1G41A

Crystal structure of hslu haemophilus influenzae
Total Genus 116
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
116
sequence length
443
structure length
334
Chain Sequence
SEMTPREIVSELDQHIIGQADAKRAVAIALRNRWRRMQLQEPLRHEVTPKNILMIGPTGVGKTEIARRLAKLANAPFIKVEATKFTVGKEVDSIIRDLTDSAMKLVRQQEIAKNRLIDDEAAKLINPEELKQKAIDAVEQNGIVFIDEIDKICKKGEYSGADVSREGVQRDLLPLVEGSTVSTKHGMVKTDHILFIASGAFQVARPSDLIPELQGRLPIRVELTALSAADFERILTEPHASLTEQYKALMATEGVNIAFTTDAVKKIAEAAFRVNEKTENIGARRLHTVMERLMDKISFSASDMNGQTVNIDAAYVADALGEVVENEDLSRFIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT SHOCK PROTEIN HSLU
publication title Structure of Haemophilus influenzae HslU protein in crystals with one-dimensional disorder twinning.
pubmed doi rcsb
source organism Haemophilus influenzae
molecule tags Chaperone
total genus 116
structure length 334
sequence length 443
ec nomenclature
pdb deposition date 2000-10-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00004 AAA ATPase family associated with various cellular activities (AAA)
A PF07724 AAA_2 AAA domain (Cdc48 subfamily)
A PF10431 ClpB_D2-small C-terminal, D2-small domain, of ClpB protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 1g41A02
1.10.8.60 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 Helicase, Ruva Protein; domain 3 1g41A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g41A01
2G1KA 1XNJA 2PEZA 4G5RA 1LY1A 2FSHA 2R6CA 3RYTC 3QEJA 3QPVA 3FYHA 4M9SA 3LW7A 2YINC 5FUWA 2ZETA 1FMLA 4AKGA 1R6BX 4RD4A 5JSZA 1ETUA 5CK5A 1UBFA 3AVVA 2D2EA 5HPYB 121PA 2A5GA 3I1FA 4M9QA 2Z5FA 3QENA 5D3MB 2QY9A 1XCGB 1TQ6A 4LHYA 2ZTCA 1IN6A 1DEKA 4YDSA 2CE7A 2JZ0A 1NLZA 2JJ1D 4ZPXA 4WBSA 1T8UA 2A3RA 4LGMA 4LJ7A 1OKKD 4RSGA 5E4FA 4B3BA 1XMVA 3JVUA 4EAQA 1RRPA 1ZAKA 4B2LA 3FRHA 1SVKA 3K0EA 3OIUA 3PV0A 3GLGA 1J99A 4OI2A 5DHAA 3LCUA 4CVNA 2XB4A 1N5IA 4ZI2A 3AM1A 4R71A 5GJBA 4YMSA 3AH8A 1GO5A 4KYIB 1Z5ZA 4XTRA 5LB4A 4JLAA 1JEEA 1NY5A 1UEIA 1Z0DA 4KLNA 1XEWX 1WDTA 3A36A 1OKSA 1A5TA 1OFUX 3PEVA 4A92A 4A15A 2OOBA 5BQ5A 1NBMA 4D2IA 1GTVA 2DWPA 1VG1A 2F43B 2GBLA 2PT5A 5DNYB 1Q1QA 4KFSA 1XMJA 3BB3A 4HLQB 5EXXA 2K0BX 2YZ2A 3JZAA 1KDPA 3EAQA 1JQJC 3L8ZA 2OHFA 3DDCA 4LZZA 2OCAA 4US2R 5KSYA 2DAMA 2G0NA 4LBWA 1TQDA 1B0UA 1DBSA 4EPXA 1H8EA 4TTRA 4Q9LA 1GNQA 4S35A 3AVXA 3Q7QA 1ZCAA 3BAFA 4MRSA 3WY9A 4BASA 1KKMA 1OXVA 2ZR7A 1DS6A 4JMPA 3BIFA 2NO9A 1CR1A 4LSGA 3QF4B 4CW7A 4O3MA 2VP4A 4NCHA 2ZE6A 1T0JB 2TMKA 5KNDA 3HPQA 5G40A 4DVGA 3P32A 2GESA 4Q02A 3U6BA 2JLYA 3U7GA 1WXQA 3AQ4A 1OFHA 1E9RA 1OV4A 1Q12A 4W7SA 3DKVA 1L8QA 5C46F 3B8HA 4FCVA 1XTRA 1EG7A 1YLAA 1OPXA 1SVWA 4MYUA 4UJ3A 3WNDA 3T12A 5CDFE 5JFGA 2WWYA 4URZR 1MOZA 4LJYA 4BE7B 4LJAA 2JP7A 2G1JA 2IX3A 2L4FA 2PH1A 2IBMA 3CF6R 4HUTA 4DXAA 2XNDD 5CDFA 2BBOA 1GUAA 1MO5A 1EWQA 1GRRA 1G21E 1LF0A 1US8B 4GMXA 2EWVA 4IOJA 3NC0C 1W2HA 4XSHA 2L4EA 2OFWA 2PCLA 3CKLA 4A2PA 4MRVA 3OESA 3THWA 4MGZR 2JNHA 2C9OA 1DAFA 2IW3A 1DTSA 5TB5A 2QROA 1XZPA 5D3QA 1BVSA 3RANA 3U60B 4MKFA 4P4SA 2J1LA 1W0JD 2GAAA 2K9DA 4IVRA 2A2ZA 1VQ1A 3CZQA 3KXKA 1VEKA 5FPHA 1XJQA 2XTNA 2ZSDA 2OCPA 3UMFA 4W5JA 4QBFA 5DI3A 4B6EA 2ZI9A 4Z51A 3TGPA 5AR1A 3KXIA 3QXSA 3CWQA 2AR7A 1K8RA 2O8EB 2DAEA 3RWOA 2PZEA 4XVUA 3U7FB 1AN0A 1CF4A 1MO3A 4IOLA 2VHTA 2AFHE 2IYWA 2F1HA 3IO5A 2YWGA 4QHYA 3MHVC 4JT4A 5E7IA 4BUJA 1G8FA 3I3SR 1OF1A 4AY2A 1KNQA 2Z6VA 1YZGA 2QZ4A 3TRFA 5EE5B 1PV4A 2ZVQX 4DZZA 3RS3A 4GOJA 4NE2A 2C8VA 3SFVA 4QNRA 3GFTA 3NH9A 5H70A 2DI0A 2WJJA 4Q1EA 1KK0A 1YZQA 2XOKA 5FUXA 3A4LA 2V7QD 4YMVA 4ARZA 1MABA 4GNKA 1VIAA 2DFNA 3TUZC 2EFGA 2F1IA 3QIAA 2V7QA 3AF0A 3Q5EA 1P5ZB 4JIMA 4PC7A 4DSTA 5FTNA 1I2DA 2DFKB 4QHSA 4I1SA 5GJVC 5FH9A 1MABB 2G83A 1T6OA 4M2LA 3VQTA 1CRQA 3BWDD 1Z63A 2GK7A 4P4TA 1E1QD 1QHXA 2LKCA 2B92A 2MR9A 3OZXA 1GAJA 3MFYA 4PXAA 3GJ0A 2KBFA 3U6KA 1LTQA 4DHEA 1TAGA 5KDDA 4P4SB 2BDTA 3BK7A 4A8JA 1HE1C 1P73A 4DLVA 1SHZA 2C99A 2VSOA 2QP4A 2WKRA 5KTYA 4NYMQ 4TZ6A 2ONJA 1UEJA 4IKEA 1W5SA 1KO8A 4M22A 2MJ5B 3CX6A 2P5SA 2PLFA 2WJGA 3CRMA 5FTLA 3AUYA 1AK2A 3EWSA 3FVQA 1WA5A 4CIDA 4POAA 3K9NA 1JR6A 1U81A 3ADCA 4EJSA 3W6NA 1Z0JA 1D2EA 3TJZA 1KI4A 2CJWB 1XRJA 2QBYA 3AV0B 4Y0AA 4CEJA 4D26A 2JZ1A 3C14C 3O8BA 4E03A 2QNRA 3BB1A 4BLSA 4LI0A 4YMUA 2O8EA 1F5NA 2QEQA 2FFBA 4WXRA 5FBLB 3IHWA 4CF7A 1SKYE 2ASEA 3T1VA 1C1KA 1TUIA 3K0SA 1P3JA 1W44A 2XZLA 1G3RA 1Q1BA 4US0R 1N6OA 1EWRA 5L3QB 2VTKA 2X19A 2WJIA 2JGNA 2OXRA 2R62A 1GP2A 8OHMA 3GP8A 4RD3A 2XZPA 2I1QA 4NCIA 1L4UA 1P9WA 3QVUA 1G8GA 4Q4LA 3U7EB 3CW2A 2IUSA 2J0QA 1GWNA 4HEJA 4RCZA 2DZNB 1ZUHA 3ZVNA 4OKSA 3G82C 2ZI3A 3M6AA 4F2LA 4AG6A 3P1JA 4L9WA 3R20A 1U0LA 4PSVA 5CB6A 3UKDA 3GLIA 4JLNA 3U3OA 4D4KA 4LRTA 3W5IA 4XWOA 4F92B 4Q00A 3MD0A 4PX9A 1Z83A 2BEJA 1N5JA 4XVQA 3TNFA 4DEYA 5LPNA 4L4UA 2B8TA 5B58C 2NO7A 2GXQA 3AVWA 1G3QA 3GFOA 5KPDA 3R9IA 3TSZA 1V43A 3ICEA 4DUGD 1W0KD 3WYAA 4A6XA 1KDRA 2XNSA 3U3RA 3SN6A 6Q21A 5JECA 4JJKA 2GVDC 1YR6A 3MJRA 3FMPB 3PENA 3Q5DA 2ZI5A 3GD7A 1DADA 1EX7A 1ODFA 1HUQA 2WSSA 2FV8A 1KI6B 2WWXA 4PFSA 1OFIA 4KFRA 2FFHA 5DYGA 4DSNA 2AL7A 