1FDOA

Oxidized form of formate dehydrogenase h from e. coli
Total Genus 265
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
265
sequence length
715
structure length
715
Chain Sequence
MKKVVTVCPYCASGCKINLVVDNGKIVRAEAAQGKTNQGTLCLKGYYGWDFINDTQILTPRLKTPMIRRQRGGKLEPVSWDEALNYVAERLSAIKEKYGPDAIQTTGSSRGTGNETNYVMQKFARAVIGTNNVDCCARVUHGPSVAGLHQSVGNGAMSNAINEIDNTDLVFVFGYNPADSHPIVANHVINAKRNGAKIIVCDPRKIETARIADMHIALKNGSNIALLNAMGHVIIEENLYDKAFVASRTEGFEEYRKIVEGYTPESVEDITGVSASEIRQAARMYAQAKSAAILWGMGVTQFYQGVETVRSLTSLAMLTGNLGKPHAGVNPVRGQNNVQGACDMGALPDTYPGYQYVKDPANREKFAKAWGVESLPAHTGYRISELPHRAAHGEVRAAYIMGEDPLQTDAELSAVRKAFEDLELVIVQDIFMTKTASAADVILPSTSWGEHEGVFTAADRGFQRFFKAVEPKWDLKTDWQIISEIATRMGYPMHYNNTQEIWDELRHLCPDFYGATYEKMGELGFIQWPCRDTSDADQGTSYLFKEKFDTPNGLAQFFTCDWVAPIDKLTDEYPMVLSTVREVGHYSCRSMTGNCAALAALADEPGYAQINTEDAKRLGIEDEALVWVHSRKGKIITRAQVSDRPNKGAIYMTYQWWIGACNELVTENLSPITKTPEYKYCAVRVEPIADQRAAEQYVIDEYNKLKTRLREAALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORMATE DEHYDROGENASE H
publication title Crystal structure of formate dehydrogenase H: catalysis involving Mo, molybdopterin, selenocysteine, and an Fe4S4 cluster.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 265
structure length 715
sequence length 715
ec nomenclature ec 1.17.1.9: Formate dehydrogenase.
pdb deposition date 1997-01-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00384 Molybdopterin Molybdopterin oxidoreductase
A PF01568 Molydop_binding Molydopterin dinucleotide binding domain
A PF04879 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.460 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1fdoA05
2.20.25.90 Mainly Beta Single Sheet N-terminal domain of TfIIb ADC-like domains 1fdoA01
2.40.40.20 Mainly Beta Beta Barrel Barwin-like endoglucanases Barwin-like endoglucanases 1fdoA04
3.40.50.740 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1fdoA02
3.40.228.10 Alpha Beta 3-Layer(aba) Sandwich Dimethylsulfoxide Reductase; domain 2 Dimethylsulfoxide Reductase, domain 2 1fdoA03
2V3VA 2JIPA 1S3SA 1E32A 1E5VA 2E2HA 3O5AA 2Y0SA 2VPXA 5DYIA 2JIRA 2JIOA 3GTJA 1I50A 3QC8A 4C2MA 5FTNA 3HU1A 1R27A 3OUGA 1KQGA 2VPWA 1Y4ZA 2JIMA 1TWCA 4GA6A 5FTKA 2R7ZA 5T5ID 4AONB 3TIWA 1AW8B 1PT0A 1R7RA 1SIWA 2NVYA 4KDIA 1TMOA 4KODA 1WLFA 1UHEA 1TWHA 4KLNA 3QQ8A 5FTMA 3QQ7A 1CZ5A 1R9TA 2VPZA 1E61A 2C45A 5GLFA 3TM7B 5FTJA 4D7ZB 5FTLA 3GTLA 3GTOA 3H25A 1PPYA 1E60A 2JA7A 5EPPA 5C18A 2V45A 3GTMA 3IR6A 1VC3B 4CRYG 2R93A 1QCSA 1IW7D 1FDOA 1PYQA 3ML1A 2JA6A 4CS0A 4AZDA 4CRZA 1KQFA 1PQFA 1OGYA 4RV0A 1CZ4A 1I3QA 2PMZA 4AYBA 1PYUB 2WAQA 3CQZA 1AA6A 1PQEA 4GA5A 4DMRA 1YLEA 3GTKA 2IVFA 1Y5IA 4KDLA 1DMRA 2NAPA 3EWKA 3IR7A 1ZMEC 1DMSA 4AOKB 2E7ZA 2JIQA 4AAYA 3O6QA 3CF2A 3GTGA 2JA5A 1CR5A 2VUMA 2KI8A 2VPYA 1FDIA 3HU3A 1PT1A 5B6CA 2G8YA 2NVXA 2B63A 2P10A 1K83A 3DMRA 2E2IA 1G8JA 2R92A 2DMRA 2NYAA 1WMKA 3PLXB 1TWGA 1SFOA 1Q16A 1AJYA 1H0HA 5DYGA 2PJHB 1Y1WA 2EEOB 1G8KA 1TWAA 4QIWA 1UHDA 3GTPA 1OMIA 5C1BA 3QWZA 2IV2X 1H5NA 3HU2A 1EU1A 2YU9A 1Y1VA 1TWFA 1QDNA 3FKIA 3GTQA 2WB1A 3HKZA 3IN6A 3IR5A 1E18A 1PQHA 1WCMA 4KO8A 5T5MD 3H0GA
chains in the Genus database with same CATH superfamily
1JNYA 1P9LA 1U8EA 1CZOA 1I4OA 2R6FA 4IMRA 4M87A 4Z9BA 1J6UA 3UQZA 3MWEA 5TEWA 3W6NA 2XNCA 3OQPA 3GK3A 4P3PA 5HIAA 1K2VN 1NJSA 2XV1A 1KFKB 2PLWA 1DFGA 3NV9A 4YRDA 4N6JA 2BH9A 1V35A 2O3QA 2OCDA 1B3BA 5AYVA 3NNSA 1A8HA 1T6XA 2ON6A 3AUUA 4DM4A 5DJUB 1LTTC 2VLIA 3EVFA 3LUJA 2OXIA 1XRNA 1TWCA 2A86A 3LDFA 3B6JA 3V4SA 1BXKA 3JYPA 1Y7PA 3R77A 4BV2A 2YJNA 2QUJA 1BGYJ 1O0SA 2VYFA 1WZ2A 2PFKA 4UE3S 1BU5A 3VR2D 4BBPA 1VQ41 1F51E 3VMMA 3BORA 1I51A 2VBCA 2L19A 2ZJ1A 3ZOZA 4BLTA 2Q41A 2XUIA 2BBTA 3K5BA 1VQLP 1UHEA 3R5KA 4IL5A 4XSHA 3VDRA 2XBMA 1L2TA 3E58A 3CCRZ 4YAKA 1VE3A 5AW8B 4D9MA 3URMA 4NPCA 2GBPA 1O87A 2E37A 1G5PA 2I5PO 4U7HA 4ZCIA 2B8NA 2ZU0C 4FFOA 2CBXA 1VJCA 2IP2A 3E84A 2RGDA 2B1GA 3WAKA 2I7CA 4IS2A 1FBNA 5JI3E 5IJ0B 1BN6A 1E2IA 3U7RA 5JH7F 3L7CA 4HGQA 4OMFG 3MRXA 4FN4A 5JRZA 2EFDB 3MUNA 3B2EA 3TN7A 4BJ6A 5DCYA 2GEDA 1O9HA 3N7AA 1JHMA 3AUAA 3KWFA 2OM2A 2B94A 4F2DA 3HA5A 4XSGA 2VUSA 1PR5A 3CWBJ 1C0PA 5AKZA 4DR6B 3CUTA 3D7MA 4ZK6A 1W30A 4LC0A 1VLJA 5AK5A 4LHWA 3L4BC 4KE9A 1E7RA 1P7WA 4JLBA 2VS1A 1H42A 1KD1Q 3ICPA 2JIQA 1W36B 1JHOA 1YR8A 2XMGA 2Z30A 3MGCA 3QU5A 1HQCA 2HODB 1KK3A 1WRBA 2N46A 3KHTA 1DZ3A 4IWXA 4LY3A 3CW2A 2JA5A 3QG1A 4S1TA 3QUAA 4TS3A 2GJ8A 1PJLA 4GVPA 3LPNA 2J0EA 5LMUB 1EP1B 1W85A 2FPWA 3AJRA 2HU5A 3E0XA 1ADJA 3PTAA 1AVTA 4D6XA 5BOSB 2XVYA 1XCJA 4UU0A 3D7NA 1FSZA 1KRHA 1U3VA 3JWJA 2DY0A 3OPYB 2OOXB 1YA6A 4XGIA 1UBKS 4URWR 5HQ3B 1K6MA 3TE7A 3OKCA 3L72J 3WYNA 3A3PA 3AFMA 3AFNA 3VVBA 4X66B 4AJHA 1Z83A 4G65A 3C7TA 3TQSA 3LDHA 1TAHA 2P3LA 3ICCA 3JQ7B 3JQAD 4PQYA 4REOA 3H4IA 3X1WA 2NU6B 5FYDA 3SOZA 3SX4A 4QKQA 1G59A 2RK3A 2RI6A 3G3EA 2BBWA 3C3BA 4NS4A 3UCFA 3VTKA 1CQJA 2V7EA 4ZOLF 1HETA 2RGBA 4CCAA 4JGBA 3CCQZ 3PNVA 4LXGA 2DQSA 3UIEA 4EH1A 2GXUA 2Q3LA 1RWPA 5JU6A 2XUOA 3UG6A 1F7UA 2H5IA 1T2DA 4UNQA 3CCJP 3BRQA 5DXAA 3SSUA 3I62A 4B35A 3K5HA 1H2EA 4UEKA 3EVDA 4U6QA 5C9ZA 2TMKA 4KQJA 3LY7A 3TYYA 2VK1A 5FR1A 4W1RA 2Y66A 1RCTE 2Q62A 3ZW7A 1PQHA 1JX6A 1DAPA 2XUAA 2ZRHA 4E5VA 2Q7DA 3AE5C 2ZTSA 4BBAA 