A 3ES9A 2Z83A 4PSKA 1W0JA 2FZGA 2YHSA 1JAZA 2B8EA 3QVGA 1EX1A 1RRPA 4TXHA 4ND2A 4MUEA 2PZJA 2XMZA 4H1UA 2XMPA 3VO9A 3UMVA 2QJWA 5KKCA 2IZ1A 4JX9A 4N9WA 1E89A 4ZARA 2QLNA 3G0HA 3U6KA 4UUPA 2C4MA 2FZEA 4G89A 1W5SA 2JLQA 2I2AA 2ZK7A 4HWSA 1C14A 4PSUA 4YREA 4EVQA 1X7YA 4G5RA 5C80A 5L3VA 3MWEB 1ZUD1 1O97D 3ANTA 5FTMA 5HDQA 4DUYB 1N0VC 3ZDZB 4DYHA 5IEBA 4E46A 4ARCA 1GZ4A 1MCZA 3IKVA 2C9ZA 1KI6A 4DPKA 1Y0BA 3L43A 1ZKDA 2QRVA 2OV1A 1C1DA 1K75A 5C7LO 2PGJA 4UXJA 3RPEA 1WW3A 4H9GA 1XJCA 4RIIA 2CF6A 3BL6A 1HZZC 1U2GC 2B8NA 2GJSA 2QN3A 3ZE0B 4AJEA 5JD6A 4PPYA 1M9NA 2BM9A 1ETUA 2ZSHA 3CA8A 4D42A 4Z4QA 4WK4B 4NOJA 1FLAA 5AK0A 2QVYX 4M1WA 4UBIA 4LSWA 3V1LA 3NFYA 5LXTF 3ZOZA 2B9VA 4MZXA 4EAQA 1EFCA 1G55A 1MG5A 1T8SA 3KL2A 1SCAA 2VCYA 2YW2A 3HFGA 5JIBA 5IAGA 4DJAA 1RAFA 1PEAA 4RCYA 1I01A 3O91A 4RGVA 4GGPA 5C3UA 1BDMA 3ZIDA 1KZ1A 1V3VA 1YO6A 1CYEA 2QJOA 4QT0A 2HBRA 2XXBA 3GAMA 3R4VA 1MEOA 1KEWA 3MCAA 2AWNA 4KIGA 4L95C 2ZROA 3U7JA 3WLHA 2IYPA 1XN1A 4YJ3A 4BJHB 3WGVA 5EE9A 4A9AA 1T5OA 3X0DA 1JDSA 2AG5A 4CL3A 1OFUX 1A2QA 1YULA 2BFWA 5GZ6A 4AN1A 5LYJF 5LIRA 1D2CA 1DRJA 1ZVQA 2CXQA 3IKTA 2C0QA 1R18A 2FW1A 3KTAB 4KR0A 1FSPA 4M6WB 4WLNA 4F4IA 4MWBA 3G1TA 3JPYA 4N76A 2VT6A 4WCFC 4DPMA 4Z1OA 4DJTA 3PVZA 4MO2A 4UBNA 4CYMA 2CXNA 2ZI6A 3CTMA 3ENWA 4HDKA 1P17A 2VF4X 3FNGA 4GPAA 4RIHA 5TVGA 4BX8A 5AJWA 2HEIA 5EMJA 2VNSA 2HFJA 4HN2A 5I4IA 1YMUA 3K70C 3T0GA 2M6SA 3PUWA 4PFKA 4GECA 1VIDA 2JD1A 3EXFB 1KSJA 4LYHA 4O1MA 2GH1A 1L4FA 1LJLA 4Y2HA 3OIVA 1WHTB 1K4KA 2ZQ5A 2BGUA 4IS3A 3CPHA 1QF9A 2ZIFA 3VDQA 5CHYA 4UVGA 1GA6A 1ZD8A 2J30A 3ZG6A 2A9VA 3VHLB 3PF8A 4KN5A 2XTAA 2XCLA 2YXEA 3BEDA 2MU1A 3SFZA 3HN2A 3CVWA 5BSGA 4QKQA 1GLVA 2FR0A 3UV6A 3R8FA 3L8CA 2HF2A 5K8LA 5JDIA 3GRAA 3HR7A 1RCUA 3FDZA 3EEBA 2NTNA 4KV9A 4N8DA 1UFVA 1J2EA 1YB5A 3IA7A 4OB7A 1BROA 2VUTA 3TGWA 1MXFA 3SKXA 1SULA 2FK7A 2HSDA 3P4YA 2HDNB 2H7CA 4P3NA 