2Z0MA 2QAGC 4E5UA 5DSZA 1KYIA 3E70C 1H8HD 4L5BA 5EUQB 1ZINA 2I1VB 4EQ6B 1G7SA 3N2IA 3X2SA 1L7VC 2BWJA 2FEOA 4JL6A 5CM9C 4AWXA 4BZPA 1Z6TA 4FWIB 1UF9A 4BLQA 1OXUA 2LVAA 2JJ2D 3NHAA 4KVGA 5SZJA 2OILA 3RS2A 4OHYA 2B7CA 2RHDA 2VF7A 5H1YA 4WA7A 2VP9A 5EE0A 4X8HA 1Z8FA 1NV9A 1DG3A 3N2EA 1ZW6A 1NKTA 4HATA 3E5HA 3MWKA 2ODBA 1RYHA 2PMKA 3CM0A 1XX6A 3H1TA 1P6XA 1YZUA 2C78A 2HJGA 3LNCA 5UKDA 3OEEA 4C0AC 5AJYA 4HAVA 1QG4A 1KMHB 2WICA 2BKEA 4K46A 2ZYTX 1E94E 2JLZA 4G1UC 3FHTA 2BHRA 4Q03A 4C0LA 2GCOB 1ZC4A 4EFMA 1AQUA 2IYUA 1XF9A 3R7WA 1KSFX 2OESA 3VU9A 1KJWA 1XPUA 3EPKA 1VEJA 4JLBA 3AF1A 1HY3A 5JHHB 2ORWA 1JPJA 4YXWD 4P0TA 4V03A 2V6IA 5F9FA 1AS2A 4OHVA 5H8WA 4B75A 3GEIA 2IYVA 3HDTA 3IO3A 3CUEF 2BCGY 5FOSA 4LV8B 3B1ZA 4FMBB 2REXB 4PPNA 5FL7A 2QMEA 1BIFA 1Z0KA 1AM4D 3WNBA 4NONA 1H8ED 2PZFA 3QG5A 3DM9B 4DCVA 5HE8A 5L3SA 2Z43A 1TF7A 1XD9A 4MH0R 3U44A 1CP2A 3SE0A 2O8BB 1AKEA 4RD2A 2AK3A 5KSPA 2WMOB 1VCOA 1OKKA 1SGWA 5DN6A 3K0AB 4HDOB 1XBTA 2VH5R 3IPXA 3QG1A 3SEAA 3GPLA 4LHXA 1KI9A 1GNRA 2ZI6A 3F8TA 4Q21A 4URWR 4PHFA 2QRNA 4B3DA 1HTWA 1M74A 5J4KA 3IUYA 1G8YA 3CNOA 2ZYUX 3TR5A 3AF4A 4ZDKA 2QORA 2Z4RA 3RNLA 3ZZUA 1WE2A 4TMKA 5FBVB 1GL9B 1AJEA 2HCBA 5KHOC 4LHVA 3ZVMA 4FWTA 3DL0A 1BH2A 3TW4A 821PA 4DWJA 3ZJYA 2GDJA 1OXXK 1S96A 4KJZA 2H18A 1B23P 4R2HA 1OIXA 4JBXA 4TQAA 5BN3A 1ZD8A 2W2XA 2IWRA 4PR0A 4OK5A 1A2KC 2ZREA 3CO5A 3AKEA 4TL8A 2ZM5A 1U0HC 3R8FA 4PZYA 1N0VC 3SJAA 3WNCA 2WOJA 1C7YA 5CJ2A 1P4SA 1OH5A 2RGDA 3LV8A 3BC1A 4G5SA 4JBWA 4O25A 3I8XA 4CDGA 3QVVA 4HUQA 2OO9A 2QQ0A 2E1RA 3SBEA 2PJRA 1TR8A 1CUKA 5G3YA 3IIMA 4EUNA 4WOPA 2IXGA 4GFDA 3AVUA 1NNEA 5A0FA 1DOAA 4C9BA 1XEXA 2W58A 5L3SB 3MMPA 2XEXA 3CRVA 3EC2A 5TVKA 4JVLA 4C2UA 3F0TA 2J9RA 4LYHA 2O8DA 4B3FX 4OQMA 1KI1A 1XPRA 5JS8A 1TF2A 2Z4SA 4FINA 2ZRJA 4QHTA 5FTMA 1Z22A 2R2AA 3W6PA 3H84A 1G5TA 1TF5A 2NZJA 2YOFA 3KKPA 3TSWA 4TQ9A 3RSOA 1FX0B 2CLCX 3QXJA 5BYJA 4I1UA 1NN3A 4A1FA 4DLYA 3KQUA 2BBWA 1S8FA 1M7GA 2NOAA 1U0JA 3MCAA 4LX0A 4XH9B 4JVNA 2P6RA 4KBFA 2D7CA 3EA5A 2W0MA 3OE7A 1US8A 1VG5A 5DISB 3TIFA 2NZ8A 1IY2A 2HWJA 2FPKA 4OI0A 2QGZA 2MSEB 2A5JA 4EDHA 2O8FA 1E32A 4J0QA 1ZJ6A 4UNRA 4BRUA 4JLDA 2RHMA 3EIHA 2VHQA 5KDLA 3ZS9A 1W5TA 2PCJA 1KY3A 2NO6A 1VPLA 1UKEA 4HB2A 2JY8A 2FGJA 4H9GA 4LJ9A 2AD1A 3T35A 2DB3A 1G3MA 3W8RA 2F7SA 2J87A 1BO6A 2QA5A 4HB3A 5IF9A 2IYYA 4XOIA 2JY5A 4F1IA 2O8CB 3C4JA 4JSTA 1Q3TA 5DI3B 1G4UR 2BIFA 4WVFA 3W9YA 4CT4B 2HJVA 2IHYA 3A37A 1Q0UA 2QBYB 1XFAA 2EQBA 3VKGA 1ZNXA 3B7GA 1QG2A 2GZDA 2OBLA 3SJZA 3VR6A 2YNMA 2RGCA 1NVVQ 4GZLA 4OL0A 3VR2A 1GFIA 3ZLJA 1XEXB 2UZ3A 4CRWB 4QFMA 1JAHA 3NHBA 3BH7A 4YQFA 3X1YA 5JRZA 4WIAA 3ZIAD 5ANRB 3OHMA 4WZ6A 3RRNA 4EFNA 4RFSB 2QENA 2OE2A 3D7MA 1CR0A 3UPUA 1E1RD 1ZRHA 1VG8A 2J0VA 5JHGB 4IFBA 3KQLA 3AKDA 5JWHA 3GLFB 2WIAA 2OG2A 2XTZA 3ECCA 5CIQA 3DO6A 1FTSA 3B9QA 2OFXA 4EPWA 1YKSA 4UNNA 2DHYA 5DLQC 3AVQA 2YVUA 5EP2A 3L2OB 1YR9A 5JMTA 1KMQA 3GLHE 3A1SA 4RFVA 3ZZ0A 4JS0A 2WWIA 3I73A 3QE0A 3QNUA 3K70D 2CCJA 1WF3A 3PUZA 4U5XA 3LY5A 4X8LA 4AKEA 2OZEA 5FUYA 3K0AA 4AKHA 4BEBA 1Z06A 1M7BA 4C4PA 1JI0A 4ILEA 4IDQA 3C41J 2DWQA 2PMDA 5FOTA 2RGXA 2QM7A 3AVOA 3QKTA 1KSHA 5SZKB 1D8TA 4DLZA 2IT1A 2VL7A 5FL3A 2O25A 5JCZA 1FUUA 2ORVA 4PHHA 3N5CA 3RRZA 1YU9A 3KQKA 3NWJA 5JSZB 3NKVA 2LWIA 2JDID 3K9LA 4EPYA 4ABYA 1R2QA 2GCPA 4Q1DA 4Q1CA 1Y3AA 4HYYA 1TPZA 3T1OA 2AHOA 1Z08A 5FOVA 4YC7A 3CLVA 3RDPA 2CMKA 4N1AA 1GM5A 2YYZA 2H92A 1II0A 3KUCA 3I61A 3FKSA 3BB4A 5FL7D 5IK2A 3RS4A 1BOFA 1SVSA 4D82A 2ZEJA 4KCGA 3RS0A 2R65A 4OQFA 3ASZA 2CVFA 2ZRDA 1IXZA 1JXOA 2GJAA 4PSKA 1OT3A 1NBME 4Q9KA 2DR3A 3SI7A 2IHBA 2GF9A 2BVNA 4M1TA 1UM8A 2W0SA 2J41A 1KAOA 1S2MA 4TYNA 1TTTA 2W83A 4EPRA 1N0WA 2KSQA 1GRQA 1JQLB 3GJ8A 4HLDA 4HZUB 4C2TA 3B13B 3CRQA 5DFLA 1DARA 2BBSA 1GL6A 1HQCA 1QBKC 4GMDA 1C1YA 2GK6A 5J4HA 4Q1AA 1WGNA 3K70B 1DV0A 3VR1A 4D25A 2V4ZA 4DCUA 1JB1A 5GVRA 1Y63A 4JLMA 3LLMA 1E4VA 2FU5C 1DE0A 2IC5A 1Z6YA 2IK8A 4HAWA 4CEJB 2QM8A 1E9SA 1ZMVA 2QUZA 1NJFA 4Q4AB 3I62A 2JDIA 4Q7KA 3H2YA 1RRFA 1EFUA 3OFNA 1R0ZA 4F91B 3NG1A 3FHOA 4TLDA 2HYIC 2ANCA 3OFND 3TW8B 3OE7D 3QXHA 1SVOA 4WZBE 2QSYA 3NBZC 3SQWA 3E21A 1HH4A 2G3YA 3ND8A 1FNNA 2BV3A 4FMCF 4JLVA 5FOWA 4BFWA 4UNPA 1J90A 5M04A 3BH0A 1WIVA 4MA4A 4MRNA 4KITB 2C95A 4NCNA 3SNHA 1F2TB 4PANA 2ZRCA 1ZUIA 1QVAA 2DCUA 3VHLB 2KNZA 1MV5A 2H8KA 4LY6A 1TEXA 1OIVA 4FMDB 3AEZA 1G16A 2A5FA 2PJZA 1W36B 221PA 2NGRA 1ZM7A 4Q9JA 1FP7A 2HV8A 3K0CA 3IDQA 2ZRFA 2ZJ5A 3EZ2A 1F3OA 1E0AA 3D31A 3OIWA 2MSDB 2WZJA 2ATVA 4M1SA 2VP5A 2AKAB 3O8DA 2V6JA 4C7OA 2O52A 2CJWA 3R8CA 4PPFA 5KSOA 3QXXA 4QGGA 1RE0A 2FWRA 2QSFX 4WAUA 1VYUA 4IHQA 5E95A 2P5TB 3K0FB 2EFCB 5FI0B 2DVWB 3GLIE 1T8TA 4BWYA 1YRAA 3OIYA 3ZIAA 3CF2A 1LNZA 1YZLA 2XXAB 1JR3D 1N6NA 3ZDQA 2ZUBA 4PZZA 1XDBA 1ZUNB 2GCOA 2QHOB 3FMFA 1QF9A 2CK3D 1FUKA 2LCFA 4NBSA 2KNVA 3DZDA 5CLLA 4D81A 2X8AA 1RYFA 4M1YA 3GJ3A 4UXHA 2ERYA 2IS2A 1M1YE 2LKDA 4ASUD 1T3LA 1I4TD 2ZTDA 2FEMA 3B5JA 3H86A 4LC0A 3K09C 2AWOA 4BRWA 4ESHA 2CBZA 3QKRA 1OIWA 1PUIA 1HE8B 2F6RA 1NG9A 4JLJA 2GJ9A 1CBUA 4IEIA 4O2RA 4OHZA 4GL2A 4LBZA 4V0LA 1JEDA 