1PNOA 1K9MQ 3CRW1 3HJTA 3SX0A 1GG9A 4OKNA 3TM4A 3E7WA 1T34A 3CC4P 3N3BC 2FG6C 1G5TA 1YA8A 2QQGA 5JS6A 4YJFB 4UMDA 4ND8A 2E4XA 4OP1A 4X95A 3DZKA 5C2JB 1EFVA 2B83A 3CMAZ 4U2CA 4NOLA 4YJ3A 4YAWA 5D3ZA 4D25A 5ALVA 1DQNA 3GTMS 2NZWA 3OTOB 3LXRA 3KD2A 3RE1A 2WHQA 3FOFC 3I45A 2FP4A 1E77A 3CCJ1 2XWQA 3AY7A 5A02A 2W2MA 3MIIA 1VJRA 3KQWA 1E3DA 3AL3A 2Z95A 3CX5I 4H0LB 5E6SB 1ADGA 4ALKA 1F6BA 1BW9B 4CMIB 1HTWA 2QD4A 3RAPR 5HOEA 2BEUA 5EIWA 2HL6A 2VA8A 3CZCA 4YJ2B 1DGQA 1H8HD 2XEDA 3ZXXA 4HG2A 4Q3NA 2J5QA 5MFZA 1VQ7Z 1T6ZA 5JJLA 3M3PA 3OHSX 4D8XA 1RYMA 1X39A 3LM8A 2XZPA 3SQDA 3H17A 1ZOPA 4MV1A 4HGZA 1PYDA 1S1CX 1B6TA 1O94C 1G66A 3GTLA 2IODA 2JHGA 4RDIA 2ZSJA 4RW0A 5LMCA 1SOVA 3PO3S 4MW0A 4PFJA 4ZQIA 2JZCA 1EFUA 1QEXA 2WIAA 4ECAA 4EIWA 3IESA 1YS1X 1GLVA 2P4QA 1GZDA 3HOVI 2FCAA 4QOHA 1ZM4A 4RZQA 2RC5A 1GUDA 1GUAA 1UBMS 3RJ9A 4E5DA 1EGHA 2PGLA 3FFTA 3LK6A 2R6MA 3TGWA 5B6PA 1L7RA 1RBZA 2C97A 1JHQA 1VKNA 4LNHA 3RS2A 4R7GA 3ZWCA 5BVGA 3CXHH 3GLFE 2QXTA 1ZMRA 5HUQA 1CZ4A 2ZCUA 4YAGA 2X0DA 4Z3OA 3FYTA 4Q4JA 1D7OA 2VEOA 5FKJA 3IQZA 5BYKA 5L4SA 2QENA 3RFXA 2BRUC 1IY9A 1NX6A 3GRYA 1ZOYC 4AN0A 1A9XA 4YI5A 1VIYA 2DGDA 2IEBA 3VAZA 1TZCA 4BLRA 4LGVA 3PGVA 4TKMA 4JYPA 3WNBA 2A1UA 4I1OA 4WY5A 3CWBG 4MCAA 4G5HA 4UZSA 2MOKA 3H1LJ 2DE6A 3O6QA 4I9UA 4QUGA 5K51A 3ND6A 4LYGA 3E9NA 1BGYD 3GJ5A 3RU2A 4JP2A 4I4CA 1OXKB 2BE9A 5DVZA 4IVNA 2UDPA 1NBHA 3VZPA 2CVOA 4YDQA 1L0LD 4NMXB 4OB6A 4CE6A 2JHCA 3B1VA 5IC6A 2XOEA 3L74J 1MPTA 4YRTA 2AK2A 2XDQB 2WPQA 2NSYA 1RABA 2AXQA 2REBA 4TSRA 4BC0A 1ND5A 4RVFA 2JPDA 2PM8A 3WBJA 1H2FA 1KIFA 2PG3A 2WNHA 4HWSA 1XX6A 5AKKA 1MX3A 2YIMA 1FFWA 1FZBA 3GTMI 3NJ4A 3BL8A 3RWBA 4HDKA 4C14A 4ENQA 1ZJZA 1Q3KA 3HKCA 4HNHA 2PL9A 3IQWA 4L75A 3BQMB 1LDMA 3DOHA 3AEZA 1HI9A 4JBNA 3HUSC 4K8RB 2QTAA 4JQOA 5LUBA 4EPVA 4Z54A 1ZJWA 2FYUD 1T0HB 3JQFC 3GEPA 4Q0MA 3WBBA 2OD7A 3BTOA 3EXAA 1SHLA 3IUBA 3KUUA 5C8YB 4G2NA 4RHCA 1YFKA 3OU7A 3OZAA 3KYQA 4PQFA 2WQZA 4PWYA 1N2EA 4Z8YA 3N2NA 2WB1A 3FMIA 3PPXA 4U2FA 3HACA 1A8QA 2L2QA 3BSFA 2R5WA 3GQBB 2XUJA 3OZGA 4HB3A 4JROA 5EIAA 5IMSA 4W7ZA 5CJPA 5JD3A 4A8JB 5K99A 5KWSA 2PE5A 5A05A 5A5GA 3IMEA 2BKXA 5I4BA 4M9ZA 5DLQC 4YFYA 2HA2A 4IH1A 2XOKD 1KQOA 3WFJA 1EFCA 3ZZ0A 1O0CA 4AECA 1LWOA 1RZRA 1Q6YA 2FH5B 2EGUA 1HLDA 1IAQA 4YJGA 3ZCPA 2ZJSE 3G79A 1T4MA 3KZNA 4R84A 4C2MA 3PXUA 1SD2A 2R8OA 4HP8A 3WJ7A 3WC4A 4TLBA 5J43A 2OYIB 5HFNA 4CBVA 1NJ6A 3FCUB 3X2FA 4AY2A 1EPUA 4FYYA 4TTIA 2R3CA 1IFPA 2E76C 1Z13A 1CE8A 2XD4A 1DJQA 1HEIA 1KI8A 4IVPA 2R48A 4AMGA 3TUIC 1JIXA 2H52A 5DYTA 4FTWA 5EHIA 1JTHA 4C6SA 5A7GA 2O05A 2OC4A 5AO9A 1DQPA 1QHYA 3H11B 1GJRA 1PW7A 3SU8A 4BUCA 4OXYA 2X8JA 5AW5A 2C31A 2DPYA 5LYJB 4G9EA 8AT1A 1VFNA 1OIXA 4ZZ3A 3GG2A 4JSTA 2AXTH 5H1YA 5C34B 2G5TA 2HUNA 4BNLA 4C1BA 3ANNA 1QDEA 3CB4A 1LD3A 4RHUA 3K9HA 2PWBA 4YJDA 3GT7A 4AJ9A 4YC7A 2DEUA 1RJFA 1TLFA 5HS6A 2J0UB 5HJ2A 2IU3A 3TFQA 3ZC3A 4OGQD 3EZ7A 3G0DA 4OMDA 3O2SB 2W2PA 2G9NA 1BYIA 4D3YA 2BCCJ 2WWHA 3FOWA 3TLGA 3WL5A 3WHLA 1OAAA 1JHDA 1B41A 1XVUA 2VA9A 4UCFA 4F21A 3FPHA 1SKUA 1B00A 2WJYA 4KNWA 4XGRA 5DRYA 3Q5GA 1KAGA 4CUKA 4JXXA 1Z5NA 4B34A 3IJRA 2OESA 5CAEA 5HF6A 4E12A 1HDZA 4CM4B 1NRXA 2PJRA 3A0BE 4NPHA 1E2UA 5LFAA 4DLVA 5JCXA 1GP2A 4O02B 4EG8A 1JTHB 5JEEA 2CLIB 1U8CB 3HYRA 3CC4Z 3PC8A 4HNTA 1I30A 3PD7A 3GTKI 1WQ4A 3O3MB 3NDRA 2VP9A 2QTZA 3HJRA 3RW9A 1B93A 4IAOA 1IFNA 2XIJA 2W71A 2DH6A 3S14I 1J0XO 1W88A 1C1XB 2F9FA 2CNWA 1LTSC 3TDKA 1KYXA 3H2YA 1NNI1 4FR5A 3SBEA 3ESAA 3R0IA 3OESA 4EGCB 2UZ0A 1T5IA 2YS6A 3DYIA 3RROA 4H0NA 4LX8A 2R8RA 2JJ8A 1WETA 5BORA 4EY5A 2BP7A 1DAMA 4HH1A 3LMKA 1IQPA 4KGXA 2OT3B 4X1IA 1R9MA 2WD7A 1J49A 4YPCA 1ODCA 1H0TA 2VSQA 1FW8A 4H44D 1QO0D 3MINA 4UPDA 4IUCS 2NSDA 3BGWA 5KAIE 3CUSA 4BRSA 4JCCA 5D5HA 4UNRA 2VJMA 1X14A 3BE6A 3L18A 1HGZA 5E6UB 5EHGA 3W1VA 3SE7A 1FTSA 2VN8A 5HR5A 3NCTA 3AFIA 1P84H 2PFGA 4C7BA 2AOUA 1XNRB 3S3TA 2ZRFA 1EK2A 1M8KA 1P7VA 3EPPA 3HVHA 2GASA 4WOBA 1IPHA 1U8YA 2VG8A 1T3GA 2ID7A 3QKTA 4Q00A 4ZZ2A 3T34A 1EK1A 1K5HA 3MTAA 4NG4A 4RYLA 1EUZA 2H0AA 1WCMA 4C5CA 1A5SB 1OVMA 1LGHB 3EERA 2H1HA 2WVRA 4I3FA 1SFCB 1HL7A 2W9XA 2GN1A 4XZ3A 3SNKA 4D74A 4HI0E 4JBXA 4Q19A 4DM3A 2W2VA 2QZPA 2PV7A 1ZEMA 2XT6A 1PV3A 3PFKA 3IDFA 1UM9B 3DV0A 5BT8A 1OKKD 1EP2B 4H1VA 2B36A 4RD2A 4CKZA 4AKIA 3GP3A 2RAVA 5BQFA 4YQZA 5JALA 4HWTA 2VH2A 2D0PB 2ZT5A 1U04A 3QLJA 4OAPA 3QWUA 2Z2XA 4CMHA 2FFJA 4E30A 3FVQA 3CC21 3HSYA 4DMCA 4CIYA 1G8PA 1WKBA 4OHRA 1JHPA 4Q9HA 3SN6A 3JAMb 4R8MA 1HBWA 3EVAA 5IM4A 5GM2A 5AKIA 3TH5A 3EGXA 3R0XA 3DDCA 3NB0A 2C5FA 4LGYA 1IN1A 4JS7A 3ERCA 1T2KC 1DO0A 1E7MA 2AW3A 4UNSA 3A6GA 2HZ7A 1PKXA 4RD4A 3ZK9A 3OAAD 3RVQA 4E2ZA 4G0UA 1NUQA 1DU4A 3I5YA 1WMEA 3AIKA 1JL3A 3CRZA 4IS3A 4QOJA 2OGUA 5CDUA 2PSFA 1KVSA 4NE9A 3EW9A 1V3VA 2VJNA 4PE5B 4D6TE 5B66H 1L1FA 1OH8A 3O1IC 4TROA 3I4MI 4PSUA 2CFRA 3EA4A 4PY2A 4KYVA 2WWVD 2AT1A 3PXEA 4S04A 4O0LA 4AP9A 4PYLA 4NK5A 3ZKAA 2AG0A 2QTRA 2GA1A 1VQK1 1A27A 4OP2A 5CB8A 4JT8A 2BF4A 4F46A 3AY3A 1UIRA 1UAAA 4BN5A 3HB0A 3TLZA 4BCBA 2PK7A 2IBZE 5CYOA 1L7NA 2C9CA 2YV4A 3B1YA 2Y1GA 2HZBA 2B35A 2ZJ8A 5A4DA 4MCJA 3GL9A 4Z1MD 4BVFA 3FUXA 4G1EB 1CNFA 4OXNA 1D03A 2R3SA 1LDGA 2PDAA 5DT9A 3V8MA 4L5CA 4OD0A 4PVCA 1B43A 2G08A 3CR8A 3ZS8A 3PLRA 2O8EB 4PLHA 2LBPA 4EL0A 4F92B 2ZBVA 4BQQA 1N0WA 