1XMJA 5DLYA 5HX7A 4MRMA 4DVJA 1A9YA 4O1HA 3NRCA 4LF6B 2V6IA 1IPEA 3IPRA 4OIFA 1IN8A 2F1IA 2ZM5A 3WGOA 1ZUWA 2F8MA 1MRZA 4K9RA 4QJ3A 3QPVA 2O8EB 3QMVA 2P2GA 4HAUA 4BAZA 4D96A 5L9AA 4LRQA 1ESCA 2IZ7A 3RAPR 3S55A 4YAUA 3TG8A 2I4LA 2PSJA 4QQ8A 1DC7A 3ULKA 1UBEA 4ID3A 2XH8A 4QULA 4PX2A 4H15A 1GGJA 4KWCA 4OX9B 3QOYA 3IDFA 1B23P 3OUZA 1ZM2A 2FW7A 2WFZA 1EGMB 1ZDMA 1M1YE 3ADPA 3AEQB 3U7QA 1I9GA 1H2HA 3ETEA 4XASA 4HNVA 3KB8A 3B3FA 4V0QA 5IYZF 3TSYA 1I6KA 2Y1CA 3KR0A 1QQ5A 1PLJA 2BGJA 2MMCA 3R6GA 2V9PA 3KUCA 1O4VA 2Q4OA 2X40A 4NCXA 2H1HA 4ZP1A 1T3LA 2P1ZA 4DCVA 3ADBA 2M32A 1DS6A 2E21A 1HDZA 3W9SA 4KQ1A 4I9UA 3F6CA 4E1VA 2EJWA 1WE2A 3CHYA 1GNQA 3DXYA 1RQ2A 1G60A 4RVSA 1KS2A 4DW8A 3WHPA 4PQFA 10MHA 1X8KA 1GUYA 3F96A 5EIXA 3IXMA 4GE0A 2PZ8A 4AMZA 4KH0A 4NYJQ 1QZTA 1ZK1A 3WB1A 3A6KA 2EQBA 3HI6A 2HI0A 1O5IA 1X7HA 3PIDA 4JVNA 4JT9A 4LECA 1FXSA 3JALB 1YA6A 2F1RA 4R0VA 3AFHA 3PLNA 2VDNB 3B6JA 1VFPA 3I5AA 1HO3A 1W19A 4B40A 1CUWA 1Q1EA 1UQUA 3B5IA 2BZSA 3KAPA 4DDKA 2D6FA 3V9AA 1ZJYA 1OQAA 4A6PA 2X8BA 3GIWA 3KUKA 4KXQA 2BGIA 3OKPA 1GPUA 1BVUA 1L7AA 3ED5A 2QTBA 4QU5A 4B6OA 1RPAA 4BRZA 3ANXA 1C30B 1CERA 2YS7A 4JI6B 3VI4B 3HKDA 5BW4A 5B4TA 3PR3A 2W6PA 3LUAA 4K8OA 1MOQA 1Q7BA 4N3CA 1GSIA 1HOXA 3U9SA 4FI3F 4BQFA 4L57A 4LMAA 2APJA 2JGLA 5FLYA 3SYTA 2CL5A 2RK3A 4LVCA 4Y7DA 5AVSA 5EJ7A 4UCWA 1NXWA 2H08A 1PJBA 3KQQA 4UE6A 4PPNA 5SYAA 1VE1A 2ZU6A 5EP3A 3SSAA 5A4JA 2V4UA 1E1MA 2CCGA 2XOEA 5CFMA 5DXJA 3PLAE 2PRYA 1QIDA 2I34A 4I55B 3RKRA 1JQJC 5HBGA 3U26A 3KQUA 3OZBA 5IP5A 1J09A 4E2ZA 2VP9A 3KB6A 1SC1A 4Z9AA 3FE2A 3REGA 4DG5A 1WDTA 4RBNA 4B76A 4ZDJA 2P7IA 4KGZA 3AETA 3B6EA 3CO5A 3LOQA 4YJFA 4C4RA 1OFGA 2BE7A 2P6UA 3PD7A 3G2MA 4K9NA 2GUGA 1U3VA 5TS2A 3KWMA 1K3FA 1Y8RA 1QHSA 1T1GA 3EVBA 1RAGA 3DEJA 4ZJUA 8GPBA 4G5OA 2I7TA 4A2WA 4UARA 4RNDB 4TTQA 1MU0A 3FWHA 4D8TA 4NU6A 3O3NB 4URHA 2G0NA 3C3KA 3ILVA 4R84A 3W1WA 