3TK1A 3U3MA 2WJYA 3HJNA 4TL7A 2AFIE 2G6BA 2P65A 4EPTA 2CLSA 1CIPA 1PUJA 3FWYA 1A1VA 2IXEA 1S0UA 1VG9B 3H0KA 2JATA 1XXHB 4US1R 4BFYA 2E9SA 4G3XA 4RD1A 4A4DA 3CRW1 1XD2B 5GJCA 3C5HA 4B3GA 4JLPA 4TL9A 2KWIA 3T5GA 4DLUA 2ORIA 1X1SA 3Q9LA 1UBGA 2EU8A 3SR0A 3PJRA 5EZ6B 1S3SA 3UMRA 2BEKA 1ZP6A 4RZ3A 4OHWA 2J5XA 4B3CA 3CWZA 4FXPA 2ZE7A 2CP8A 1KHTA 4M0LA 1GDDA 4TSFA 1L4YA 2ODWA 2WPDD 2ZJOA 3THXA 1XPOA 3K8YA 2GEVA 2JA1A 1G20E 1E2QA 4C0JA 3F92A 1E1RA 2MMCA 3AP1A 3FKSD 5IHPA 3WBJA 2QT1A 2QMOA 3VMFA 5AUNB 5CB8A 4XSGA 5KNBA 2ZROA 1V92A 2WTUA 1UFZA 3G5UA 1Q44A 1JBKA 1ZM9A 1SULA 2Q3HA 4O2LA 4IEEA 3IKJA 1GKYA 1KI8A 4AI6A 4NPHA 3RC3A 3KTAB 4OI4A 3AJIB 3HR8A 1XJ0A 4HDCA 4FW9A 3TQCA 2D74A 3W3AA 2HDNB 4F4IA 1UADA 5AUQA 3EPHA 3AF2A 1IY1A 4GSYA 2H5XA 4D0GA 1M7HA 1YQTA 1A2BA 5C4GB 4RY2A 1W46A 1AS3A 1Q1EA 1VMAA 3KXLA 5DYIA 3Q8XB 3RSLA 4JJZA 1D5CA 4KAXA 2FF7A 2XZOA 3IQXA 1CKEA 2FMXA 2QPAA 3JZMA 4Q19A 1R10A 4EJSB 2FGKA 1IQPA 1IN8A 4HZUA 3D3QA 4DSOA 4OYHA 4IOKA 2B7BA 3T5DA 4LYJA 2IYRA 3CZPA 5JLJA 4M8NE 2GJSA 3DMDA 3A1UA 5HR5A 1M2OB 4Q4HB 1BYIA 4I1OA 3L8YA 4LRSA 4DIDA 2CXXA 521PA 5JI2E 4M4SA 4DC9A 2VIIA 4FCTA 2WV9A 1E2KA 2O0KA 2WWGA 1W47A 4M1OA 2MMGA 4F4CA 2DKLA 3VKWA 3GLHB 1DAEA 4XVRA 2ZXUA 3ADKA 4KFUA 1DAGA 4ZIRA 5HKKA 2J7PA 3IECA 1R5NA 4NKRA 1AKYA 1D2MA 1GNPA 3QF4A 2GZAA 2B6HA 2OM2A 3BFXA 4HAZA 4LYFA 4JLOA 621PA 5JRJA 5CK4A 4GBMA 4DLTA 2CEAA 1F2UB 3RC8A 4PAMA 2H1LA 3IPYA 4ERNA 2DNAA 3FOZA 1TQ4A 4HDQB 2G77B 2MSCB 4LPSA 3K1JA 2WWHA 3RVBA 4TLEA 2ZANA 1ESMA 2HCJB 2ZSFA 1LS1A 1E2JA 1I4LD 5IDVA 1NSTA 2DPXA 4B74A 2IYZA 2FPMA 1Z3IX 3PEYA 2GCNA 2P6NA 2X77A 5AWFC 5K8TA 1VDLA 1S9DA 4LK2A 3K70C 1GL7A 3KW6A 2Q21A 1X3SA 2R9VA 3WRYC 5FPTA 1KK3A 3REFA 1R5BA 2J0UB 2ECKA 1XB2B 1ZD1A 3NBFA 2D3WA 4PHGA 4ZV4A 1E2FA 1W48A 3PXGA 2HUPA 1Z2CA 1Z29A 421PA 2OXCA 1P62B 4OK3A 3U2QA 4D4JA 2VHCA 2R6AA 4ZCIA 3NDBB 5JJIA 1RW4A 4B35A 3AVTA 3EXAA 3EARA 3K0FA 3I92A 1DG1G 1WBDA 3V00A 2C9YA 2CCGA 3A4NA 4OBEA 3KTAA 3DVLA 4UJ5A 5TV2A 4MGKR 1ZD9A 4G5QA 4AD8A 5K8UA 3MWYW 3H4JA 4DKXA 3S1AB 3L0PA 2F3TA 2FSGA 4URVR 1DPFA 1XCPA 4QXAA 1YE8A 3LX8A 2WVJA 4AG5A 4QBIA 2BJVA 4OQNA 2IUUA 4YDHB 1NBMD 2QPTA 4E09A 4JSYA 3SFZA 1T4GA 1IN7A 1IXRC 1LV7A 1F6BA 1FTNA 2CNWD 2HF9A 4TYPA 3TBKA 3WYGA 4RZUA 3KQHA 2A7QA 2HLDD 2W2VA 1VEGA 1EFHA 2FG5A 3RWMB 2ZRAA 2YC2C 1JJ7A 4QGAA 1GZSA 3HPRA 5BYKA 3K0CC 2PLRA 1EFCA 5KU1A 2CWBA 2BKUA 1O87A 3K9GA 5AUPB 1WP9A 2ZJAA 3KKMA 2QE7D 2QL6A 4LBYA 1KKLA 1XTSA 1EFRD 1FX0A 1S3GA 3C8UA 4PSAA 4BLOA 4JLKA 3BJIC 2ZAOA 4DLWA 3T1TA 5KUTA 2W6ID 3CNNA 2Q6TA 3X1WA 3RRYA 1NSFA 4IRUB 3EZFA 2VEDA 3UG6A 4Z1MA 3QJYA 1LB1B 4HAYA 2QTFA 1OW3B 3AP2A 4Q4JB 4IXMA 4Z1MD 1JAIA 1TADA 1F2TA 2WZQA 3GMTA 4KHZA 1KO4A 3FFAA 4CEHA 3UWKA 2UKDA 5EP4A 5JI3E 4IVQA 5BN5A 1JNYA 4BGDA 2CK3A 4PHTA 3AB3A 1JJVA 1XEFA 1SKYB 1WMSA 2BBTA 1LFDB 5J40A 5J47A 4UNQA 3ZGXA 4QGHA 3QKSA 4XJXA 3FHCB 3VFDA 1OJLA 1QHHA 3H4MA 3IGFA 1ZU5A 3QPWA 721PA 4DT1B 5EE9A 2L2DA 3KFVA 5AJWA 1UBCA 4F38A 4C7OB 1N5LA 2YC4C 4FD2A 3B1YA 5TMPA 3OIVA 3BFVA 1IXSB 1DVRA 3BE4A 1OYYA 1ZNYA 2AD5A 1KY2A 1FZQA 3KL4A 5B64A 1FOEB 2ZRMA 3LW8A 1XB2A 1G9XA 1KZGB 1PVOA 2DFTA 5JS7A 4LHZA 1T0HB 1ZM4A 3KKOA 4AURA 5LD2C 3VNVA 4RVCA 2EVWX 4ZCMA 4Q4HA 4B47A 2QTHA 2F43A 2WM9B 2FZLA 4L16A 1KDTA 1R4AA 1UAAA 2DWOA 4JL5A 3B89A 4GITA 2HAKA 1ZYUA 2I4IA 2VBCA 2ZITA 3CX8A 4C0KA 3WMGA 5HCNA 1YJ5A 2NPIA 3SYLA 1AA9A 1QDEA 2PX0A 1II8A 2J7PD 1DAKA 5GADl 2EFHB 2C98A 2H5EA 1N6LA 4S2EA 4I81A 1MRSA 3U5ZB 1WHCA 1EXMA 3THYA 1BYUA 2NPFA 2VF8A 5B57C 2GXAA 2ODNA 3HR7A 2GWHA 3BBPA 2HEIA 2YOHA 3KQNA 4TYWA 1TX4B 2WKQA 1E99A 1XD2A 4KI0A 2ZJ8A 5LDDC 1TUEA 5FPYA 3W3ZB 1OH6A 2QG6A 5DHFA 2KE5A 4DLSA 2LVOC 1NLYA 5CJPA 1TEVA 2GILA 4N0DA 3LRPA 2ZJZA 2GXSA 1R8QA 4KSBA 1P7CA 3TSOA 4DT1A 3EG5A 3B1WA 3VHXA 3U3KA 3FKQA 4IDOA 3VAAA 3GJ6A 4RD6A 2HT6A 3L0OA 3GLFE 2IF0A 5HZKA 3WHKA 2RGEA 2ZYWX 3P26A 1HYQA 1Z6GA 2JY7A 1S9HA 2ZUDA 4TLAA 4HB0A 5J4VA 1BMFA 2XSZD 3SBDA 4FWDA 2EKFA 4FCWA 4OJKA 1KDOA 2ZR9A 3A1WA 5KYKA 3GEEA 1CJMA 1N6PA 2DFLA 2ZRGA 1KI7A 2J0UA 4URYR 2O8FB 1IFYA 2AK2A 4QJ5A 3EIEA 2EWWA 1XTIA 1YVDA 1WB9A 1ESNA 1NG1A 3C16C 2YOGA 3SDZA 1XD8A 1K5GA 2QGNA 3BH6A 4KV9A 4IW3B 3LQRA 4GI7A 1R7RA 3SOPA 2OBMA 2PX3A 4ON9A 2H57A 2RH5A 4V0ME 4A36A 5TY0A 1W4RA 3VR3A 3TUJC 4DIEA 4P3YA 1IY0A 3E2IA 4XD7D 2Q9AA 3UMSA 4DBLC 4C0BA 4W5WA 4XD7A 1FL9A 1U2RA 1ZIPA 1IONA 5CLQA 1A82A 2EFDB 1I2MA 4KVAA 4MGIR 3DOFA 3U3JA 2DZLA 4FMDF 1E2LA 3KZ1E 4B43A 1MO6A 3DHWC 3WMEA 1KOFA 5FOXA 5EE1A 4A3VB 1RRGA 2KBEA 1IOZA 1JECA 4LJ8A 2VP6A 1P2UA 2FSIA 1W2GA 1DAMA 3FMOB 1NVVR 3MWLA 2QMHA 3ND9A 4GP7A 1Z6AA 2CL6X 2RMKA 1VHLA 2ZRLA 4NCJA 5LD2B 2V9PA 5J4YA 1UFQA 3GLHA 1D9XA 1VYTA 4RFSA 2J59A 2JJ2A 2RCNA 1CULC 1XMIA 5FBWB 3EZ7A 2VSXA 1X6VA 4C0QC 2O8DB 3FRIA 1FW6A 2RGAA 2P3SA 3NDPA 4MQBA 1ZMXA 5AUOB 2DWZB 1N25A 2ZR0A 1ZNZA 5IK2D 1CLUA 2FZ4A 1TMKA 2RAPA 3MLEA 1Q3HA 2EKKA 5E7JA 5KO2A 1WGLA 4DRZA 3A1TA 4EJSC 4QM7A 2IS1A 1GITA 5DIFA 2NO1A 4NTZA 4L8GA 1OSNA 1PJRA 4FIDA 1CS4C 1RKBA 3PUWA 3GCGA 3P4XA 1R8SA 1VCIA 4Q47A 5J5CA 4B2PA 1G4AE 3EIQA 3WHLA 3LBIA 