2YWHA 2FFBA 4RMJA 3A2AA 2RN0A 2E1RA 3B36A 1E4EA 4QYWA 4EZEA 2NUAA 1BW9A 4NH1C 1TEVA 2OCKA 3LH5A 3MN1A 1QQ6A 4TKZA 4V1CA 3LQ2A 4MD7A 4E5SA 1P1IA 3B7WA 2E2IA 1P8AA 2BFCB 2HRDA 1G8JA 3G02A 3GRRA 1LI4A 2PSSA 4YCBA 4ITRC 3TZCA 1S1MA 1Z68A 3WDMA 2RG7A 2V7QD 1HYQA 3W1EA 1V26A 2QJWA 3UEOA 1BMTA 1R0YA 2MHCA 4QAQA 2D1RA 3VB9A 4DR4B 5IHPA 2EFJA 121PA 1XVTA 3C3JA 3L70D 4PQRA 2AZDA 1KC3A 2IXAA 2FRDC 2X86A 3LLCA 4G5SA 3RIEA 3VR6A 1EIWA 3FPSA 1MH1A 4EKYA 3UWPA 5KTSA 2NVXI 3A32A 3GLIA 1MAAA 4BKRA 2WABA 1UFQA 1OYVA 3BTUA 3ZJTA 1DI0A 1KTMA 1NLFA 4JJAA 4LZOA 1L4AB 4DDUA 1Y3FE 2XYVA 1NM5A 3FKIA 3IOYA 1Z07A 4PRZA 1FY2A 2X3YA 1KI7A 1YB5A 4IP0A 5E2BA 2YJ3A 4PD4H 3NTQA 3AY0A 3EZ9A 3G7NA 3KDPA 5CLQA 5LZ2A 1S2MA 1G38A 3U4DA 5KDDA 4GUAA 4IZIA 1QYIA 3BXHA 2YV1A 3EK2A 3GR6A 3OX4A 4INAA 1KQPA 2AJBA 2FDRA 3QBTA 1NVEA 1S9KE 5CXXA 4H7IA 3H1KE 4ZKPA 1NI4A 2FB9A 1NYRA 3LBIA 3A14A 2WJAA 1YJBA 1CLEA 4DREA 4JUDX 4GBJA 5I7UA 3AV0B 1XMOB 4XYMA 3ECSA 4V3BA 5K0JA 1AQNA 3UZUA 5AW2A 3SUJA 3I2IA 2AX4A 3VKGA 3C3DA 5E4FA 1E8MA 1ZJ4A 4MUBA 1BSNA 2PH1A 5JO0A 1YQ9A 2GSWA 1Q7CA 1WPRA 2L42A 2YVUA 4DR2B 4Q02A 3KR2A 4UTZA 5K0TA 3IIKA 1XQ6A 5BOSA 2WPRA 4JT9A 1I14A 2YHBA 3ADKA 1IUKA 2BJOA 2WZQA 4HDQB 4M8LA 4XJVA 1TK3A 3COWA 4GXNA 1TWFI 5CJJA 5FNZA 4LSMA 1O0BA 3GLGA 3INNA 3ESZA 3HB4X 1I80A 1RHQA 3HJGA 3IEPA 3G2LA 3ISJA 4DYVA 4R8LA 2WVJA 2Q4TA 1TPYA 3W05A 2VUUA 1Y82A 1KV4A 3T5DA 5GP1A 3W8DA 4Z4QA 2HHAA 1FZAA 1CZ5A 1CZNA 4NIMA 2F3RA 1PJ4A 4NFHA 5HMMA 3STTA 2G9ZA 5F1PA 3ZHCA 1TJ3A 3DDSA 4DCJA 5L4NA 1MJFA 4XFDA 1P1RA 1VC3B 3FVVA 3ZCVA 1U6JA 3UHFA 4HB0A 2AQIA 3SIRA 1YTLA 3HCEA 4HS9A 4UU8A 2B92A 2P0YA 2Z5GA 4QPCA 4WESA 3T5CA 1OYYA 3I9V6 2WKSA 2B0CA 4QU5A 3QBJA 1SXPA 1HOXA 1EX9A 3AVQA 3FX0A 1NI3A 2WINI 1YF3A 2MYTA 2GQ0A 3AUYA 3O9ZA 4ARVA 1U28A 3OZRA 3P96A 1UADA 1CR2A 1KK2A 3BCCD 2KE5A 4JD5A 1A9TA 4TTJA 3VPXA 2LD4A 1F4VA 4J4BA 4N5DA 4C0KA 4UCXA 4GVLA 1GA1A 2MSWA 3QG5A 4R0NA 1RFLA 4H35A 2OZEA 5KUTA 2QA4Z 4OH1A 4C4SA 3PZRA 4ZALA 1PWYE 3VDXA 2NP7A 3THSA 5FNVB 2ZS9A 3SR0A 3MEQA 2A6ED 2J8ZA 1J1EB 1DBWA 3RADC 5JATA 3WFIA 1SZDA 4B4OA 1GL9B 4TZ6A 2H07A 3AUTA 3N2KB 3EMDA 3RSQA 5K8LA 5F2KA 5CW1A 1JWLA 3VHQA 3TMYA 1SC3A 4NSNA 1Z73A 3KFXA 2KYRA 4FSHA 2D0DA 3C98A 2ZBGA 3T3OA 4L4SA 3ZV3A 4GP7A 1UJ6A 1U1CA 2VNHA 2YVQA 1W5TA 1VM6A 3IEKA 4MGEA 2GN4A 3R7AA 5B1IA 4KV9A 2IYPA 3IFSA 2CZCA 4D92A 3H3XA 3HUDA 3IUNA 3NIFB 4R5HA 1GDHA 3PBKA 4JH0A 1KBOA 1PGOA 4E31A 3MWGA 4LSZA 4ZO4A 1QRUA 5AW7B 4YJ3F 1GPJA 4PZYA 5IDVA 1JCDA 1TVCA 1XRJA 4RE6A 4RLFA 2AEJA 1K7CA 1K7FB 3F4BA 4OU4A 3KPVA 4M6WB 2HPVA 3P0JA 4PZZA 2IZ4A 1DQYA 1M1YA 1U1GA 3AHEA 3FYUC 2UYCA 1A5TA 4K6KA 3QU9A 3FYCA 1IWOA 3UHOA 1N5LA 1M56D 3L73G 3A6KA 2DPLA 1FDRA 3AEQA 1JW9B 1G0NA 4LK2A 3EEIA 3NFQA 2C5GA 3E9EA 2OO7A 3D1VA 4Z0TA 4JLDA 1MDBA 2XA2A 5JS2A 5K01A 5IT0A 2D5LA 1HBJA 1N8R1 1ECPA 1R0KA 1QHFA 4IOIH 3LIDA 3E7KA 1X3SA 3ED5A 4LJ4A 1Y33E 4UE2A 5JSKA 3T7TA 1THGA 1S3GA 3G82C 3R3XA 3WUUA 5BWMA 2HNAA 5ICCA 5C46F 1QTRA 1LCIA 3F5QA 3UK2A 1C7RA 3M4YA 4G23A 1PNVA 4JQCA 4ONEA 1W2BY 5E79H 3NIGB 2H85A 2R92I 2AKAB 2WYWA 4OLHA 1TNDA 3MSCA 2W6IA 4B31A 2XCOA 4FZVA 4M9SA 1C9JA 1B15A 3AZOA 2P8JA 2CUKA 2HWKA 4H2DA 4A27A 3D0RA 2Z3VA 1WLFA 5CH5A 2H1RA 1V4VA 1L8XA 2RT9A 3DJYA 2QL6A 3G5MA 3MRSA 4KE7A 4DPKA 1I2ZA 4EVIA 4H15A 1QK5A 5IARA 3U09A 3QQ7A 3V4LA 1RLOA 1Z6YA 1N6PA 1Y1SA 1Y9AA 1ZKDA 2FEOA 2QQEA 4LZWA 2A2ZA 1SBIA 2H7XA 2XGJA 1NR1A 3B3AA 3RLIA 1WVGA 2V54A 4D9KA 4DVGA 5JROA 3BMOA 4R7ZA 1C14A 2AOWA 4WBNB 2OAQ1 3EXHB 2OMEA 3HJBA 1G6OA 1PFUA 3BCUA 1OGIA 2JGFA 2JRCA 2V9ZA 2UXCB 3SHOA 2Y3IA 1AUXA 3JD2A 5JCOA 1VDMA 4MIEA 1OTHA 3QPBA 4WERA 4C2AA 4YDSA 4RY9A 5B2ZA 1KJZA 2ZSBA 3AOEA 2ZTUA 2VCYA 1GRCA 3EH2A 3H84A 1ACJA 2QRJA 3CSDA 4NZ9A 2A9VA 5D86A 4IMIB 1J2YA 1BE6A 3F9RA 4HX2A 3R8XA 4JJ4A 1KOLA 1YRWA 2VQFB 5APYA 1S6YA 1ZA2A 3AR2A 3VDNB 1LLQA 1ZD5A 1H85A 2CEKA 4CL2A 2VF8A 4R98A 4NYJR 1SVWA 1XCGB 4NHOA 4JBIA 2H3EA 1X19A 4UW9A 3L0OA 5BWCA 3TCNA 4ND2A 1RW4A 4R1PA 4QSHA 1ISFA 1U2PA 4MW7A 3CPWO 3U3OA 1ZUHA 1NTZD 3K72B 5GVSA 4IIJA 2ZP1A 2A88A 3STYA 4CV1A 3CC7Z 4DNXA 2VPYA 4EG0A 4EUEA 3NVKI 1UCFA 3CN9A 1Z29A 1LRJA 4E2FA 3I34X 3ONVA 4JI8B 2DF8A 2GSDA 2AE0X 1N7SD 5KB3A 5HP4A 3KVRA 3K5WA 1OE0A 2HF2A 3K6RA 4ECEA 5K8JB 1QBKC 2R92A 1JLMA 4YEDA 1C30A 2YCBA 3CXRA 5G53C 4RA6B 1GCUA 1PSDA 1SFOA 3AY6A 3EUWA 1OA9A 2AJDA 2HCRA 4JJGA 4DV1B 4R41A 3U3RA 1WCV1 2QPAA 4QJ4A 1EVIA 3SULA 1GUZA 3A4IA 4MN4C 5CBNA 2Y67A 3QHPA 4F9EA 5L9AA 2GZSA 1YI21 3NDBB 2VSYA 2YIDA 1Z5VA 3GELA 4DLRA 2LCIA 1U81A 2ZSHA 1KPHA 5CBOA 1EFPA 3PWZA 3TIGA 1ISPA 4Y2HA 1AGYA 5KIAA 1RKQA 4X64B 1CCWA 5H4GA 4A3JI 5GV7A 5EIBD 3OEED 3H3JA 3KQHA 1KI6B 4TWIA 4YCLA 1M902 4MV5A 1AC5A 3WBFA 4A93I 5AW2B 1KYWA 4KQ6A 1VQ5P 2K4MA 4D0NA 1E18A 2CFSA 2IBTA 5KREA 1T26A 1U0JA 1YZHA 4Y0NA 2DJIA 1QRTA 3RV4A 2H4ZA 3H9QA 1WDKA 3HYNA 4OJMX 2D7DA 2FEMA 3F7NA 3ZLTA 1EGVB 3DTVA 2GEVA 2O07A 2PR7A 5G4LA 2OARA 2X1LA 1Y42X 3CX5H 2RBLA 3G89A 1QIFA 2BTOA 4NBEA 1VXRA 4RXTA 1KP9A 2IOHA 2CB0A 3M1AA 4JP5A 4WKNA 1P19A 3DMHA 3RO7A 3TG2A 2BFNA 1GAXA 1DWQA 1V6CA 2GTIA 2ATCA 1ZM3A 2ODQA 1A4IA 3BJMA 2LEXA 2OPBA 3NHYA 4ESHA 1M5TA 3FETA 4HDMA 1VF5B 4WDQA 1QYCA 2IYFA 3TLXA 3KZOA 2DPXA 1LJ8A 4G89A 4JOSA 4DWVA 2DFPA 1WNTA 1RE1A 3C8DA 1GGEA 4PANA 4PLTA 5D8DA 3AF6A 1RRKA 