5ABPA 2IBTA 3OQPA 3JR3A 1YRWA 5CP8A 3Q0EA 5EXSA 4KR7A 5A0TA 2QP9X 3HWSA 3RBVA 4EHDA 1W87A 4B83A 2E4XA 1W4RA 1V16B 4R1SA 3NBMA 4AY3A 5JJ5A 4KLAA 4YRRA 3U9TA 2I99A 3G2PA 2C9YA 4MKHA 3V80A 4HLQB 1SEVA 1EK0A 3IHWA 5FPQA 5AK6A 1ITZA 3AHGA 3TTTA 4IDFA 5JS1A 1KQFA 1MJGM 4XEUA 1ID1A 5HUQA 1EESA 3KVOA 3JZAA 2PPVA 4M88A 5JI3E 1V9LA 5LQJA 3RCBA 5EHQA 1NR1A 3WYGA 3GLFE 2JFXA 1KHHA 1QPGA 2CV2A 3OT1B 3UJNA 1BE8A 4I6GA 7MHTA 2HJVA 1XCMA 3UOWA 3ZD9A 3RRMA 2OLEA 2XWPA 4F4UA 2C1EA 4POAA 2D1QA 4LDQA 4LDNA 1CNMA 3ENKA 3GJ7A 4B84A 5K0EA 2HDWA 3A14A 3LY9A 4YMLA 2CVQA 4FIZA 5ENVA 2JRCA 1CR2A 1MAUA 4DBLE 3ODPA 4IUDS 4FFDA 4CV3A 5E4TA 3IP6A 5AJVB 4UVIA 4Q3OA 5TGTA 3VZQA 4DC1A 2OEPA 4HH4A 4KODA 4FZ3A 1SR8A 4QD3A 4JLWA 2QJFA 4MP3A 4XM2A 1RHJA 2C1ZA 4EVIA 3KSUA 3BH7A 5DHFA 4ALJA 2YVUA 4H3SA 1CQIB 1JZTA 5ECWA 5FXMA 1CFJA 4L5JA 4WXRA 1ODSA 6LDHA 3D6JA 3FOAA 4ZAGA 4WNCA 2X0IA 1CDZA 3RVKA 3V97A 3OTWA 4CR8A 4Z3KA 4IVNA 5DM4A 5IM4A 4CV2A 4FQ7A 2I3GA 4WL0A 2MDTA 4WZBE 2EHDA 1KEZA 3KJQA 2RHGB 4M0CA 4OL9A 1PZXA 1YZYA 4OK6A 4S2EA 5AW7A 1V25A 5H83A 5K6AA 4US1R 5LKRA 1VE9A 2JFFA 3DFMA 3QH4A 5ALYA 4Q3BA 5CEFA 1PT8A 1T3HA 3I8XA 1Z75A 4N5DA 4NZPA 2VHJA 3WADA 5ED0A 1G63A 3RYHB 2VNIA 3ZV6A 4KR3A 2OQIA 4PO9A 3KQNA 4FW8A 1JPVA 1QRSA 4PZLA 5EE1A 1H9CA 1Z6GA 4MPRA 4B7CA 3AZQA 4D81A 3OCXA 2FPGB 5JAIA 1VL0A 1V8DA 4YRPA 3EMKA 3I0NA 3PWTA 5D6OA 2WD7B 1CK4A 4U7HA 2QX6A 3M4JA 2CDBA 3OC0A 1N2CE 3MAAC 4NNPA 3TAXA 4GMXA 4HB3A 5BR7A 2YWCA 3LGSA 4LNAA 4JYPA 1YRAA 4N9QA 3GZ4A 3V2GA 2PGDA 1NX6A 5CCBA 1JR4A 2ORYA 1MIOB 1FNNA 1EDOA 1U1IA 4IV5A 3SY8A 3TW8A 1Q77A 4MQFB 2J9RA 2HMWA 4DM7A 3W5UA 3ESDA 2YIVX 5AYVA 1H66A 3ETNA 2NZ8A 4MMYB 5DNEA 1CJMA 5FUQA 3WWYA 3ZY2A 1IH8A 2PR2A 2J6IA 3F98A 1IEXA 3EQ9A 3H11A 4G5HA 4RD2A 1L3BA 3QEJA 3D8HA 3MPUA 3QVXA 4X60A 4YMUA 4NY1A 3DUFA 1NQ5A 4L9AA 4TTIA 2QN1A 2EWVA 5FQNA 3FIJA 4Q4AA 1PZFA 5BN3B 4NFSA 2WF6A 1R6VA