2GEUA 2ZJBA 1W49A 1ELOA 3PUYA 2R0IA 1TU4A 5TARA 3CB4A 1CJVC 2BWEA 3OAAD 1G19A 1G64A 2JIZD 4PQRA 3SJCA 5C2JB 1LF5A 1SXJC 4TQUS 3B85A 1WCV1 4KO8A 3U44B 2O8BA 3LH5A 3CONA 2WJHA 3P4YA 2ZU0C 3DKPA 2O0JA 1FMJA 1S1MA 2ZE8A 4D0LB 3L0IB 4DLRA 3F3YA 3QBTA 4LV6A 5H68A 1H8HA 3LXXA 4QKQA 3QY0A 4OJQA 3RABA 2O8CA 3ETLA 1GILA 2J7KA 2JJ1A 3LVRE 4FN5A 3D6TB 1E0SA 2RGGA 4XWKA 1U9IA 3SHWA 3CPHA 4ZDJA 3IIJA 4C0HA 3QKRB 4DCNA 1KJYA 4BFUA 1KTVA 4HLUC 4JYBA 1ZBDA 2QSZA 3BGWA 1SVLA 1Z6XA 4B33A 2AX4A 1R4GA 1E2IA 2PBRA 1LS6A 3IHLA 5DO9A 4V0KA 5G41A 1D9ZA 1OAIA 2A5YB 3DPUA 5FBQB 1NKSA 2W00A 4A2QA 2DAGA 2OEPA 1ZU4A 4IOMA 4LUCA 5KNCA 2CE2X 2G0TA 1SHKA 2V54A 2JUJA 2LVPC 3QOFA 4Q66C 4QL3A 2G9NA 4LBVA 4K8OA 1CTQA 4GT1A 2XOKD 3LQQA 2GHIA 2BM0A 2UZIR 3NXSA 2D4HA 5DH9A 2H7VA 3DEFA 4B2IA 2C96A 1E69A 2DY1A 2YKGA 3PFIA 4Q18A 1L2TA 4XWAA 4A8JC 3W90A 4M9ZA 2IYLD 2F3RA 5CYPA 3B2EA 4QBHA 4FWHA 1U9IC 4CEHB 3QSYA 5GVSA 2WAYA 2FPLA 2L0XA 1CRPA 1JR3E 1VHTA 3GJ7A 1ONBA 3B1VA 3TH5A 2OCYC 2VSFA 4JKIA 3UK6A 3T1QA 1M34E 4GP6A 3W8NA 3KB1A 2CHQA 1P2VA 1E9AA 3O8CA 4Q9HA 1E1QA 3THWB 2SHKA 3LVQE 3ZD7A 1JR3A 1XXHA 3B82A 4OHXA 2JCSA 4TL6A 3FGNA 1QVRA 4MKGA 4W9MC 3CPJB 5EE3A 1SZPA 3FE3A 5KPJA 1Q02A 3QI2A 1AIPA 2GZHA 1E9EA 2GRJA 3KJEA 1RVDA 4JL8A 1TQ2A 3NIBA 1C4OA 1DAHA 2Q3MA 4TTQA 2AXNA 1IM2A 4I99A 3U7HB 2OSBA 2RGBA 3PEUA 3ZQ6A 3SYNA 2GBLC 1QHNA 3THXB 3Q3JB 2G88A 3GLGB 2CNWA 4QG7A 3KJGA 1CJTC 2A9KA 3NBXX 2OAQ1 4IJMA 5JWOA 4IXNA 1T91A 4N0EA 2LTUA 4CEIB 2FE4A 3OF5A 3Q72A 2JIZA 5EP3A 4JKYA 3GJXC 3V4RA 1W0KA 2Q3FA 4YXWA 4PO9A 5DGXA 4EIWA 3MJHA 4TSFD 5FOUA 4MYCA 1PLKA 2FX3A 3AKYA 4CEIA 4DCTA 1OE0A 2PL3A 5JJLA 3RLFA 3U4QA 2ZYVX 1KI2A 1E79A 3GQBA 3SC3A 2P6UA 1ZV1A 2X2EA 3SS8A 5F3WB 2C77A 2D06A 1X8JA 1X86B 4DDUA 3V9PA 4Z54A 2REBA 1G6HA 1W4BA 4Q5IA 1G6OA 5TDHA 1J8MF 5B2ZA 3KUDA 2ZRKA 4Q01A 2LVQD 4E07A 4Q7JB 5EUMA 2QT0A 2IEYA 3VLFB 4BFSA 1IHUA 2WPDA 1UPTA 1LVGA 3L0SA 4AK9A 1KMHA 1Z28A 2V3CC 1SKQA 3VNUA 4R98A 1XP8A 2R6FA 3LX5A 3SYKA 2D7DA 3A4MA 5FPKA 1T3SA 5JZVA 2GVZC 2JLRA 1H65A 1OXSC 3T6PA 3GLIB 2FFAA 5TXGA 4A0HA 4BQSA 2KHHA 3I5XA 2WHXA 1E9FA 3AP3A 3J81k 4CT5A 2ZSEA 1YR8A 2CDNA 2NIPA 1E0KA 3K9HA 1COWA 3OEED 4JYCA 3RS5A 1KAGA 4AKIA 2KNAA 1G3UA 4P31A 2O0HA 4LWZA 2R8RA 5FR2A 5C18A 3T61A 1ZVQA 1E2GA 2W2TA 2JY6B 2QPOA 2EJSA 3I8SA 2GTPA 1FNMA 3M4YA 2HXYA 3AF3A 1WQ1R 3V4FA 2WIBA 1T9HA 3VKHA 2CHGA 1NRJB 1KI3A 4DDVA 2DAIA 3QKSB 1XEWY 4GRAA 2FNAA 3VX3A 2WJVA 1EESA 1KO5A 1IJEA 3CH5A 3CR8A 4PPGA 4QBGB 1G41A 5KOYA 3DMNA 4HZIA 2VA8A 5G3ZA 3TVTA 1GVNB 2I3BA 1QHSA 5CITA 3BXZA 3EC1A 1K5DA 2BMFA 1XZQA 1X8LA 3A1VA 3LWNA 4PTLA 2YJTD 1E9DA 1SVMA 1G8HA 2BWBA 3DM5A 2BJWA 4NDZA 4TTPA 1OQYA 4F93B 1E9CA 3REGA 1BMFD 3C7KA 2OFOA 4G5OA 3TQFA 4XTCS 3S1AA 1GG2A 3SJBA 3O8RA 4D80A 1P72A 1ZMWA 2NG1A 3CX7A 3B1XA 3C5CA 4R7ZA 5IRCD 1GKIA 2GEDA 2X1VA 4ESVA 2DZOB 3TAHA 2NTYC 2R44A 4HI0E 4KODA 5EXTA 2ZE5A 5K8LA 4HEOA 4DCSA 4JZKA 2ZRHA 3MGCA 1GKUB 1NV8A 2OBNA 2RGNC 2E87A 3F5FA 4OQXA 4ITRC 1E3MA 4TLCA 2ZS7A 3T34A 2IYQA 5SZHB 2ATXA 1UJ2A 1P61B 1NIPA 1VIYA 1CXZA 4NH0A 1UKZA 1MH1A 3HYTA 3ZZTA 4LDJA 4PC3A 4M9XA 1E2DA 4YMTA 1HT2E 2FN4A 2C03A 2FA9A 2REOA 1KSGA 1XTKA 2OCBA 1NI3A 5L3QA 3EPJA 1P75A 4KU4A 3GJ5A 2ZSAA 3CH4B 2NQ2C 2RB4A 3NEJA 3QQ5A 1G8PA 3NH6A 1CR2A 4F7WA 2BMEA 1WJ7A 3LDAA 4G5GA 3WYFA 4IDHA 4B34A 1NMXA 2VQSA 3FDIA 5AJXA 4U7DA 2MROB 1G291 2VO1A 3KB2A 1HA3A 2XSZA 2GXUA 3GEHA 4DDWA 4TMVA 2Z83A 2OOAA 1F4IA 2C9CA 1FQJA 1TL7C 3WP1B 3ZYCA 3AUXA 2QRZA 4NYMR 1N6RA 2W6JD 1PLLA 4GEWA 1AS0A 4PAQA 4HSEA 4IVPA 4O0MA 1KGDA 1VCMA 2HLDA 1AZTA 2Q9BA 3NBYC 5CIWA 1T5LA 3KJIA 3PUVA 1NVWQ 4Q7MB 3VR4A 1G7CA 1NVXQ 4TLBA 1YHNA 3E1SA 4FI3C 2Q0HA 2OAP1 3LA6A 3UG7A 4NHOA 1PLJA 2NMVA 3ZQJA 4PC2A 1Z0IA 1PGYA 1N6KA 1EFTA 1Z0FA 3LBNA 4ACBA 1KI6A 1JALA 1EGAA 1W4CA 4WP2A 2VHUA 4KLZA 4A0FA 2KRKA 3AVPA 2IL1A 2XB2A 2OT3B 2ZU6A 3IEVA 2J45A 2ZPTX 3K09A 1N0UA 3WP0A 2BMJA 4B71A 2IYXA 5EXSA 3BBZA 1XMSA 5BXQC 1FQKA 1G3IA 1M8PA 5FPSA 4U00A 1CJKC 2R6GA 3ZVRA 3BS4A 2CL7X 3KKQA 4UXIA 5DE3A 4A6PA 5BN4A 4I4LA 3LBHA 2B8WA 1HURA 1SVIA 1UKYA 1VDZA 1ZMUA 1Z0AA 3GJ4A 1WRBA 4AYWA 1HEIA 4LOAA 4MRPA 3UATA 1DO0A 2V1UA 2ZRNA 4AIIA 4RKFA 3CF0A 3M0EA 5GJWC 3JVVA 3KJHA 3Q85A 2IXFA 3THYB 2BC9A 2H17A 1J2JA 1IN5A 2W6JA 4M1WA 4W5HA 1T43A 3IHPA 4XIGS 1E9BA 1R0YA 5EZ5A 1U99A 1QHGA 4Q1BA 1T6NA 1W4AA 4Q7JA 3IQWA 4IFEA 4A9AA 5J4LA 5HZHA 3I5YA 1IBRA 1P2TA 1COWD 2VHJA 1NN5A 3B78A 4JBYA 3W34A 3NTUA 1RC8A 1A4RA 5A4JA 3EA0A 4BPBA 3HWSA 2FOLA 2Y8EA 1KK1A 3M1IA 2YWFA 1E2NA 4TN1A 5HTKA 2FDCA 1EFRA 2OLKA 3B60A 3DZ8A 4TYYA 4LHWA 4KXFB 4C0SA 2ZI4A 5E7MA 1Y8GA 1G1MA 1UBEA 3TUIC 4QC2A 4MKHA 2RRUA 4B48A 3MG9A 2AN9A 2XNDA 4P33A 1VYVA 3HU1A 2X2FA 3BRWD 1QHYA 2CLDX 4TT3D 3TAUA 2DAKA 2ZJ2A 1MR3F 1OTRA 1NY6A 2V6ZM 1ZNWA 4NCKA 5FI1B 3GLGE 1DO2A 1EK0A 1VECA 2O5VA 3W5JA 2XGJA 4UQOA 3RRMA 2H16A 4PQYA 1CR4A 2ZS9A 4G3OA 3BOSA 1JXMA 1E98A 4R2IA 5LBIA 4ACAA 1K6MA 3GFPA 2ZTSA 1NF3A 4B44A 2BMDA 2CVHA 3U61B 1E6CA 2F1RA 3ICQB 3NVAA 2K5UA 4C3ZA 2IA5A 3A58B 5DN6D 2QP9X 3IILA 4F4JA 2CL0X 1UKVY 2OO7A 1N6IA 3ZH9B 2EYUA 