2QLNA 1P4RA 5AKJA 4YRGA 1TRHA 3HY3A 1JPUA 4TN5A 1JPVA 4YBRA 1SBQA 3PCRB 2X4LA 3BXPA 1JUDA 1PX2A 2HMUA 2MYNA 3EISA 3OUUA 3T3GA 3FCOA 5AHOA 3NETA 4J29A 4AS1A 2DBQA 4OL9A 5KYYA 2QN7A 3ETLA 4LJ6A 3GLTA 3ZHZA 2Z58A 4DV0B 2HLDD 2HH9A 2IYLD 3R0JA 4IXMA 4UFOA 5JMOA 1RO0A 4G41A 1MLDA 4COOA 2YKQA 2FJPA 1RQPA 3ES9A 4BNXA 3MT8A 2IOQA 4CRZA 2FFDA 3K0AB 4MWSA 4H44C 4R2IA 3R7WB 5JZOA 2YWEA 1SA0B 1VLZA 2O2IA 5A9SB 1RM5A 4E1AA 1L7PA 3PUKA 3I5XA 2WJHA 4G0WA 1TU3F 5AVSA 1O8CA 2IPPA 1KY3A 1RRFA 1NTZK 1CUUA 1R37A 2XE7A 2YMMA 3BDAA 2R79A 3IEIA 3IQDB 4KDFA 1JMVA 1Y1RA 1QL2A 4N8SA 1USUA 3C0KA 4KX5A 4NBVA 4KPUA 5IABA 1EKXA 1J09A 3F6RA 4B09A 1FZFA 3E82A 1OW7A 1DTSA 2BCGY 4AO6A 1PZGA 4LNUB 2MKVA 2B1QA 1P84D 4MTCA 1T4DA 2PYIA 4I4LA 4F9TA 3R76A 3KU4A 4A6EA 1ILWA 2QTMA 4F4DA 2RHTA 5BN1A 3SXPA 8ABPA 3ZCSA 1XCPA 1P5ZB 4OUKX 3ZDFA 1GNSA 1L8AA 1J1DC 3Q9NA 3UK0A 4LF7B 2WPNA 1GNTA 2C84A 3F2VA 3BXZA 5G0TA 1CZKA 4AICA 4ZKDA 2KWIA 5AN9F 2NV0A 5TQ0A 5GTIE 3H1KG 1YI2Z 1P9OA 3A6EA 4KN5A 2BD0A 2DR3A 2OV2A 4KDEA 3R9XA 3EFHA 2YINC 3AESA 5K6TA 5AVJA 4URYR 4K6CA 1RLYA 3O83A 2GBFA 4GF5A 5KS2A 3VGPA 2A8YA 1VMKA 3ZHSA 3H97A 4HNAA 2B9EA 3G6KA 2SCUA 5BQPA 1LLDA 4V38A 2HDNB 2VZEA 2FJUA 3D6WA 3M6XA 3QUCA 2NVUA 4OQ4A 5CX4A 3WQBA 1IN6A 1EJ6A 2QNIA 2YZ7A 4RQUA 4UARA 2BMFA 5TVKA 1MFTA 3NDIA 1Z2DA 1ZRTD 5FWAA 3TZKA 1BYUA 1XDGA 1NRJB 1PFKA 1UZLA 2Q5LA 3C2QA 3IOMA 4H6WA 3RVPA 3T9BA 4BLVA 4PC7A 1FZCA 1SXJA 4EY6A 4IDNA 3K16A 4OQZA 5EI5A 3SUKA 2OAGA 2QJPC 2GCIA 2XT0A 2XVZA 3PIIA 4NDNE 1MTZA 1IZ8A 5DBHX 2NWQA 3FKII 4MKXA 2IIVA 5IBCA 4QXPA 5J1SB 5T4EA 3ZI7A 5KYTA 4UEJA 4WN9B 3WBKA 3JATB 1Y1LA 1TU3A 3F3MA 1ISJA 2FQ1A 4H27A 4KPGA 1NTZJ 3EQ9A 4F12A 1FFSA 2SECE 4WH0A 1YKSA 4KQGA 4A3FI 1JIJA 3W2FA 1MA0A 2R2AA 3MJVA 1OW6A 4MW6A 5DWQA 2E4UA 5C7IO 4MYCA 1HT0A 2R5FA 4QDKA 2JD1A 1JV2B 2E6KA 3U6BA 3EGDB 4YUXA 4B5KA 3SHFA 4YQFA 2G7ZA 1S9DA 2FMXA 5BNIA 3PUVA 2VHYA 2GZ3A 1HF3A 1KO7A 1TD1A 2FFAA 1P4SA 5E6UA 3PKIA 5G3YA 1D1PA 4J3NA 2B34A 4ZMSA 2ZUBA 1VE9A 4U2EA 4YT5A 5FBZA 1Y8CA 4PCUA 2HFKA 3DBRB 1HEUA 2PUEA 4K9MA 4WK6A 1XVVA 3IURA 2YXNA 1E9SA 1LF0A 4D44A 3KHSA 1VHLA 5FBQB 3ELYA 3B6EA 3EVGA 3QWOC 2BP7B 3MLAA 4TSFD 5FB3A 1QO0A 3EZYA 5FIUA 3L1JA 3VMFA 1B1CA 4XVRA 5EAIA 5H7XA 2IYTA 4Q4CA 3BHMA 5BSMA 2EW2A 3OW2O 1XQXA 3AKYA 4BNNA 3G2OA 2QDXA 1AKWA 1W9MA 4R2JA 2Y1FA 1A95A 4ZCSA 5TT1A 4BXLA 2O1XA 3OLWA 3GVIA 3R3WA 1N3LA 2A9OA 1QCSA 2NZUG 1VYUA 2QSZA 4GKVA 2BZ1A 4C04A 3OQIA 2WTUA 1WDMA 4OLFA 4H3HB 4GEGA 4BGIA 4M38A 3WKEA 5EJ6A 1IVYA 1LDYA 1A76A 3ZQ4A 4HPJB 3T9CA 2CJPA 1E1NA 3HTKB 4TZ0A 4MQEB 5KU7A 2NTNA 3L77A 1X1SA 3ELDA 4CPDA 1KAHA 4J7XA 1Z0JA 1KDPA 2YRFA 3N28A 2DPHA 3A8TA 4J90A 4YRQA 1JSZA 2Y77A 2JRLA 3FTNA 1SUSA 2JGRA 3CLUD 3NVMB 2XODA 3HC7A 4JEUA 5T64A 1SQVK 1F9EA 2DJ5A 3A6LA 5L3QB 3IP3A 2V7WA 1UXGA 2FYNB 1SCJA 1VECA 3I1JA 2KLUA 1YTUA 2RFLA 5TF0A 1EQUA 1TYAE 1JF8A 2GBIA 2ZT6A 3AR6A 4FBLA 3HA7A 4RH1A 5BSRA 3T3IA 1NW4A 4UUQA 1H88A 5D87A 3R8FA 3OHPA 1V8FA 3QFSA 3BGIA 1WABA 3V55A 4M7PA 1GTRA 2C4TA 3QUQA 3ADCA 1I3QI 1VI5A 2BHLA 2A3RA 3DVAA 3FXAA 4OQLA 1XD8A 1KR5A 3FB1A 4U7FA 3SM9A 3V80A 2AVDA 4D56A 5CXQA 9GPBA 3O2NA 2LFUA 1TMYA 1IULA 1K4YA 2H1SA 2LDXA 2GEJA 1JLSA 1CJTC 2AG6A 2FLKA 2Q4RA 1ZNWA 1UXJA 3G8CA 5DOVA 3L07A 1ZH1A 4G8DA 4JWKA 4OQEA 3QJYA 4BFWA 1H8ED 2Q27A 3P2YA 1OREA 4HFRA 4YXWA 621PA 3WK7A 1AJYA 4XIYA 1LPOA 3M3DA 3PD0A 1I4EB 1I33A 1U2DC 3GRZA 2EEOB 3QPWA 5D3KA 3OURA 1ESEA 4PBSA 1U7MA 1TEXA 3CCUP 1E2PA 1PFVA 3UANA 1XZLA 2CYAA 4B7CA 4C05A 4WCDA 3ZCTA 5JISA 3G0CA 3DZIA 2JGLA 1LWUC 2XAAA 4RDHA 2XDJA 3OLZA 1Y9ZA 4MIOA 2PUAA 1PT9A 3F49S 3R9WA 2Q49A 4QUHA 3RRNA 3DD5A 3MZ0A 3CX7A 1RXVA 1TZJA 4B0PA 3FKQA 4N41A 2H4YA 4HZUB 4EA9A 2O8CB 4J94A 1RQ7A 1DT3A 3T3DA 1DHTA 5K2MA 1BA3A 4OL0A 1PYGA 3STUA 3HXQA 3AEUA 3E1IA 1T2UA 4E32A 1YMVA 4A1OA 4N9QA 1RYFA 4D3ZA 3ANYB 4L3WA 1NNSA 1ODJA 3OCWA 4LE0A 1ZD1A 3V2PA 2FKAA 4X61A 3BZBA 2VHQA 4Q9AA 4YP7A 1YDEA 2FLVA 1MTOA 1P1KA 1W76A 2G36A 2JVJA 3EN0A 2G3YA 1OIWA 2DTDA 3ILXA 2JZOA 3OZVA 3WL8A 4WVZA 3RAEC 4MPDA 4UD2A 2WKQA 4IJ5A 1JDVA 3OICA 5EUMA 4URVR 3C1LA 3OEWA 2RHCA 3L7MA 4PC6A 2ONYA 2P9YA 4LNUA 4YO7A 2XGMA 4LVOA 1DOHA 5B5SA 1WD7A 3OY2A 2NSLA 5LJIA 4RTSA 4NCBA 3V9AA 4B6SA 3JAMA 1FZTA 3RRFA 5DJTB 2W37A 4F6RA 5AVSB 3PC3A 4TS1A 2F1KA 3FVTA 4PX9A 4DUZB 1W25A 1Z08A 1ZWKA 4BV9A 4EKGA 3S8EA 3QQ8A 3QNWA 1SM4A 3ZU2A 1E1LA 4RIEA 3QSYA 2ZBRA 4L74A 1P4JA 2DFDA 4HNRA 1LPBB 2M2IA 3R0VA 3AHHA 1UBTS 5EE9A 2RB4A 3HB7A 1OZHA 1ZUNB 1G19A 2BW0A 2A84A 5CYFA 1SUBA 2ONCA 3QLVA 4PYKA 1Q1BA 4YXFA 2O2CA 5F1YA 5IULC 3L8HA 4KYIB 3EXFA 2RBGA 1A9RA 1U7DA 3Q7IA 3I1FA 3THXB 3E35A 1AQTA 2F64A 3MBOA 1UDBA 1ACLA 4HAUA 1NNUA 2IPOA 4KPYA 1QGZA 5H2FH 1QLED 1CJBA 1Y80A 1P31A 2A1UB 1V8ZA 3ZYCA 4EB6B 4P32A 4Q9NA 3G6E1 2YRXA 3O8LA 4QG7A 1FU1A 5DHFA 5F5NA 4ZVVA 2QQ5A 1NQVA 3DXYA 3GBPA 1COWA 1KRXA 2QT9A 3FA2A 4MDEA 1SVNA 3CKKA 1EZVG 2XKMA 1KHHA 1E8NA 2WHXA 3IP9A 4IHKA 4QTUB 5KJ7A 4N7BA 5DX8A 4I1SA 2IVZA 4BFLA 3OJEA 5J58A 1UKEA 5HK8A 2J5UA 1VDZA 2B4RO 4NU8X 4RAOA 1Z17A 4KFTA 2Q6LA 4H18A 5CT4A 4ZDJA 4IKOA 4MV9A 5DLEA 3O31A 4TKLA 5I7EA 2C20A 4Y7DA 2QE7H 2WT9A 3CZ9A 3MXOA 2HT6A 3PG5A 1AVOA 4KLCA 2ID9A 2O3RA 2PD3A 1PNTA 3G2QA 2BH2A 2NXEA 4HZGA 1ZCFA 1UFRA 3PX7A 1XLTA 3H1KJ 4ZO9A 3FAZA 3JSAA 4M1MA 3H0EA 4N8DA 3SLGA 4FFVA 1J97A 1TX4B 4WASA 3NAZA 4NKRA 3OQOA 3DB2A 1IK4A 3GVXA 3PYXA 2XSZA 4KDRA 4OUDB 3TZ6A 3CF4A 5KNCD 4A3LI 2GETA 3LW8A 2GJAA 4CU5A 1KP3A 1YFJA 1EFPB 4OXKA 3LRTA 4C4PA 1N5OX 1SQVJ 4DV5B 4H31A 16PKA 3P9CA 4PC3A 2GWRA 3GLKA 1F6DA 3Q10A 4EVSA 5C7OO 3D3WB 3JAMf 4IQ4A 1ZIOA 4U6SA 1C7ZA 4B3IA 5KLIB 5DP1A 2HMAA 1V47A 1BDMA 4B6JA 3E1RA 5IAAA 2D5CA 1RZVA 2AYDA 4M0KA 2G0NA 3KM0A 3T52A 3JYQA 4YJFA 5JUWA 1ODKA 2P4UA 3S1AA 5EIXA 1ABEA 3O0TA 1T24A 1X79B 2IW1A 2Q0QA 1BXGA 1GNVA 2JFYA 2R7NA 3OZFA 4OBEA 1KZ6A 3D3NA 4Q66C 1VQKZ 1XZBA 1NZFA 2M3BA 1Y8RB 4MQ6A 1LPNA 3C1UA 4NOMA 4EYQA 1TYZA 3FXDA 2WIFA 4Y6GB 3STHA 4BV8A 2FKWB 1U0FA 2G1KA 3ELBA 1U3CA 1VDFA 4DTCA 4EJ2A 3AHDA 3U1VA 2WVGA 4MVJE 3B3JA 3MJSA 4FLMA 3BSWA 4O4HB 4OXIA 4AG5A 5IC4A 4US1R 3ELWA 1E7YA 3JVEA 5JYDA 3A1UA 3CPWY 3D81A 1VQ81 1SKYB 2R68A 3C1AA 4P58A 5BR4A 4I6MC 2OYHA 1I7NA 1OT5A 2O1JA 2ZETA 1ZXXA 3CEHA 2LKDA 2OAEA 2JR8A 1F0NA 3KUCA 1GDDA 4EG5A 4ER5A 2J9ZB 3E4DA 2PL3A 2L18A 3OW2Z 1GTG1 2WF5A 1RF0C 3CME1 1UZNA 4Q3DA 5CGQB 3T3MB 3T5GA 4CLDA 5K8IA 4XA8A 1G1JA 4MVYA 5JXHA 1H6CA 1TWHA 3A1VA 2H89C 2GDZA 2AN4A 3BATA 4UB6E 5F12A 3ITNA 3K2BA 2R2GA 3AKEA 1JEEA 4BO3A 2A0KA 4WL0A 1I7SB 3UOAB 1G4HA 1L5ZA 1L7AA 4WNCA 1FVXA 1UWCA 2FPMA 2VKTA 5T3YA 3TNFA 1GILA 1FJXA 2IHNA 4WBNA 1E9BA 5DSXA 1ZI6A 3V2UA 4KGZA 5EKSA 3QOXA 1KILA 1JP7A 4JL5A 4L0DA 5JTUA 2PGDA 2DYKA 2EYUA 1Z4NA 2O2GA 1IY8A 1KGDA 2WHEA 3GV0A 1KB9I 1W85B 2P5YA 3AU9A 3HY4A 4PZAA 2X40A 1Y3BE 3ENWA 5AM5A 4ZEWA 2BJVA 1ZCBA 2J46A 3AR9A 2QRGA 3WK8A 2EF1A 2ZSKA 2PAAA 1JDUA 4UU7A 3WO0A 4DV6B 3ZEIA 2FPLA 1CRQA 2JIBA 3EOZA 2IYWA 4IFEA 4LF5B 3RRBA 2WAXA 3NV7A 5AVYA 3L75D 1T9GR 2EIHA 3NTXA 4RL6A 4BEWA 3P0EA 4Z4CA 1VQ61 3SCZA 5IDWA 2VUGA 4G0MA 4HB1A 4IO0A 4EMSA 4BRYA 1GXSA 1CYEA 1VHJA 4Y9RA 1M0SA 1CUGA 2JDIH 2CCKA 2CE7A 4CMJA 3H3FA 3PEUA 2YV5A 4LRUA 2RPRA 4P5PA 2HBRA 2VFAA 4L85A 4MV0A 5ALPA 2O19A 2NZYA 3SXUA 1SS1A 3AFGA 2QUBA 3GFSA 4KBGA 5I01A 3USCS 4CMGA 2ATXA 2RGNA 4ID9A 1CUZA 1GYPA 1V9LA 1YE8A 2GTHA 1TM3E 3HKDA 4RVDA 1K27A 1F20A 1L4NA 1X7HA 5D85A 3M0DA 2GZ1A 5JAPA 1BE3D 1T25A 5DNWA 3TW0A 1NJI1 4DTIA 2QM7A 5FUMA 4HK4A 2B3DA 4Q3BA 3HPRA 4M6WA 5F52A 4ZTUB 2PMDA 4FIDA 4O4IB 3RABA 3PP5A 2W2NA 1DZIA 3BCRA 3ESYA 3NWEA 5E2IA 5EG5A 2QN9A 3SFVA 3X43A 5IKMA 4OXRA 4WA7A 5TS2A 5J4HA 1EM8A 1OBCA 2G63A 3TDHB 3IP7A 4QRIA 3ZGXA 3VSEA 4HFMA 4NPEA 4Y67A 3LDUA 1G8YA 1DWPA 5AH0A 5EINA 1UXIA 3KKQA 3RL0C 3NRCA 3Q88A 1MGPA 3KB1A 5GJVC 5JO9A 5SYNA 3V2IA 5AW7A 4AIIA 2O8NA 4L4XA 4GMHA 2FZ4A 4UTXA 4GI2A 4J7CA 4WZAB 3RR2A 1TQ4A 3B60A 4YJ2F 3T9DA 3IDZA 1OSNA 3D70A 2FG7C 3CT4A 9LDBA 1AXEA 4K88A 2CLKB 2XA1A 4J6FA 5EYPB 4G25A 4PLVA 4NH0A 1USIA 1DQRA 2YU9I 1PR2A 3DP9A 2JEYA 1AFOA 3N2KA 5K4AA 3B5IA 4BNDA 1RKVA 4IO1A 3IHLA 3ROKA 2M1XA 4JLPA 1IU9A 4BMZA 2SNIE 4ZI7A 2A7QA 2JH9A 2GUSA 2P75A 3IQFA 5C5EA 1RRGA 3UXYA 1IRIA 1SUAA 4IDDA 2TRSB 1LX7A 5LN1A 2WT7A 2IYVA 2XMDA 2ERXA 4F97A 4NP6A 1PS9A 2BH0A 5FP0A 2KNCB 1ZXBA 2YXPX 4GGOA 1Q7RA 5CA0A 2K9YA 3T7SA 4EJSB 3H1KD 2B5VA 2M5AB 1Z75A 2PN1A 3IVAA 4TT3D 3RSFA 1NBMD 3VGJA 4F3CA 2H2HA 2B1RA 4OJKA 2I7TA 1DX9A 3DXZA 3QIAA 4M1EA 5E7IA 2FPUA 1YZLA 1WXEA 1QH0A 4P5DA 3KC2A 5B5EH 3BREA 3DMFA 4M37A 3G2MA 5L3ZA 3QY9A 1S1CA 2CLEB 4G36A 4O0MA 4OSEA 4OYLA 2JGMA 2RIRA 4RVNA 4YBZA 3WIOA 4BKUA 1K5GA 3QELB 4JL8A 4K7JA 2BMAA 3OOJA 4ZODA 2DUWA 1VFPA 3BD6A 3GNQA 4KXYA 1U9CA 4RQAA 5CVTA 3F4LA 2PU7A 1FEZA 5EP1A 3CWBE 1ZZGA 3M91A 4XLZA 5ERGB 3VOBA 1DBIA 2OKCA 3AF1A 3BWBA 1NG9A 4MWTA 4OB8A 4X97A 3OM1A 5I48A 1MNAA 3VVCA 2CXXA 3PPWA 4QG3A 4PINA 3IAXA 4AKTA 1SXJD 2ACKA 4L4ZA 4Z9YA 3W5HA 1KKLA 1HE4A 3PQ6A 5ERXA 1ODIA 4CS0A 1L9XA 3F7MA 3K4HA 3KZKA 3O7MA 3S28A 2NN3C 4RX1A 4NCHA 3DGEC 1XK7A 2WMNB 1QB7A 1L3BA 4Q16A 3BXXA 2WI8A 3A2NA 3DLPX 1HMPA 3EMBA 4X84A 1S5LE 3V4WA 4QTXA 3DZHA 3BWMA 3NYIA 4DUGD 3IDSA 5JEDA 4ND8B 3EG9B 3HUSB 2PX3A 3LUKA 2I66A 3VXKA 4C0BA 2NZXA 4RLSA 3GVHA 1S2NA 1HE8B 4ILKA 4KLZA 4GSYA 3SJ7A 2HQSA 5FPYA 4DDMA 2XQKA 1UZUA 3DBLB 3IR7A 1CZHA 2WU3A 3FPEA 3O1JC 3U48A 5BMVF 2Q8PA 2YCLA 1NTZG 2ZI3A 3ETJA 1PCXA 4FUQA 4PD4E 4W5HA 3SEAA 2AJCA 1JJ2Z 2IYXA 3EGWA 3TNYA 3J81b 3UICA 5JYEA 1VQKP 4N78E 3LLUA 1OA0A 1X1CA 3FPBA 3H5NA 3KOOA 4DQKA 4JB3A 3FNGA 1XAHA 3FXEA 4DKXA 1WXHA 2F3QA 2XE8A 4BMDA 1R4NA 4BE4A 4I14A 5IVPA 4QXOA 5JWOA 3VP9A 2VDWB 3PH0A 5L6MB 2RH8A 5ALGA 1D2GA 1KJQA 4TLMB 5DHTA 3U16A 4U2GA 2ZR7A 5I8ZA 2DFTA 5EZSA 1ZBQA 4QTYA 4MUNA 1L4AA 2YZ2A 3OH8A 3I76A 1E4OA 4JGIA 1JSRA 4P4SA 4EY7A 4H1HA 5ICGA 4CIDA 1Y3CE 1I3MA 2YHSA 5JWRA 4AMYA 3QVGB 2E4WA 4C5BA 3F97A 4I1VA 3K1TA 4EUFA 5TLSA 2JFFA 2VAXA 3BDVA 1PUIA 3IKLA 2VO1A 2XMRA 2R6R1 3C5HA 3OCXA 1NTOA 3OKAA 3TLMA 5BR1A 4H7HA 3X2IA 1PD0A 2UAGA 2ZT8A 2H2AA 1NNEA 1JAYA 1G8SA 1HLGA 3ZHBA 1UJ4A 3HVUA 1WHTB 4G8CA 1CEXA 4LCJA 3S1SA 4MAFA 4KO8A 2D2CB 5E95A 5ELMA 5PNTA 3ZJ5A 3JARA 2Q4BA 2W7TA 3A3YA 3JVUA 4A03A 4IV0A 4B4WA 5KDOA 5JAZA 1AXRA 1G2CB 1MKMA 1FRNA 2BN4A 4DE5A 1GPH1 1NUAA 1P0FA 5G41A 4AZ3A 3PEWA 4V1CB 1FB5A 2RK4A 3AXSA 4PD4D 4IL6E 3CCL1 3GX1A 3H2IA 1BS2A 1V7QA 1R5BA 3UJCA 5HYVA 3FE2A 1JVNA 3MWFA 3DA8A 4UNPA 2PQ0A 1KTVA 3K31A 4WHMA 1SKMA 3GW6A 1FXSA 2R85A 1G16A 3UENA 2OTLZ 1F38A 2ODAA 3KHUA 1BE3J 1YDHA 1KQ3A 3E9YA 1HDXA 1GOTA 2FTKE 4FR2A 4IMJB 2BGRA 4J91A 1ZH8A 4JITA 5FI1B 2EQ5A 5AQEA 