2GF0A 1Q20A 4QGFA 1OHHA 2WMNB 1NP6A 4DJTA 2LVNC 1FPMA 4BFTA 4ZI3A 4LJ4A 1ZM3A 5CYOA 5FR1A 4UXJA 5JJKA 2ONKA 4Q9IA 4HUQB 1OFTA 2IF2A 2P67A 4V0OA 3WXMA 4RZXA 3WMFA 3ADBA 5L8VA 3LLUA 4P32A 1XXHE 3PR1A 2A5DA 1OB5A 1W36D 1BKDR 2XXAA 3HYRA 4D0NA 5G53C 4UNSA 1E2EA 3FB4A 4LJ6A 1X8KA 5AJZA 5LB2A 1ANKA 2ZSBA 1XWIA 3T15A 2N46A 3B6EA 1V5WA 3IBYA 4TMTA 4TT3A 4JN6A 4GOXA 3PIRA 3R9WA 1O3YA 1GOTA 4BZQA 3UWOA 5SZIA 1NN0A 1U94A 3A8TA 3AKCA 4EFLA 3P27A 4RKEA 2WWFA 2XITA 4QJ3A 4RD0A 2J3EA 1KO7A 2BCJQ 1E79D 1KO1A 2C5LA 3TMKA 5P21A 4D6PA 2JLWA 3BERA 2QP3A 2ZJYA 2ZQ5A 3VR5A 4A82A 2N42A 3CR7A 4AYTA 1W1WA 2V1XA 2XAUA 4DB2A 3K9PA 3ONWA 2ZVPX 2D62A 2KI5A 4TYQA 1BS1A 1T3HA 4NYJR 4MYHA 1XJCA 2GA8A 2PZGA 3LD9A 1IN4A 4RCYA 1RIFA 4C30A 4DB4A 2IS4A 1M6NA 2J46A 2ERXA 5JEDA 3EX7C 4BFXA 4MDEA 1YR7A 4BZXA 1KJZA 2MGWA 2YHSA 4URUR 4ZO4A 3VX4A 5C1BA 4OK6A 1LW7A 1QZMA 4WXPA 1QRAA 3LO5A 1WBBA 2QTVB 3L43A 3QEOA 3I72A 2XJ4A 3E46A 1P9NA 2ZAMA 1W7AA 1OH7A 4II7A 2CCKA 2GJ8A 4EPVA 2HXSA 2ZIAA 3QKUA 2IYTA 3I4LA 1UDXA 2A78A 4R9UC 1NVUQ 1FP6A 1GSIA 3NC1C 3SZRA 1U8YA 1X1RA 4B6FA 5D3MA 4URXR 3AGQA 4HAXA 1GRNA 3EZ9A 4G0NA 2BM1A 4JVMA 4GZMA 3OEHA 5JCPA 1VG0B 1YZKA 2HT1A 3FTQA 2IS6A 5HE9A 2P2LA 1Q57A 2ZI7A 2AWNA 5JWRA 2G3QA 2JLUA 2ANBA 1VTKA 1XCMA 2DBYA 2QI9C 5EJEA 2KB0A 2QN6A 1J70A 3KX2A 1R5OA 4X8MA 1N3BA 5BW8A 5A5GA 1NLFA 3GLFA 3BORA 4CGZA 2FJUA 1P9RA 4GDFA 2JAQA 3RHFA 1J7KA 4Z8YA 4A0RA 1PZNA 3OAAA 1RZ3A 2ZRBA 2CHVA 4ZKDA 2EFEB 3KKNA 2QU8A 1NJGA 2XJ9A 4NYIR 3QF7A 2A30A 2JJ8A 3L82B 3IIKA 4TWZA 5L3VA 1OB2A 1RPZA 4RJLA 2JASA 2WSSD 2QE7A 1C9KA 4GPTA 4DDTA 5EP1A 1RRCA 4BLTA 2QMUA 1VCNA 5KSZA 4AC9A 1EFUB 3TE6A 1II9A 5K8IA 2C04A 4MITA 3EWAA 2XTMA 3WRXC 1ZC3A 3MAAC 2WWWA 1KIMA 3PG5A 4OQLA 5E3HA 1RFLA 2FH5B 2JLVA 1S4QA 1G17A 2WOOA 3G0HA 4DUGA 2GETA 1E2HA 1DELA 4V0MA 3C15C 5L3RA 2QAGA 1XU4A 1G5RA 4Z8XA 1WR1B 2DENA 4MKIA 3IEUA 1P3QQ 1GIAA 3MRSA 3RAPR 2VPPA 4FMCB 1HT1E 2AXPA 2OV2A 4DLXA 3OEHD 4X8OA 4M1KA 4PC1A 1VKJA 1CJUC 3TLXA 4Q4JA 3B9PA 2QNJA 3X1ZA 3Q7PA 4L9SA 5FBRB 3QUSA 4H1UA 2IUTA 5FUVA 4K81B 1TTEA 2BOVA 4BFVA 1MN3A 3PVSA 2LBCA 2JEOA 1NN1A 4Q7LA 2KJQA 4BEJA 3ADDA 1OHHD 2AKYA 5IT5A 1TU3A 3UANA 3ZD6A 4NU0A 4UKDA 2PEYA 2GJKA 2YV5A 1MT0A 3CRRA 3FMIA 4A0GA 1Z2AA 4TMXA 1N5KA 4AYXA 2VRWA 4NL4H 4UN2B 1F48A 2GNOA 3PUXA 4ZDIA 2PT7A 3BFKA 3HP1A 4JVSB 1E2PA 3KFXA 5AJVB 1AQYA 1Q22A 2ZUCA 1G7TA 2HYDA 1AIPC 1F60A 1N2CE 3VTKA 2HF8A 1T5IA 1Z47A 2IWHA 1W0JA 3O47A 4ZCLA 4MUBA 1EX6A 5F2EA 3EASA 3SQXA 3U4QB 4NMMA 1ZIOA 2C2HA 3CNLA 4KYUA 4KBGA 4B3XA 1MKYA 4NP6A 3QBVA 1QZXA 4DEXA 1CU1A 4NYJQ 2JLXA 1R0XA 1G5PA 1SQ5A 1SXJB 4PO1A 2YWEA 1XTQA 2DYKA 2QAJA 2VP0A 2YWHA 3N70A 4N3NA 4BLPA 5AK0A 4E22A 3AGPA 1OYWA 4M53A 2GAOA 3VU9B 4EQ6A 1NMZA 1KZ7B 4V02A 2P0EA 1NL3A 1KNXA 2FFQA 4B76A 3EPLA 1IAQA 3K53A 1IXSA 1MO4A 1RJ9B 4BFZA 5HKKD 2ZS8A 4FWGA 4CZ2A 4PQFA 1NMYA 1A7JA 1P2SA 4YONB 4EKDA 3P20A 1E4YA 4PAOA 4B32A 2F55A 2VP2A 4ZDWA 1D6JA 2ZRIA 4D4LA 4L15A 1I4DD 1P60A 3PEWA 4HLCA 4P4UA 4KSCA 2N1BA 3W6OA 1W36C 4WW0A 2DHRA 4ZIRB 1X37A 1S1CA 3K9OA 2F9MA 5EXPA 1U8AA 1ZCBA 4QJ4A 1KK2A 2ODEA 4YMWA 3X1XA 4BECA 4LJ5A 3I32A 3LAWA 4CYMA 2R6DA 1J8YF 1DAIA 4ZKEA 2F1JA 1OH8A 2UVQA 3R7WB 2FSFA 1YZTA 2QAGB 3MSXA 5BWMA 1YZNA 3HU2A 4IDNA 2EYQA 1E96A 3LFUA 2ZRPA 4LYAA 2RKOA 5FTKA 3PQCA 3CIOA 4A2WA 4QM6A 1YRBA 3LXRA 3SHFA 4IDPA 3ZS8A 5ELXA 3DOEA 1R0WA 3FPAA 2VLIA 4DBGB 4MUAA 4H1VA 4BLRA 4LCBA 4HB4A 3PCRB 1Q21A 1OXTA 3TVDA 3ASYA 4YLGA 4JT2A 4U02A 3SU8A 2OUKA 2WBLC 2WKPA 3D8BA 1F2UA 2JLQA 4PZLA 1ZM2A 1E2MA 1UDWA 1AGPA 4LC1A 5B30A 3PITA 1Q1ZA 4NYIQ 1SXJD 4Q1FA 5EQTA 1FFHA 1KSJA 3MWJA 1SXJA 4RZ2A 1Z07A 3NEYA 4Q48A 3CBQA 2WAXA 4A8JB 3AVYA 3T06B 5CM8B 1TNDA 4LRWA 3FE2A 4GOKA 1U98A 4M1MA 2OLJA 4TZ0A 2IEZA 3IBGA 3CPEA 2VYFA 1HQYE 4Y0VA 2Q9CA 1SXJE 2QQEA 4M21A 1QHHB 3ZVLA 1E0JA 2V8OA 4HAUA 2RGNA 4MYTA 5KDOA 1N6HA 4PPQA 3UXMA 3HU3A 2B21A 1AGRA 3A6PC 4PC6A 4HLUA 1G18A 3MUFA 3UIEA 2WSMA 1QHIA 2NO0A 1JPNA 3TKLA 5DI9A 4LV5B 5F9HA 3R9XA 4V0NA 4B73A 2J0SA 2W6IA 4G01B 1OLOA 2EW1A 2JLSA 4NZYA 1G7RA 1U8ZA 4MRRA 3FFBA 1RJ9A 1II8B 4D4MA 4MGYR 4WZAE 1IJFA 2IYSA 4PO8A 3X1DA 4DSUA 1XTJA 1HJPA 4QOSA 1NIJA 2V55B 3EW9A 3WBKA 4TMWA 5FFMA 4OI1A 3LCVB 3QPUA 4TMZA 1U90A 3EZ6A 3TR0A 2B3TA 4QNMA 1NVMA 2F9LA 3BD9A 5F98A 1SG9A 4Q4AA 4ASUA 4KFTA 5JEEA 4MDFA 1CEEA 4I1VA 1AZSC 4LPKA 1MRNA 2GKSA 1QZEA 3KDSE 4QRHA 3RS7A 5HCIA 5FTJA 5JBQA 5C4MA 1HV8A 3QXCA 4ARZB 3THOA 2D2FA 2XX3A 1D2NA
chains in the Genus database with same CATH superfamily
3WGTA 1XNJA 3OLCX 3HXQA 3CHYA 5DK4A 1T9CA 2FSHA 2I99A 2JARA 3DLPX 3ETCA 3GGOA 3MQFA 1B93A 3QEJA 4MEAA 3FYHA 4M9SA 5EZYA 1JE0A 1T8RA 1JQ3A 3J2PB 1PFVA 1FMLA 4OQPA 4NXMM 3T0FA 3S44A 4B0PA 5BOSB 3FSGA 1CJBA 4M8SA 1P91A 1ZXXA 2ET6A 4Z4FA 3AVVA 2P1RA 4WPGA 5ITSA 4EO4A 4ZI7F 1F6DA 3PVCA 1UK8A 3QENA 4DDKA 5D3MB 2QY9A 4C7VA 2FQQA 1XCGB 1TQ6A 4PAGA 5MHTA 1X7DA 3EBOA 1JMVA 1I1NA 4KT0F 1FMFA 1QQTA 3AFMA 1H2YA 4GI2A 4ZPXA 5KS2A 2WQ6A 3E0QA 3FZNA 4U2FA 4EAQA 1KMMA 3C6YA 4RSMA 1ZJJA 4FKMA 1ZRSA 2AE2A 1KBQA 1VLHA 3FH0A 3K0EA 3MD9A 4OJNA 3PV0A 4OI2A 4DR5M 1J99A 4MI3A 4RXMA 2XB4A 2OGUA 1HTTA 5GONB 5TPWB 1JLRA 4YMSA 1TW2A 2NADA 1OTXA 1GO5A 4NZZA 2XCQA 3UW1A 1UEIA 5CT4A 4JC0A 2I54A 4BVAA 4BO0A 2DULA 4HRAA 4M0CA 2CHEA 4G0YA 4FEGA 4KRXA 5AKKA 5C37A 1OFUX 1DCTA 3IPRA 1INLA 4F4UA 5H3HA 2CLIB 2QR2A 3L7JA 1NBMA 4D2IA 3N2KB 1GTVA 4PHCA 2C88A 1Y1SA 3VHRA 3A6JA 3DLIA 3BMCA 2R11A 3BE8A 3UPTA 3FNHA 2YZ2A 1KDPA 5TC4A 1W25A 2FXIA 3FHLA 3L8ZA 3EGOA 4OHRA 2R4JA 4CFYA 1JHQA 3M6IA 4G4SO 1J4AA 4TWRA 4US2R 1N0HA 1QOZA 2DAMA 3U4IA 4R2JA 5JNVA 5K0CA 3GPYA 2YBDA 4UQPA 5AVYA 3T5TA 1J39A 4Q9LA 2ECQA 4B5KA 4S35A 4MUEA 4X41A 3LTNC 4RKUF 3SAWA 3IBSA 3RYHB 2GHTA 4EG4A 3ZTTA 3BAFA 2LPMA 1HDRA 3E9YA 2Q0XA 3KE8A 5BN5B 4JP2A 3DMHA 1IHPA 1KKMA 1AUXA 1DS6A 1UDBA 1Y9ZA 4RYDA 2AQIA 1CR1A 4Y6LA 5FWNA 2J4DA 5AKHA 3LUGA 1MN6A 1CQIA 3O5AA 4TZTA 4U7TB 1KP2A 2O3QA 3UGQA 2BGGA 4IIFA 4NRWA 2IV7A 3JZDA 4OHMA 2EAUA 3HPQA 5G40A 3VR5H 3P32A 2GESA 3F4KA 3IULA 3O31A 4Q02A 3BXOA 5F77A 4FS8A 5J23A 4YROA 4W7SA 2JLYA 3V8QA 3DKVA 1V6AA 2QL7A 5EJMA 5CFMA 4FCVA 2VTBA 1T35A 1EG7A 1U0NA 2BZGA 1EUCB 3WNDA 1I94B 4G67A 1CX9B 5JFGA 2OFPA 2W6ZA 2XBLA 7AT1A 4LJYA 3PUJA 1NQ5A 2F90A 1TXGA 4TLLB 2AJDA 2G1JA 4BNGA 2J3LA 2WD8A 1NBWB 2FEXA 1DQSA 4PCVA 4JQOA 4M89A 3SMPA 3I53A 1GQFA 5CDFA 2BBOA 2VDVE 4E70A 1ITZA 4O1HA 3STUA 3INTA 4KPFC 5K0SA 1LF0A 4Y67A 2B6NA 5FWDA 2FWIA 2WT8A 4G89A 3OFKA 3NWPA 4HNSA 1OGIA 1RT9A 3SK0A 3PVZA 1QUSA 3OURA 2GDZA 4GP9A 1IBKM 2WC1A 1SY7A 4RENA 3REQA 4GIPA 2JNHA 2GKOA 2V74B 5TB5A 5A62A 3AMVA 2XUJA 1BVSA 1NVAA 3P4UA 5D3QA 5F7OA 2EGHA 2LP4Y 4MKFA 4JB3A 4EA9A 2J1LA 1W0JD 2JIMA 2PG3A 3NYIA 5DTRA 2A2ZA 2A9OA 3WFIA 5C1DA 4HXFB 4ZHSA 1VEKA 3K2IA 4U9UA 2XTNA 4UVEA 4FJ2A 2FG7C 3B3AA 3V1YA 1TE2A 3KSZO 3HZOA 2D7HA 5TX7A 3UMFA 4F21A 4NZNA 1U04A 1LTKA 3QXSA 2HKJA 2O8EB 5FXMA 5EINA 2B8NA 2CNDA 4R81A 3U7FB 4C7XA 1UPCA 1WXDA 5ECGC 3WWPA 3K31A 1CF4A 1EFDN 3B6MA 3NHLA 4EAAA 2FH0A 1MO3A 3PQDA 3PNYA 4PINA 2C5SA 4GXNA 1MH9A 2AIRA 1X7YB 2RGRA 4LJLA 1ADBA 4BUJA 3N5KA 1LLFA 3SAJA 3RTGA 1I7PA 3QUBA 1PGOA 1T4BA 2Z6VA 1HNWM 3ILKA 1EBFA 2WU8A 3QX9A 3ZC3A 3JALB 4GOJA 1YL5A 3UWSA 3M3DA 3E8XA 2AXQA 1K27A 2C8VA 3G2QA 4JZYA 3SFVA 4X24A 5SYMA 3U3DA 3ZWMA 5CBPA 3ESAA 1S8NA 1ZD5A 3NH9A 4HDKB 2Q7OE 3M5CA 2WJJA 2XOKA 2X7JA 3V4SA 1MABA 1FFXB 5I4IA 1J25A 1KYXA 2CXUA 2V7QA 4PG5A 5FA5A 1YCGA 5CBPB 4ZAWA 4DR4M 4JIMA 1D03A 2Q28A 3CCCA 4PC7A 5D01A 5FB3A 2NUAB 2XDQA 4BE9A 3TCKA 1E58A 4RHYA 5E7QA 3I4YA 4B7GA 4EI8A 4I1SA 5FH9A 1MABB 1VLMA 4ZQHA 2XDAA 3J7AS 4M2LA 2FZVA 4P8RA 1Z63A 1E1QD 2R0QC 4HH4A 3FOAA 3RTAA 2YVAA 4YT5A 3ZTWA 2B92A 1MGOA 2DFDA 2MR9A 1GAJA 1Z4IA 2OK8A 1Y4SA 1YCHA 2QE6A 3L7DA 4RY9A 1V1RB 4ZOAA 3WLNA 2WVGA 4P4SB 4PLVA 2QN7A 4M86A 4M88A 3FFTA 4A8JA 4M99A 3T1HB 3EIUA 3B1JA 3Q0EA 1HLGA 4UFPA 3MNFA 4Z99A 3ZU4A 2C99A 4XWWA 4MHSA 4H7IA 1K7FB 1CERA 2WFLA 3GI1A 4TZ6A 2DVMA 2WF6A 2WMYA 4NEHB 2CF6A 3EMDA 2PWZA 3QYJA 5IH3A 5KTMA 1QCCA 4M22A 1SEVA 2MJ5B 4NZMA 2PUFA 1MNAA 1BKSB 3ES9A 5JNLA 3L7NA 5LKAA 3LP6A 2PSHA 3B52X 3VUEA 1GGNA 4B8WA 1QNFA 1YJ8A 3KB6A 3K9NA 5IJWA 5L4LA 1UODA 2E1PA 1J9ZA 3PZBA 4KR3A 3E3OA 3ZLVA 3B7QA 1VSBA 4MW9A 5ICEA 4K8RB 3AV0B 4Y0AA 1NQOA 3LUJA 4GSKA 4BEVA 3C14C 5HDBB 1WTAA 3WGHA 4FEEA 3EF1A 4ENWA 2QNRA 1Q16A 4IV0A 2XT0A 3EJWA 3K5WA 3OQPA 1V0JA 4S1PA 4YP0A 2H1HA 4O4JA 1Z33A 4WXRA 4EMUA 2BH2A 1HKUA 3IHWA 3L6BA 3AVUA 3JWJA 5CAEA 5DGIA 3NTRA 1TUIA 4LCJA 4DV5M 4ZU3A 4E32A 1LA2A 3WLAA 1N6OA 1EWRA 2EL7A 2IU6A 1IL0A 1BHQ1 2JFZA 3M6UA 5F2NA 2QRHA 4HDMA 2YWRA 5AOVA 2R62A 1E1CA 1GP2A 1VIVA 4N47A 4EHHA 8OHMA 1SC3A 1RZRA 1WETA 3II6X 3L7IA 4OUKX 3ZWDA 3QVUA 1X1TA 5G0UA 4G5XA 3K0KA 4F85A 5CLGA 4PZAA 1VPVA 3OWHA 3RQIA 2LHCA 1AY0A 4K9LA 1QJ4A 2WF8A 1A50B 1UBOS 2DZNB 2H2DA 1ZUHA 4B40A 1KQGA 1JDJA 4KO3S 5G4KB 2MU1A 2BGKA 5B4VA 4ZVPA 3GEPA 1PHPA 2VJCA 2FXVA 4FHDA 4U6SA 1QG6A 1ZGZA 4MA5A 4KO1S 3P1JA 4WZAA 3U7IA 3R0XA 3K73O 4HX5A 4MUFA 3R20A 4DV7B 4E5MA 4D4KA 4JLNA 3U3OA 4F92B 1DJQA 1SJ9A 2OL4A 1YVUA 4WK0B 3IJPA 1PT5A 1C30B 2WNHA 2RHBA 3L18A 3FKEA 5JYBA 5LPNA 4L4UA 5AW4A 2B8TA 5B58C 2BR5A 3HJTA 4EB3A 3KC2A 3ELYA 1MOQA 4PCAA 3HN6A 4AZ3A 4TS9A 1M8KA 4GD3Q 2O7QA 4EB6B 1W0KD 4MXDA 4DQXA 1RD4A 4BYGA 5CEFA 2OC9A 1A27A 4IX9A 3VPXA 2GVDC 4LHSA 3FMPB 3PENA 3Q5DA 1PFUA 4BRZA 1DADA 1EX7A 3MQ2A 4V2UA 4JA2A 1KI6B 3X0DA 4ZTBA 4KFRA 4G5FA 4F3CA 5DBHX 5I7WA 1R3DA 2XRZA 2DWLA 1HYEA 5DYGA 2QAGC 1J2EA 1EZ4A 3VO9A 1AGYA 5DSZA 5EUQB 1ULAA 3I1IA 4NZPA 4YCSA 5KBYA 4CQLB 4F9GA 4OXKA 3N2IA 5GTDA 5J4LA 3HVIA 5CM9C 4JL6A 3PX3A 2JHGA 4WY8A 3SKXA 3I5AA 1C7ZA 4BLQA 1OXUA 2RDMA 3U7JA 2VDNB 1MJHA 2JJ2D 3L92A 3Q2IA 4KDCA 1ULHA 3QHAA 4KN5A 4PNHA 1JXQA 2BGRA 3AX6A 4WA7A 3E48A 2VP9A 1SELA 1A1SA 4RHCA 2IODA 1NAHA 3HCDA 3EQZA 4X44A 3SS7X 1JLLB 2WYOA 2ODBA 1RYHA 2PH3A 3CM0A 2R00A 4M0KA 1P6XA 4EHAA 1UXKA 2HJGA 1DTEA 1KH3A 3OEEA 4G5YA 2VXYA 4JCCA 5AJYA 5ALWA 4RL4A 1CY8A 1GV0A 3UXEA 3FAZA 1SR8A 4D3XA 3H8VA 3ZBPA 4JN6B 3WRWA 5FEUA 4NBNA 3BGOS 1YA4A 2BHRA 3CZAA 3IQDB 3KNZA 4C0LA 2YQZA 5TR9A 5HGJA 2XVZA 2X13A 4EFMA 3IAM6 2RGYA 2IYUA 3AY0A 3FLEA 3SIRA 2YZGA 1KJWA 1YU6A 2J7NA 2GTIA 4K0KM 3BGIA 4JLBA 