1EK6A 2HJSA 3ZEAA 4NPFX 1PT0A 2VSXA 3LL7A 3Q8XB 5LVAA 1K63A 3GHGA 1G1AA 1F2TB 1N6LA 1YJ8A 1SKYE 2WOOA 3GLSA 1NMXA 3O3NB 4P92A 4AWXA 4M1KA 5LA6F 1SQPJ 2F67A 3OJWA 4WOKA 4BZWA 1IVSA 5AVRB 4KQWA 3FM9A 3ZE1B 1CKEA 4I5IA 2VT6A 4HH3C 3TIXB 2PMWB 1H8HA 3FFWA 4NOHA 3PV0A 4FGZA 4D7ZB 4PIVA 4Y6SA 2FW9A 2ZIUB 2FCRA 1Q20A 1K731 2YMYA 3BB3A 2ZUDA 2KYVA 3OFSA 5IZCC 3FCEA 1WIWA 1BA2A 3L1UA 1DJMA 4O29A 1OZFA 3VO9A 3PJRA 3QE4A 2H88C 1S0UA 4XM1A 2F55A 1M6VB 1VSVA 4WXEA 1CP3A 3IKJA 3C39A 2PRRA 5DM2A 4Y2QA 4DSNA 4B3BA 4H7EA 4LE1A 4NZMA 1AA0A 1V7ZA 1WS6A 1ZUWA 2X6QA 3QFFA 1APBA 1G7RA 2Q9AA 2CB9A 3T94A 3T7RA 3W4IA 1J8VA 1WP4A 3LG2A 4YRBA 4ZI3A 4MQMA 1WXIA 3L4EA 3N74A 3ER8A 3N07A 2PEYA 5B1HA 1NBWB 3RYCB 1U0GA 5GTIH 4V0SA 4UZEA 3AT1A 2G25A 3WGIA 2D1TA 2DVMA 3GJ8A 1T3JA 1N9KA 4Y7NI 1RWNA 1LLCA 4RKYA 3L0ZA 2GF9A 4OIMA 2O7VA 4P53A 4BNJA 4FQ5A 5KQMA 1H89A 1G2QA 2UWJE 2W2KB 2WKPA 5I7VA 1K3TA 3A6DA 3KIHA 1BN7A 1UM9A 2QORA 3IYLW 2WU4A 1CEQA 2YYZA 4MW4A 1YZQA 2FEAA 1NE7A 1NVTA 1PG5A 2ZEJA 4G5XA 5AIAA 4DL9A 1WMKA 2OCGA 5JMWA 3OJXA 1Z6GA 4X60A 3PQ2A 5FA8A 1A8PA 1WZIA 3U40A 4BFVA 4ENRA 1RQLA 2AC7A 1SU8A 2VJDA 3S17I 1U4NA 3B89A 3CLVA 2H11A 1J8FA 1O97C 2WK1A 4BLUA 2EBWA 4QYSA 2Y9PB 1XB2A 2FYZA 1AG9A 1NQAO 4XDGA 4ZOQI 2JD0A 3TZEA 3RYFB 3REFA 2XQJA 3N8KA 4EWCA 5A5FA 1ZVMA 3K7EA 3MMSA 4FMPA 3DCYA 3O4IA 4I50F 4RWZA 4KP7A 3H18A 3IP1A 3Q12A 1XWFA 4I2LC 4EA6A 5B36A 1VQOP 2PS3A 2HR1A 3DLAA 3VMIA 4YONB 1YDFA 1K8A2 4RZ2A 3B5NB 1TUEA 1YR1A 4EG1A 3PHHA 1PGNA 1I6WA 4I8DA 1AQYA 4HDSB 3UOWA 3FQMA 1Q3TA 2VHZA 3KCNA 3MRVA 2GZHA 4QQFA 4UEOA 4BU0A 3FPJA 2RHJA 2WYUA 1JNXX 2BFDB 4OU5A 2UUAB 1M10A 1T2EA 2YADA 5HF9A 5JBIA 2OXTA 5AVZB 4UB6H 2I1LA 2P0EA 3HZRA 1C1XA 1W47A 4MZXA 2YJGA 2POHA 3RHZA 4RVHA 1JKJB 3GF4A 1QRSA 1Y34E 2OY0A 3V2RA 4KXLA 2PLFA 2XIQA 4PZLA 4XR4A 1JIKA 1G9XA 2VZ0A 5HIIA 4E7PA 3VMYA 3U80A 1BX0A 1WPQA 1YMUA 4AZ0B 4EMBA 2C54A 1P6XA 2I2BA 3L4SO 4LMAA 2PUHA 2ORED 3CZMA 3CX5E 1YQUA 3K9BA 3L70J 1V7CA 1D2MA 1GR1A 4TV9F 5GWXA 1O96A 5J5VA 3CTPA 4E88A 5IM5A 1L1QA 1R50A 2FLWA 4ZOEA 5CAEB 5FFFA 3E9CA 3KUKA 5KDLA 3E9ZA 1BXRA 3ZQUA 2BFDA 2UVPA 1JMKC 1I4DD 2CLLB 2ZXFA 4NNPA 1ZCZA 4CHTA 5CT6A 1GIAA 4HS4A 5IT9b 1LPAB 3FDIA 3MWJA 2GD6A 3PCTA 2PJUA 4C4AA 1T9DA 2HBYA 1S2OA 4DAOA 5B3LA 4MARA 3B5NA 2QNRA 1JS1X 2BRUA 2WM2A 4MK4A 2X2EA 5FTJA 1BXRB 4QULA 1RXUA 4DJEC 2OM6A 3RJMA 4OGWA 5KHAA 2QR2A 9ATCA 4P86A 4FYPA 5JNLA 3N2ZB 3V7WA 1OYWA 3TNLA 3D6NB 3QF7A 3SPXA 1NVWQ 1NVDA 2Q7OE 3H3VJ 3HCAA 4EYSA 3GDOA 5AW5B 1JKMA 2BC9A 2X8JB 2EW1A 4KN8A 3L7LA 3WP0A 1PPJE 2DSNA 4CR6A 4RFSB 1AA6A 4PFKA 4Z49A 2NYUA 1DCMA 3QP9A 3KQNA 5KLVJ 1QMPA 2ZJZA 5BURA 2O1KA 2NQTA 2KBEA 1ECFA 1BNCA 1M1XB 2IELA 1BFKA 2O2ZA 2JFOA 3L02A 4EYOA 3BPSA 5G02A 1NR5A 4EHJA 1SJ9A 2EHJA 4K9QA 4ENTA 2W2KA 5HX7A 4Q7EA 4XQ9A 4DLTA 4HD8A 1VCOA 4AYXA 4YCSA 1F1BA 1Z7EA 1RLIA 2CFTA 3Q3VA 5YASA 4BNYA 3DDZX 4Y99B 1NPYA 1U0RA 1TKCA 2C2BA 3CONA 3NX4A 4UAVA 1C50A 2FN3A 3GWGA 1PE0A 1JG4A 3S29A 3TGLA 4UNNA 5HNKA 1WR8A 2HJHA 2OBMA 1KL7A 3B1WA 3H8JA 3JVIA 2VR1A 3NWPA 2F2TA 3D4BA 3QMPA 1MIOA 4KACA 5FHRA 5EJ7A 2WY2D 4FZJA 5TPWB 4DG5A 5CK4A 5E0OA 2R11A 4DNPA 5KNCH 4M0DA 4FEYA 5DGHA 1BRTA 1I5EA 5EPUA 4BMXA 1E89A 1GDTA 2UKDA 2OYSA 4NCXA 3AU8A 2HDHA 4MV4A 4H1UA 2KZIA 1K8AQ 1W1WA 2K88A 3NOXA 1GTSA 3G4S1 4C7MA 2BFFB 2YFQA 3KBBA 3OZIA 4FWTA 2V8JA 4CIBA 1K4MA 3M1LA 2IH2A 3FNFA 2WSFH 1QF6A 2SKDA 1GLGA 1NLMA 1XJ5A 3I8OA 4EW1A 5ER9A 1OASA 3MAAC 4E14A 5IDXA 5IWAB 3BG5A 2QD2A 3T4UA 3TS1A 4HLDA 4WBNF 2G5PA 2YU9A 4D9FA 2H31A 2HNBA 1V9CA 3LI2A 1UZMA 4ZWNA 4HAYA 3BWXA 4LC1A 3DE3X 4TL7A 1SZJG 3CF0A 1RADA 3PIDA 2DH5A 3TD2A 4V24A 3EHDA 2NPSC 4MGYR 4P81A 4X44A 3WADA 2HY7A 4CL3A 1MD9A 4BVJA 4L50A 1BSHA 1FQKA 4OBBA 1XUOA 1FW6A 1F2TA 4JIMA 3G2KA 4DUYB 3FI9A 3RARA 2H5LA 3HE4A 1WV0A 3KEFA 3VU9B 4CKBB 2OO3A 2B99A 5T4FA 2PUJA 4MI1A 3M6IA 3A9CA 1HE2A 1VPLA 5LIPA 5FRDA 2QUZA 2E2HI 3B5NC 1IZNB 1RH5B 2A9QA 2DHDA 4P98A 4F06A 1N5KA 4Z5XA 1KIAA 4JX8A 3CXHE 4J3JA 4L2IA 3T12A 4CXMA 3UJNA 3WI7A 4F4FA 3VR5H 4QDOA 1CUDA 2QVGA 4L6IA 5DGDA 1FUIA 1DRWA 3B2NA 3GJXC 3IAHA 3W2TA 4PN7A 1VLQA 1U7HA 4BGVA 1A9XB 3UC5A 5IJZA 4ZVNA 2IIQA 2DLDA 1ISIA 4F5YA 2E1PA 4ZZIA 1NU1G 2NU7A 2NZVG 2J9YB 1SFRA 3C5EA 1N7IA 2JAWA 4NV1A 5CIWA 4MRMB 1WHTA 3CLTD 3ZDXB 2QRPA 4X8OA 4DYDA 4WZBA 4XUEA 4TNUA 1LSSA 1HGXA 1R9JA 3JYHA 3GHGB 5C53B 2RK6A 1JDZA 1VQM1 2MINB 1PRYA 3HOZI 4M99A 3IVCA 1YJN1 4YO8A 4QUDA 4FW9A 4RK6A 5DK6A 4GOOD 1DCFA 5E3JA 1MC1A 1JDJA 3H1IG 4BUZA 1VPDA 1EWQA 2VOJA 1BCCE 1A2OA 2W43A 1M1JB 3NT4A 3PP8A 4G0YA 4P38A 4UAJA 4EHIA 3M9XA 3AX6A 3IE0A 3FF1A 1W44A 4J4TA 1SULA 5B2FA 4PD4I 2IEIA 1QUFA 1ZPDA 2AMYA 2GN9A 4GOXA 4N6OA 4RQBA 2VQDA 3B9RA 2XDAA 3AF0A 3WLMA 4AURA 4EA7A 1V48A 4X3PA 5DPMA 1DKPA 2OXRA 3GNTA 3LSTA 5TQ2A 3UT0A 4MWEA 5IEBA 1SOWA 1XE3A 3KPWA 5U1PA 4A6DA 4CMIA 3A3YB 3AETA 1R4NB 5FOTA 5LDHA 4U00A 3BEDA 3CO0S 1Q22A 3U62A 3LGXA 1J2JB 1CY7A 2DWUA 1LTBC 1WEKA 1FU7A 3M3HA 1TWHI 4HEA1 5D1HA 1HJBA 1ZSVA 3TJRA 4DEXA 4OHPA 2WG0A 2ZIGA 5EJ4A 1B23P 1X87A 2RIPA 2BUCA 3DBLA 3ZUGA 1EXDA 2E75C 1I2AA 3GJ7A 1UK7A 1BCSA 5TT0A 5AUOB 4YUVA 1XEWY 2A5JA 3PLXB 1VPEA 4I4NA 5AESA 3VH3A 1ZOOA 1KDRA 2ZI9A 4ZHQB 1JU3A 3I64A 2FSIA 1KSJA 1LVHA 1NJGA 1YGPA 3EG5A 5FUBA 3ST7A 2DQ4A 5DM1A 1Y6JA 4ANFA 1U4SA 4JEHA 