4MIYA 1SB8A 2PMCA 3I76A 3IV6A 4I1RA 3NCTA 3P2YA 1PT7A 1N32M 5H8WA 3L5KA 1CYEA 3VSEA 2XECA 2O01F 2IYVA 3AERA 3KZCA 1AMOA 3WNZA 5AHXA 2REXB 2GASA 5FL7A 1VGQA 2BRUC 3CLTC 4KKVA 4YJGB 3ESDA 2WUGA 1GNTA 1T26A 4HKTA 1YB4A 4D8XA 3RU9A 2O14A 1OBVA 4M0MA 2D1FA 3KV3O 1TF7A 4UC0A 4BUZA 1XVVA 4CQJA 2FS1A 3U44A 2JIBA 2O8BB 2V7PA 3PWZA 1BD3A 1VSUA 2AK3A 3TOZA 3NBMA 3ZIDA 2OCGA 1V33A 4MS4B 5C7LO 1NDUA 1XBTA 4X1IB 5AH0A 4HVTA 5BV2P 1TIKA 2IY7A 1ZIDA 3IPXA 3JQ8B 3LUCA 3KD2A 3W5VA 3ZN2A 4ZGWA 4G2TA 3FFWA 4LDNA 2OZVA 1GNRA 2ZI6A 1G98A 2A7XA 4RPKA 4URWR 4JASB 4PHFA 3ZWKA 1HTWA 1JG2A 3QWLA 1J23A 2HHAA 2IGBA 3CNOA 2C1XA 3IUYA 3JD2A 3QMPA 1GUBA 4MAFA 2VVTA 5ESDA 4BJ5A 4XVCA 3G5MA 3AO0B 3GH1A 4ZDKA 4AJLA 2SKDA 3ABIA 1POXA 3AHHA 2G1PA 3GPBA 2UUOA 1JB9A 4UOZA 1FS4A 3RF6A 5KHOC 3TZBA 2EQ5A 2I87A 2J5KA 5CVTA 1I3MA 1GSOA 2RGWA 4NOJA 4M0FA 3WGQA 3A25A 1CUXA 3PI6A 4Y6PA 5T6MA 4PIMA 4R8KA 1XWFA 4DWJA 4JI1B 3I23A 3SVTA 2CT8A 3BRSA 3ZJYA 4DUZM 2IU0A 2CUZA 2ZRQA 1S96A 3DQZA 2CYCA 3FYDA 2INGX 2FLKA 4HAIA 1E7MA 3IE0A 4H0FA 1VMIA 4IUBS 4G8JA 4QU5A 3VU1A 4BVLA 1B23P 4FN4A 3QFCA 4C7OA 4TQAA 4J0HA 1THGA 4KWEA 1JJBA 4OK5A 2ZREA 4DLKA 2G17A 3NGMA 2HTEA 5LJIA 5C53B 1CQPA 2PFSA 3PGJA 3U81A 3R8FA 2XUDA 1N0VC 3CBGA 4EHKA 4MP8A 1PSZA 2XTAA 3WNCA 5CJ2A 1P4SA 3WKDA 1HEUA 2ZTVA 3LV8A 2PKCA 1BFKA 1ZUNA 2GPAA 2A4KA 1DFHA 4WBNF 4O25A 4HUQA 5IUNC 4QVGA 3QAUA 3P97A 1XG5A 4H4CA 1M5TA 2ZTMA 1C3VA 4EUNA 5EAIA 2OPHA 4WOPA 2AZTA 2IXGA 5L7WA 2PLNA 2QJTA 3O3OB 3TOXA 4UU0A 4C9BA 2ZQYA 3EC2A 5FADA 4OLBA 4S3MA 4C2UA 4RQTA 2O1SA 1X39A 2DUNA 2J9RA 1PNVA 4LYHA 3WAGA 4Y2XA 2EUCA 4B3FX 3C85A 2BZ0A 3P9RA 5DEOA 1YONA 2GWRA 1V5IA 1TF2A 4XJTA 3SCZA 4Y1EA 5C5CA 1ZVKA 4RTMA 2W90A 3RVOA 5FTMA 2I71A 4GXTA 4CMBA 1EE8A 3PPVA 1N2EA 1NVMB 2OQ2A 4JI6B 2NU9B 1BJTA 4EB8A 5BN4A 1OC2A 2XEPA 2AYZA 3QW4B 4UVGA 1JYFA 2W2LA 3ORFA 3MT7A 3RNOA 6AT1A 1WVIA 1FX0B 1QLHA 2VA9A 2H4HA 2ZJ1A 4J9UE 4QXMA 3TZLA 4JYZA 2CXQA 4PCLA 2R6R1 1LLUA 4NBKA 3BTOA 2VHXA 1U0JA 1KU0A 3MCAA 5KAPA 2YVQA 4DLAA 4KBFA 2D7CA 3DVAA 1A7UA 2G9VA 3NORA 3RTDA 1GVHA 3LI2A 3ZWCA 2NZ8A 2HWJA 2FPKA 5AO9A 4OI0A 2O8FA 4EDHA 1RHKA 2UUPA 3GOHA 1E6UA 1WHTB 5DHQA 5B3JA 7GPBA 1U3DA 4H18A 4MHOA 2PZAA 2ZZNA 1A7KA 1FNCA 4EGQA 5IAOA 1KY3A 1WP4A 1Y7PA 4JXJA 1AC5A 2JY8A 1UKEA 4HB2A 1BHO1 1C9DB 2FGJA 3TNLA 4LJ9A 4IIJA 4J1NA 1U5CA 2AD1A 4JI4B 3T35A 2H4FA 1L7XA 2DB3A 3T1HM 1G6Q1 2X0IA 1EWVA 4L95C 1GGJA 1GPYA 4RKQA 4HFMA 1KDYA 1QFMA 5DM70 2MYUA 1DXHA 4XOIA 2XNCA 1OBOA 3A14A 4JSTA 1Q3TA 1CUYA 2H52A 1IM8A 2HMVA 4C6TA 2BIFA 4E5VA 3UB4A 4Q3CA 3HO8A 2CFSA 3OJFA 2VATA 4JOBA 3BXFA 4DR1B 5ES4B 2PE5A 1XFAA 3B7GA 5AOCA 1SUIA 2OBLA 3SJZA 3VR6A 1D04A 2O07A 3HYSA 1F7UA 1YULA 2YNMA 4EARA 3HYCA 2G76A 4QGSA 3VR2A 3FZEA 3OT4A 4OL0A 3PXAA 4CM1A 4CI0B 1FSZA 1XV5A 2RC5A 2VYCA 1VSQA 4CRWB 1E66A 5F3WA 2LH0A 1CWUA 3C8ZA 1BVRA 1JAHA 4MJLA 1GL3A 3NHBA 1SCIA 4Q16A 4QYTA 4L6CA 2NV2B 4NATA 5AT1A 3ZNPA 4BGVA 4WIAA 4ZDJA 4R0NA 3FIUA 4X9XA 3RRNA 4ZZIA 3WYBA 3D7MA 1F9AA 3ZGNA 3DHNA 2ZUFA 2XKAA 2LE0A 4JOQA 1N36B 2F8TA 2J0VA 1NXSA 2FE8A 3K8OE 3KDAA 4ABTA 3AKDA 5JWHA 1FMCA 1JUDA 4YN3A 1TH3A 3DO6A 1ZNQO 1ONNA 2NO4A 2ZBVA 3GVHA 2W22A 3WWEA 4X1IA 2OFXA 2QRUA 4PCZA 2BFFA 4RACA 2WTBA 1Y98A 4UNNA 3TWLA 2DHYA 1IN1A 1XAGA 3L2OB 1YR9A 3SXJA 4B80A 5JMTA 4LXHA 3RI3A 2JRLA 4L0DA 5K99A 4TM8A 3SIWA 2QG9A 3A1SA 4HRYA 1OJ7A 4C7MA 3ZZ0A 1SXPA 3OPXA 5TIIA 4O2AF 1GO2A 4JS0A 2WWIA 4NBWA 5HK9A 4F97A 4UTVA 4RANA 2X4IA 2XBUA 1QKJA 3QNUA 3P2EA 3WK8A 3AUSA 2CCJA 4N3BA 3RS8A 3HGIA 1WF3A 5KTKA 3K0AA 4BS9A 2XYVA 3E18A 4BEBA 1ZZEA 1Z06A 1PNRA 1ZJYA 3ESXA 4M1ZA 2SBTA 1QGUB 5J5VA 1KOJA 4HGRA 2PMDA 4UU1A 3U5TA 1KSHA 2WM2A 4WASA 4DLZA 4PGFA 5FL3A 5ICCA 3PRYA 2O25A 5JD6A 3T3DA 2ORVA 4PHHA 3DF7A 7MHTA 3WBBA 4MVJE 1PK9A 3RAJA 4BIMA 4KITB 1PTJC 3NKVA 2VFAA 2A0UA 2JDID 3OOYA 4ND7A 3I39X 4ZJYA 1OVGA 3EH1A 3K9LA 3KSRA 1XZKA 1YB1A 2VHZA 2JXNA 2YMMA 3CT6A 3R77A 1T1RA 4NPCA 4ABYA 1Z8NA 2AHOA 2Z98A 1WCWA 4Y2PA 5K20A 3KJNA 3ZHYA 4JGGA 1GM5A 4X65M 3QK7A 3SATA 3H2SA 3KUCA 3F73A 2Q3EA 3BB4A 1ACMA 4GKBA 2ZEJA 1ZN8A 2QRVA 2P30A 5JMPA 2R65A 5KYYA 3ICPA 5FAKA 4ZAGA 2Q4RA 3DWEX 3UMMA 1YE3A 5GZ6A 4V0QA 1OT3A 1LK7A 1NBME 1J5PA 2DR3A 5T7BA 3U6MA 2ZAYA 1CUGA 2BVNA 1RQRA 2GZRA 5I7OA 2I2AA 4YBZA 2Q0SA 3QVOA 1CSEE 3RKSA 5AW0A 2HMYB 1Y7LA 2R8EA 4MJXA 2I7TA 2W83A 5E3IA 1ZR2A 5IZ4A 2KSQA 2O54A 2ZBKB 3WL7A 9LDTA 3BMNA 1P8AA 5AVKA 2O5EA 3VR6H 3WWDA 3OIGA 3GJ8A 4HZUB 1NVFA 4HWTA 4C2TA 3FNIA 2X2PA 5DFLA 3HKEB 3MQ4A 3ROEA 1DTWA 2BBSA 1Q6YA 1P7ZA 4RY8A 1C1YA 1BX3A 4JI3M 2B98A 2NU9A 2OCXA 4QO8A 5H02A 4Q1AA 3K70B 3M49A 3C4QA 3E4DA 4D25A 3QI7A 4G81A 4DA6A 2GN8A 4Z53A 3QBJA 1C9YA 1HDZA 1Y63A 2GGSA 3C6BA 1JKXA 2E4VA 2FU5C 2ZYRA 4DIUA 2BHLA 3C58A 4XARA 1ZOOA 1KY4A 1E9SA 3LQ1A 1ZMVA 3C3AA 1S2DA 3AR5A 1PEAA 4Q4AB 3RVMA 5JH7A 1R0ZA 3AY3A 3ODGA 4FHEA 4Y18A 2AEFA 1BW9A 2W37A 3NG1A 4TLDA 5DU2A 1CUVA 3GVCA 2ZDHA 3TDMA 4K0RA 2I67A 3X1MA 1WHTA 4WZBE 4CQMD 1EVQA 2KPOA 1Z0ZA 4MI1A 5JYCA 1GN9A 3SSAA 2GK3A 7ABPA 1Y4UA 4OHUA 5BR8M 3X2EA 5BW5A 1CUZA 2QRQA 2FVXA 3D7NA 5G1OA 3IJEB 4KQXA 