5DNEA 5KTPA 1DKMA 4G5RA 4KKVA 4DJDC 1SQPG 3D7SA 2BMWA 2HYDA 1CQJB 3P8ZA 4FC6A 4C76A 4YAUA 2ZJ0A 4XUGB 4CUJA 1YJ5A 3FHJA 3ZE0B 1M1K1 3LBNA 3ETEA 2QWXA 4FILA 4MKZA 5HMLA 2IKQA 2VDOB 4HTFA 4ZT7A 1JFLA 5MGNA 3ESBA 3T4NB 3IELA 2ZGVA 1K9M2 4BY7I 2W70A 1CW5A 1LKZA 3PF8A 4KQ2A 2G4LA 3DOFA 1TQDA 2OGSA 2B5OA 1FC2C 3KUXA 1UFOA 4ZAXA 3LHSA 1WO8A 5K05A 3CZAA 4Q1FA 1K8QA 2FUG6 5HOQA 5LQKA 2NMVA 3D0QA 3HKEA 4LXTA 4TPKA 2TMDA 2UU9B 2P3QA 2A69D 3N2EA 2FW7A 3Q5PA 2V3VA 2ZWAA 4KIUA 1XA3A 1AK9A 1VKRA 2P65A 4W6QA 1FL9A 4Y98A 1N8TA 3M70A 3TYXA 1BDIA 2BDUA 5B3JA 3AR4A 4GD3Q 1FFXA 1Z82A 2CNKA 2FPXA 2J9FB 4N7RA 4XTRA 3WTBA 1MEJA 4EJSC 3W6PA 3LRXA 2V9CA 4CQMD 2OLEA 2PEZA 1SQ6A 1VE1A 2PQMA 2ZAIA 1UWKA 3DVSX 4JLVA 4AUWA 5F23A 3PKJA 2QHXA 3Q3JB 1XN1A 3MMZA 4GRDA 4MMZB 4BDSA 3KZCA 4MMXB 1P33A 1J25A 4CF3A 2PUFA 3N6RA 2P77A 4RL4A 3MJHA 5DTRA 3WKBA 3OVMA 3AEYA 4IDCA 3PNSA 3IPCA 4GP9A 4X1KA 4GNKA 1QSGA 2Q1XA 1DRKA 1EK0A 1R6DA 5TR9A 2B21A 3SQMA 2HF7A 1LNQA 3MCVA 1ABFA 4M9RA 4L0QA 1N32B 1KJWA 2F7SA 3O4FA 4Q6BA 2CVHA 1R9TA 1EE1A 3GJRA 2PUDA 3A25A 1K73Q 1UPUA 1KEUA 3TXYA 1UEIA 3JALA 4UUAA 3W9SA 4CMEA 5WRFA 1XMSA 4O2AB 5FORA 3Q3DA 3MHVA 3O26A 3PR1A 4WXMA 4RSMA 3S5JA 4TN1A 1GLNA 1OFGA 5FLXA 1TAQA 1ZFNA 1HFKA 1WEHA 3HNRA 1GM5A 4B3MB 1YIDA 2HQOA 2MTBA 2KNCA 2F8MA 3S1LA 3EWSA 4FGWA 3BH6A 4X65B 1KEVA 3EBPA 4FONA 3C4VA 4OGLA 2YY5A 4QU0A 3ULKA 5REQA 2CXUA 1W2BO 1T0BA 2YW9A 3C5WP 3MFYA 3NBQA 1IPFA 2CFCA 2FX3A 3N7UA 4UBIA 2PS0A 4UUBA 3VNAA 2HU8A 1LI5A 5CFOA 3U19A 5BR7A 4EO4A 4NECA 3ZS9A 3CWCA 1YCDA 3MB8A 3CSSA 2J3IA 4MDHA 2YDYA 1LK0A 3R5SA 5ALOA 3FZEA 1QTQA 5LL6f 1N7JA 1TF5A 4OJTA 4AJEA 3BZWA 4XGQA 5CH3A 4X1KB 5EYPA 3R1IA 1S96A 2CEAA 1CIVA 2HDWA 2AXEA 5KOHA 1KU6A 1MCZA 5CLFA 3Q8WA 2O8FA 1X7YB 3TM5A 1L4YA 5TMPA 1OVUA 1ZVQA 3QVVA 3ZDDA 3NTNA 3HCRA 5BSUA 3VYSB 1E5WA 2K7ZA 3OSZA 5E3IA 4D98A 4TKVA 1B73A 2FN8A 3QPDA 5IF3A 2FWRA 4OWFA 1XDWA 2R6DA 4JENA 2NYAA 2J6IA 1EM8B 2O2SA 1RPZA 2DCUA 2ZIAA 1CZLA 3RC1A 3P0HA 1L7BA 1G291 3NGXA 4H4EA 3L8GA 4WINA 1ZC1A 1NVXQ 2R87A 3R3UA 1TA0A 2ECPA 1N77A 4RMNA 4YMGA 3AP3A 3IBCA 1CB7A 5DE3A 2UZAA 2OFPA 1MV5A 4E03A 3W68A 2F4OA 1F4PA 1KILB 4L57A 3SYLA 5SZKB 1U7WA 4IOLA 5DWVA 4AUKA 5J47A 3CXCY 5KTKA 4RH3A 1J8DA 2WSIA 1Y1VA 3AVPA 4AT1A 3L7NA 3GTQA 4FYHA 3TAXA 2O0HA 1C3EA 4HBGA 1CSBA 2IOFK 3E15A 2GKGA 1YS7A 1YTZI 2VRCA 2YL2A 3HFRA 1NXXA 2KBFA 2ZRCA 2XCIA 2JEEA 2OPHA 1KJIA 1N1EA 1ZOSA 2H5JA 2R65A 4C08A 2PRSA 821PA 2JLZA 1Q91A 4RPCA 3NFYA 2CXTA 1T5TA 1M2NA 1WUTA 1XF9A 1C3JA 2J9FA 2J3QA 4WNIA 2HN9A 1I50A 4AJ2A 1XC7A 1N75A 1COWD 4NPAA 1SU4A 1ZK2A 2LRHA 4O4HA 4WI1A 5BSFA 1T3ZA 1M83A 2XEXA 5IJ9A 5HIMA 5KVAA 3OHMA 3VHLB 2LE0A 4XAQA 3RL0B 3OOWA 3KZVA 2PX6A 2N9BA 1A77A 1TA4A 3O4RA 2FZWA 3LP8A 4TSFA 5DKFA 2JVKA 3E8XA 3ZVLA 3NQ41 1Z03A 3O03A 2YHUA 3S1AB 2QAGB 4W8OA 4B4VA 3Q9SA 1KMHA 1R8XA 5ADWA 4Q01A 1EWTA 4M8IA 2JA2A 3IA2A 3ZZMA 5KJFA 3SAJA 4LYHA 1P1FA 2UZ1A 3UC9A 2PZLA 2ZATA 2Z09A 4CHGA 2XB4A 3VC2A 3A3KA 3EAFA 2GBCA 2GEFA 2Q4ZA 2J33A 3C48A 1NNLA 3OFNA 2JH8A 4IEFB 1R6VA 5BSHA 2QMEA 5KTTA 1OD6A 2LIVA 3T3HA 2ZUUA 1HH0A 2LXCB 4E08A 1H3EA 3G1WA 2EZ9A 1BTOA 1BU8A 1CUHA 2CJXA 1A98A 1KDOA 3LT5A 1FYVA 3LVFO 1P2DA 1VBFA 2OSVA 4XB2A 3H4TA 5I45A 4LGCA 4GKBA 3EXIB 3TLEA 3TUJC 1PV4A 1XTUA 2VBIA 2RDMA 4RAQA 5AI8A 3CNEA 5TV2A 1JH8A 2GYWA 5BUZA 3UM9A 3JQ8B 1K92A 4DC1A 3G9QA 3BG0B 4QEKA 2JAPA 3V5BA 4HGNA 1Q17A 4XPZA 3L4KA 1U9ZA 4TMYA 2V7QA 3CL3D 1OFCX 2C9LY 1U0OC 4BZQA 4KXNA 3I2FA 1J2TA 3L75J 1O5IA 3D2BA 2I6XA 2IWRA 3GTQI 1S7GA 1B2LA 3VPGA 2ZZNA 3IBTA 4X1OA 3ZKWA 1Y1VI 3JQQA 1Q3HA 3PXBA 4FMCB 1Y47A 3OUTA 4I6GA 4PVDA 2GKOA 4YRPA 4YCJA 2IV7A 2HF8A 1QC5A 3DUFB 3AOEC 4RFLA 1T6BY 2Z5IA 4GLJA 2P7JA 4J0CA 1VE7A 3U1BA 3WO1A 5EZ5A 1W75A 2LV8A 4ZDKA 4WKOA 2Y0PA 5HTOA 1JY3P 4UAUA 2JKZA 4L2IB 2YRWA 4TTRA 5AHKA 3UW1A 4EGJA 5A71A 1N73B 2Q0SA 1DO2A 3PHIA 1RHKA 4YDHB 2ZM5A 4OUDA 4YIKA 3A37A 1EJBA 1KTIA 1L7MA 3MTGA 5D3MA 4K8OA 3QVJA 4HADA 4ROTA 4QBTA 4OAOA 3K94A 5AI9A 3ZDQA 5LB2A 4DVJA 3BYZA 4BRZA 4C88A 4PGAA 3CZBA 2C7QA 1JAZA 2XNHA 4XJSA 2JLUA 4IJVA 5KCMA 2GCEA 3L7AA 4O5AA 3GLFB 2FW1A 1GAEO 3HU2A 5F3RA 1LTJA 1A2BA 2XMCA 3OQHA 4HDRA 3AKZA 3RB8A 3PVSA 3D8HA 1I3OA 1PV2A 1Z62A 2PVSA 4MW5A 4N5NA 4ZVLA 2AMLA 1EA5A 2I80A 2JLSA 5ULLA 2DPMA 3DGFC 3EA0A 4BS9A 6PFKA 1DSSG 3Q5SA 1DCKA 3DBVO 3TBHA 1W19A 3QJGA 4WZ6A 5EA2A 3EFEA 3NORA 3L7DA 4G1UC 1S3SA 2JIPA 1OBOA 2VWHA 3SFTA 4CZ2A 1N92A 2RHBA 2C5BA 3EASA 1STOA 3M82A 1LF5A 2V4HA 5AI0A 1EG2A 1L5FA 1U5BB 1U7XA 2RJNA 3IA7A 4I2NA 4NBLA 4R1MA 4YRRA 3VKWA 3Q7TA 4ER0A 3HVKA 4J1TC 5LXTB 2WVHA 3FW1A 3PC4A 4D9GA 2P8SA 1PFGA 4ZC8A 8ATCA 4B3XA 4O4IF 1KA9H 1G5RA 4UMVA 5HKKA 1KI2A 2NQ2C 4JBHA 3B71A 4CKBA 1DBQA 2Q5CA 3H2KA 2YNYA 1OX3A 2NU9A 3MF4A 3I30X 3PGA1 3PK0A 5A0FA 4HQLA 1KZUB 1WB6A 4QICA 1E4VA 5F4BA 3X1ZA 1HQKA 1QJ4A 1JQBA 3ETDA 3NHJA 1CC1S 2HV9A 3I53A 1H3FA 5JCOC 1DOAA 4MULA 3SP1A 3T5AA 1EDKA 1DP4A 3I5AA 1VQNZ 2LR0A 4A8TA 5AXCA 2OBNA 3V7NA 1P84E 3HDHA 1AKRA 4A82A 1KO5A 5FXMA 1Z56A 4WE3A 4HAOA 3HXOA 1JZQA 1G5IA 3AG6A 4NFSA 3K9QO 2MCFA 4Z8XA 4HZUA 3CRRA 1RJDA 2BEZF 1WJGA 5IAOA 1DTEA 1E3TA 1E60A 4KXUA 4Q39A 4WFIA 4EI7A 1W93A 3OQNA 5EFWB 3GQVA 4P3OA 4RFSA 5HK9A 3AEXA 4YGYA 1GL2B 5AVVB 2PUVA 3CUEF 4IF6A 4E09A 3UMRA 5A4AA 3F0TA 2XMPA 4HYTB 2SKCA 4Q4DA 1MB0A 3P2KA 3UAWA 5H81A 5A2GA 4EGAA 3P94A 3AFHA 1L2PA 5A9RA 3A5TA 1KFMA 1MKYA 1NUSA 2E9SA 2ZTVA 3AB3A 1JWAB 1WTAA 3ASYA 2JATA 3BGVA 3OPXA 3Q1KA 3DZFA 4UUOA 3ZNNA 4DR5B 3AIMA 1FS4A 3ITDA 1IJBA 2VQ6A 1NDQA 1ZEJA 3I12A 1M2VA 3ZDYB 1I24A 5TY0A 4COKA 4DR1B 3OEEA 3HNPA 3RAFC 4OGGA 1SCBA 1FZEA 4NJMB 5DLDA 3K53A 1WZCA 4FYMA 2GK4A 1HQYE 1UMKA 2JAQA 2O8VA 2Q45A 1Q1GA 1QYVA 2JEOA 1KDVA 1ONOA 2IBMA 2PKQP 1NWQA 1LRKA 3GD7A 4BKOA 3NRBA 5K3AA 1RO4A 3HOXI 4CMCA 1D2HA 2UVPB 2V6BA 1I6LA 1RIFA 1RQUA 4DOJA 5LBIA 2K9JB 2OG2A 3Q5EA 3R7NA 3ZNQA 5FLXb 1GCGA 3QLUC 1KWKA 3TG8A 1YA4A 1M57D 4OQQA 3GLHA 4EGSA 4M1YA 1BEUB 4C2BA 2VYND 4FJ1A 1ZN5A 1X1DA 3CCMZ 1ZGAA 2Y92A 1K83A 3GVCA 1P29A 1VLVA 5JC1A 5L3QA 5M2QA 3KOZA 4DOMA 3J81k 1JG3A 2GNAA 5JFGA 3CM0A 4JBLA 3R75A 1GPYA 1P3JA 1FP4A 2VNAA 4U9HS 5A4JA 5DW0A 3D7KA 4BYMA 5JIBA 4M8KA 5FBRB 3N86A 3DOCA 3BRTB 4TTTS 4EI2A 1O54A 3PNLA 2E74C 4HDNA 3V8EA 4CM4A 4CQMA 1TVMA 2PUBA 5A2Qf 3JQ9A 1M73E 4ZC1A 3V33A 5CMZA 2WUFA 4GYKA 3A1DA 4KHZA 4M55A 5EKDA 3VOAA 2QREB 2R5BA 4FNMA 2XZLA 4M2LA 1T8SA 2WTMA 3OP1A 3ZWNA 4MR9A 1K7YA 1Y98A 2Y9YA 1FJKA 2XSZD 1HL3A 4HDSA 1TRKA 2IWHA 1BE8A 1XJWA 1IM5A 1EZ4A 5CM9C 3TLGB 1KS9A 3NPMA 4BQSA 3H1HD 1QQ5A 4IHQA 3CXHI 2WD9A 2J5XA 1KYIA 4HMPA 1FDTA 4I9NA 4JDPA 1BVHA 4DA7A 3QGMA 2FJ0A 1WXWA 1SQQK 1WMAA 1O96B 3COYA 2D0IA 2OE2A 4GG1A 1W5CE 4I0WB 2TMGA 2WJ6A 4NS1A 1QS0B 2BBSA 2VDKB 3PJEA 3GPDG 2L5GB 4ND7A 4BB5A 2QJYB 4QQNA 4CDNA 4XD7D 2IU6A 4GIFA 1DAEA 1DTWA 4RGBA 4UHFA 2V6MA 1ZB9A 2BGIA 3CLRC 3K0EA 3BFVA 4RKRA 3TPFA 2PT5A 4EYYQ 5J23A 2EL9A 1Z5GA 1OXZA 3IBYA 1NU1E 1UXHA 2VJYA 4Q34A 4RJIA 4X24A 4CM8A 3J80b 3EGDA 5JQGB 1T4GA 3BE8A 3I6YA 3PCXA 1TEZA 1B1AA 3FDXA 4G0QA 1SFOI 1V5EA 4D9EA 2W93A 2WP8J 3J7TA 4D0GA 3HWSA 1LDNA 4RACA 3TQRA 1ZM7A 3CMEZ 5KLVE 1PPJD 1E1RD 3GAFA 3IBGA 1ZX1A 4QJIA 3AINA 2ZYVX 2ZIVB 4QHSA 4TLDA 1ZXGA 4POOA 1H2HA 4JODA 3L05A 2FXOA 3SZMA 2YVAA 4P54A 2Z0MA 5TISE 1H2BA 2Z9CA 2BOVA 3S2SA 1R3DA 4A2QA 4DBZA 4DT1B 3MILA 2ZJ2A 1GL2D 3DKPA 4ML3A 1OZGA 4P3KA 4EFMA 1GZ6A 4ASUD 2AOTB 1QHXA 4R3WA 3P5SA 3C1OA 1UL1X 1B8UA 2JZNA 4WY4A 3B6KA 2GPBA 5AR1A 5A2QA 5IK2D 5FTLA 1V1RA 4CL1A 3T99A 4BMVA 3DEIA 1FS5A 3FSJX 4TX1A 6YASA 5DCWA 2H2IA 3R9IA 4AF7A 2V45A 4UUMA 4GSKA 4HH0A 5F2EA 3MUOA 4JCWA 2VPIA 3NONA 5DMHA 4G0ZA 3F78A 4AJ1A 1QR2A 3J7AC 4IFBA 5KHOC 3ODPA 4G6ZA 2GPSA 2IIBA 3F3YA 3OQJA 2VCHA 4GGPA 2A68D 1EX1A 2OHIA 4P7BA 2JFHA 4AYBA 3M4OI 2TSYB 3K1JA 3LGSA 3CPWZ 4JOBA 2JLWA 1XYGA 4YCNA 4D4HA 4RKEA 4CLRA 5DHSA 2DE7A 3IQXA 3FKJA 2GFHA 4RHYA 1S5LX 3THXA 4WLEA 2I1QA 3BAFA 1IFIA 1SELA 5J4KA 5JTTA 3A6JA 4CEHB 2A5FA 4YMIA 4K9KA 3P71T 4A6PA 1UIXA 3CGGA 2ONZA 2IOFA 2M6SA 3EGVA 3D8BA 5JBQA 5JZVA 4AAYA 1TZBA 2FSHA 4Y6RA 2WT4A 4LAFA 1I2DA 3GJ4A 2VXYA 3DAYA 2NW6A 3RUIA 4HYTA 4L5JA 3UYKA 1AQ5A 3R20A 4PZEA 1O4WA 2ZR8A 3NAGA 5IT9f 5DTEA 5AIBA 3D8RA 1YNOA 3UMGA 4XM2A 3U3MA 3WWEA 2FXPA 3X2GA 5DLPA 5EUCA 5EP2A 2VNSA 3CVOA 1GT91 2C94A 2X5XA 2QE7A 3QKRB 1M6VA 4FHGA 4WFJA 1ORHA 2IYNA 1NRWA 4BAUA 1XPRA 3S68A 2F4VB 4UC0A 1GG8A 1IEVA 5A9SA 3MOSA 4N7MA 2FBWC 2ODBA 2C7GA 3ANTA 3OOYA 3QW4B 4NRDA 1ZN9A 2GA9A 2QMYA 2I4OA 3JTEA 1E9RA 5DMXA 3U9TA 5KZMB 3EGEA 5HSGA 1NVGA 3ABVC 1REQB 1Z38A 2OMKA 3FNIA 4R4JA 1N2OA 1WUHS 3B2QA 4XIJA 1JG1A 4JDUA 3V42A 3ZDEA 4BQPA 4UHBA 2NU9B 2E6UX 4KL8S 1PQWA 5FO0A 5CFMA 4NBAA 2JIZD 1HDRA 5EPOA 2WJGA 1H2YA 6ABPA 1KY2A 3JC22 1ZW6A 1WKCA 4O2AF 3KUDA 2QYOA 1FZQA 2R8ZA 3DDWA 1J5EB 1YVDA 1N5RA 2F1HA 1ESDA 3SYKA 5HJEA 5L53A 3HN2A 1WE2A 3MHTA 4F5WA 1YZYA 4JX9A 1X9VA 3BICA 1JWBB 4OYYA 3UV7A 4C0AC 4YUAA 3RVNA 3C6MA 1S02A 3ZU5A 4AY3A 2DLNA 1U2GC 1OFTA 2VTEA 2C59A 2O6LA 1XTRA 1IXZA 5B2EA 3HXTA 1T36A 3PFCA 1OCEA 2XYPA 3VSCA 3N0VA 2VP2A 3DOEA 5JZ9A 3I551 4LZZA 1UOOA 2H9YA 4RMGA 1CIPA 1QCYA 2D3WA 4YJ2A 1A4XA 1XCBA 5CVDA 2V8KA 1ZR2A 5T4BA 2QRMA 3BUSA 5KYKA 3CLTC 1Z06A 3PA6A 3G1UA 3LNTA 3GARA 3SXJA 1O94D 1YS6A 3BCHA 4NYJQ 4KFRA 1R4AA 1CUVA 2OILA 4PCAA 1X0TA 5KYYB 3LOQA 4CU2A 4OTZA 1QH8A 4GBMA 2V7QH 1II0A 1ADCA 4FEAA 1ZYRD 4INJA 3BTSA 5A9TA 4ZJZA 4G4GA 4YJ3B 2HMSA 1QGAA 4ZOAA 5IFLA 2PP6A 3CC2Z 4GZMA 4HAZA 1RPAA 1UPTA 1DELA 1XEXB 2AG8A 3DNMA 1C7IA 1OLSA 1BVRA 1B8VA 3NBXX 4AJNA 2ORVA 1MU0A 3B1JA 3GW8A 3H05A 3IGFA 2HA6A 3UJ6A 4QJ5A 4Q1AA 1TUGA 4QEZA 1QOPB 1W5BA 3RTAA 4H59A 1KPIA 3FYHA 4O08A 5CITA 3B9QA 1HFJA 2BMVA 5EE3A 5MN6A 1MA3A 3GCGA 1YDGA 4KUGA 1KK0A 2FR0A 3CUWA 3R2JA 5AJXA 5G0UA 1IBMB 1SHUX 1U0BB 3M9HA 3COVA 2QMOA 2DT5A 3DMDA 4L5BA 3RUHA 3F3SA 3PUXA 3I61A 3JSXA 4M9CA 4DILA 3UGJA 3DF9A 1SCIA 3KELA 3OZXA 3RVBA 3NP7A 3O8CA 3DXXA 3DL4A 3NS7A 3PXGA 4AKEA 1JXAA 2QR3A 3B9BA 4NAVA 4UVGA 3SDSA 4MRIA 3X2PA 4Z2YA 2H2GA 3CKYA 3PENA 2NU6A 3QV1A 1N2IA 1LPSA 2YVKA 3QELA 4QFMA 3EARA 5JJIA 2JGKA 4FB4A 1FJHA 2FQXA 4ZU1X 3GNSA 5BYJA 3EVNA 5TXGA 2PGAA 3UYLA 1PPJG 3E5MA 3Q9LA 4JGGA 2MWMA 1DC3A 1A7AA 3D6TB 3DBHB 3GTGI 2BT4A 4KVGA 4IINA 4MV3A 3N2GB 1RLJA 3ZZUA 4YRSA 2WFLB 2C82A 4TRNA 2PJJA 2MSCB 2XQFA 4G1VA 3ONWA 3K8YA 3ESQA 3QK7A 5FULA 1YQ4C 2I1VB 3WV5A 4CT4B 3OJLA 2Y1KA 4JS0A 1FQJA 1RD4A 4M8SA 4N7JA 1OFHA 1TQ8A 2GD2A 5I7OA 3ZE6A 1ZHFA 3OJAB 1Z36A 2BKAA 4FOTA 4EY8A 2IBSA 2NPSA 3L70E 1XNGA 2W98A 3HKBB 3HRIA 3QF4B 5DHUA 1NP6A 3TKLA 4W5TA 1EX7A 3V46A 1XZAA 1GKYA 2B4KA 3VJKA 4B87A 4OQMA 2M6LA 2OD9A 3PICA 3VYVA 1L4FA