2O59A 3C3YA 4WBNB 5J1TB 4CPDA 4NCNA 2BI8A 2OYSA 1KFBB 4PANA 4BNZA 3VMMA 3LMMA 3HKBB 1TMGE 2HIHA 3VHLB 4AL4A 1KP3A 1ZMOA 2Z04A 2H8KA 2WHRA 3IMCA 4FGZA 1TEXA 2C57A 5IAGA 2PA0A 2WJAA 4C76A 5KX5B 4LXYA 1U2EA 2PJZA 3IH5A 4PY2A 3PYXA 4MUYA 1G5FA 3IDQA 2ZRFA 1F3OA 3IXQA 3OZCA 4MAAA 1YR2A 2WZJA 3BHJA 3MIZA 3MMZA 3QX7A 1E1DA 2PFGA 3L7CA 4V0SA 3PDIA 2I8LA 2IW1A 3BZBA 4RH1A 3RJZA 4BQNA 1N78A 2HCRA 3D59A 5DFAA 4ETNA 5JALA 3R8CA 3E05A 4R8RA 1BXZA 2E18A 2AI1A 3KS9A 1U7XA 3QXXA 4GOMD 4HOYA 2Q2WA 4ZO8A 2W42A 3D6VA 2XWPA 3ODPA 4WI1A 4Q7QA 2QSFX 4WAUA 1VYUA 4NCBA 1PJ8A 2R4UA 1NOKA 3T0IA 1YS7A 4EA7A 3K0FB 2EFCB 9GPBA 2DVWB 1BMTA 1RKXA 1T8TA 1T0BA 2DHQA 1GQYA 1NULA 1YRAA 3ZCQA 3OIYA 1WCYA 2PX2A 3EH2A 2A58A 5ELMA 3GU3A 1X8XA 4S1OA 4JHXA 2RK3A 1JR3D 2ECOA 4JITA 4AS3A 3HKDB 1Q7RA 2PRJA 2ZUBA 3B2NA 2EEZA 3M5WA 4W8OA 2XY4A 3W4IA 1LI5A 1GJSA 3MMSA 1RP7A 3O92A 3MUNA 3STTA 4NBSA 3EPRA 4D81A 3R3WA 3N74A 1A98A 3GJ3A 1JPVA 3ONDA 2ERYA 2Q6LA 4WNAB 3E4RA 2B30A 2UXDB 1T3LA 4JI4M 2V8BA 2APJA 3QU2A 4YCAA 3H86A 4GLOA 4R01A 1W5FA 4NENB 3WMXA 3IYLW 3TZHA 4O2RA 1V45E 3N6RA 4V0LA 5GAJA 4GKKM 1JEDA 3U3MA 1YBHA 3AEKA 3I2YX 5BQXA 3KM0A 2AFIE 2G6BA 1SKAA 2PWYA 3QPDA 3E61A 4Q15A 1N1GA 2GLUA 2X1LA 1PAUA 1TT7A 2I3AA 2V7XA 4IBCA 4INOA 3QU4A 3H8SA 2AEMA 1BU5A 1CIPA 1MVLA 2ADFA 3F3MA 3PC4A 2IXEA 3HJUA 3K1TA 3ZK9A 3LHFA 3NCHA 1QANA 4I4IA 1XXHB 5A7HA 5IJZA 3SHVA 3D6FA 4G3XA 5MFZA 1SKBA 2CB9A 5BRJA 1EYZA 4L7VA 1WD5A 4JLPA 4F6LA 4DLUA 3EIFA 1WZ2A 1DPGA 4MVJM 3SR0A 4WMLA 2ILVA 5EZ6B 1NF2A 1S4MA 3TLKA 1ZP6A 3KYCA 3V6MA 4I3GA 4QRDA 3L1JA 1KHTA 1IY9A 3PQ4A 4M0LA 4PZ0A 4YACA 5CLJA 5IULC 5K3EA 4ARIA 5LQKA 4RJTA 1XPOA 4N82A 1KEVA 2H4WA 4GHWA 1DCMA 3CNQS 4X7PA 3K1ZA 3GCWA 3HMQA 4DR2M 3IT0A 5DCUA 3F92A 2EBHX 4ZVUA 4C0JA 5JNUA 2OCIA 4YAFA 5E6RB 5CDSA 5AVQA 5IHPA 3RO7A 4DA4A 1BNCA 1C30A 2WE8A 1CP3A 1NUTA 4Q12A 4XSGA 1KJIA 1U65A 3TYXA 2ZROA 2QD4A 5G4LA 1V92A 3HLKA 3QU9A 4K9RA 5JAQA 2WTUA 3AFIA 3G5UA 4D98A 1TM1E 5TQ0A 3HCEA 5KNDH 3V2GA 4GOOD 2CJPA 4TS1A 3OU6A 2R1VB 3D2BA 3DUWA 4KQ6A 4O2LA 4WINA 4NPHA 4DAOA 2NTVA 5CA1F 3OJCA 5EA2A 4OI4A 2GPTA 1QE3A 1MTOA 1HEYA 1Y5MA 2XUAA 3HR8A 3PIIA 4FW9A 3CPSA 3DKKA 3L8HA 2D74A 2XUKA 2J6CA 4HDCA 3HY5A 2HDNB 2YZ7A 1UADA 4NFSA 5AUQA 5IEBA 3AF2A 5K3FA 4EH1A 3F6PA 3EPHA 1LBSA 5EPOA 4WK4B 2Z3WA 1M7HA 1YQTA 4AJ9A 1A2BA 4D0GA 4P0QB 4LZNA 3G7SA 3ZWNA 4NENA 3VOSA 5DYIA 3N2YA 1CUIA 1E77A 2XZOA 3LCRA 4HS9A 4CV2A 5HTOA 1GDTA 1KPIA 3KYBA 3ZWVA 1L4KA 2QW1A 3D4LA 1GUDA 4AZWA 3PTAA 1O96A 4M0DA 1A3CA 3AEUA 3BPSA 3EUFA 3B6KA 4DBLE 4X6XA 2AEJA 2OP0A 3EDYA 1PGJA 2IHVA 5JLJA 2AZMA 1RPNA 4BN5A 2W82A 2H31A 3FBTA 4KXXA 5K51A 5HIAA 1XKTA 1ZONA 4R1LA 1UPBA 1A4UA 2CXXA 2WP0A 1PJ2A 521PA 1Y3CE 4O4HF 4M4SA 3W04A 2VIIA 1EVYA 4RDCA 1VRCA 2WWGA 3TE7A 2NUTA 2HY7A 2MMGA 3WWCA 2DKLA 1F14A 4Q9NA 1DAEA 2HA2A 4LA4A 2ZXUA 1W85A 5KYVA 1DAGA 1N0IA 1NE2A 5HKKA 1MU5A 1U28C 2J7PA 3DT6A 2EV9A 1GNPA 3V1LA 3MBKA 3U0VA 4H1TA 2B6HA 2OM2A 3OZDA 1AOXA 4JLSA 1VI2A 4HEQA 3L6OO 4NV3A 1U8TA 2XKBA 3BL5A 1TGUA 5CK4A 2J9FA 3ZCPA 4DLTA 1F2UB 4AUNA 2H1LA 1CE8A 4MDYA 4UUQA 4JV5B 3VDPA 4U3JA 5DRTA 1MX5A 3G79A 5ALUA 4GZ5A 3TNYA 3T54A 2C31A 3HI6A 4LJSA 3I01A 1MEOA 1PDWA 1S2GA 4TLEA 5LBTA 4DRXA 2R46A 2ZANA 1ESMA 1KQPA 2HCJB 4GF5A 1EK5A 1FW8A 2DPXA 4DG9A 1QO9A 4B74A 4MTLA 3HFSA 3V97A 2FPMA 1Z3IX 4O8CA 5TQ0B 2F5PA 1GA1A 5EKUA 1RADA 4N8DA 5LVAA 2ZUEA 4YJ2A 1AK1A 3AETA 5FI5A 1MT3A 3LBYA 3SLKA 3BQMB 3G8YA 4KZKA 4PWZA 5E1BA 1N9KA 5CW1A 4XQ9A 2Q21A 5CMLA 1TZJA 3TD2A 4LXTA 3SS9X 3ZV7A 3I1JA 5EJFA 1F5SA 1H2XA 2J0UB 4LXGA 1CUAA 4V39A 1D0MA 2ECKA 1GZ5A 1ZD1A 1X74A 2D3WA 2Y66A 1PUXA 3ABSB 3AETB 2AOXA 3HDJA 3O8QB 3PYMA 1Z29A 3T9CA 421PA 3PDHA 3O95A 1I4OA 4D4JA 1F0KA 2WDZA 4YAJA 4HQFA 2N47A 3QUCA 5TMBA 4B45A 4YRNA 4Y1GA 4Y9RA 3NDBB 2GPNA 3EXAA 2GPSA 2ZWMA 3EARA 3I92A 3IR5A 3ZIUA 1DG1G 2SKCA 3JTMA 2C9YA 2CCGA 5G1PA 2F2TA 4OBEA 3VVLA 4JXKA 3E3MA 1DAOA 2Y0PA 4G5QA 1SUEA 6ADHA 1ZK4A 4DKXA 1VIDA 5AKXA 1EPUA 1ST2A 5BWNA 5HQ3B 1RAFA 1K7EB 4AX4A 1I14A 4URVR 3JPYA 4QXAA 1DJLA 1QM5A 4TTJA 4EYSA 1K8XB 3LX8A 2Q3BA 3AHIA 2QUHA 4BNTA 4C2BA 1R16A 5KYNA 1KWGA 1NQWA 2E55A 4OQNA 2IUUA 1RXYA 2CN1A 3CTMA 2YY6A 1LLQA 4JSYA 3O26A 4LF4M 1T4GA 1IN7A 2FTKE 4XPIA 5DK6A 5C46F 2CNWD 3EY9A 1I2AA 1K3UB 1YI1A 3ESRA 4RZUA 3KQHA 5A3JA 1LSSA 2HLDD 3O38A 1ISFA 4WSOA 3R8XA 3RWMB 4CQNA 1H3NA 2ZRAA 5DBGA 2M32A 5MN5A 4O63O 1OOEA 3HPRA 1QH8A 4HXEB 2IOFA 4JELA 1HBJA 3OTQA 3KOYE 3CE9A 4X45A 1P33A 2F48A 2X8JA 3JX9A 3VKUA 2BKUA 5D84A 4AF8A 3K9GA 3LT4A 4LOLA 4CN9A 2QL6A 1KKLA 1K06A 3R5FA 3HO1A 4EMTA 1DZ3A 4R2MA 1P9OA 4G36A 3C8UA 3TZEA 4WKNA 2MSKA 1BWRA 5K3CA 5EMKA 2J67A 3P9SA 1HQKA 2Q6TA 3X1WA 2ZWPA 3IAAA 3QHQA 3SSNA 2BFEB 1W2WB 4HRXA 3AJEA 3ZW8A 4Z1MA 5DBFA 5KWEA 4HAYA 3PDUA 2DP4E 3MYYA 3Q41A 4HG2A 1E1YA 4Q4JB 4Z1MD 1TADA 2RFLA 3I09A 1F2TA 4G8DA 4HH3C 4WKBA 3RSGA 1T1EA 1L5RA 1MAVA 3UAOA 1U1DA 5JI3E 5FLXA 2OBYA 2JJQA 4OLJA 1O2DA 1VA5A 4IH1A 5JXIA 5GIOE 3H05A 3RU2A 4FZ5A 1XEFA 5AQEA 1WMSA 1OBHA 2BBTA 5J47A 1JU4A 3DEIA 1BWQA 3AXSA 4IDCA 4QGHA 5G0VA 4W99A 3A6KA 3QKSA 1DBWA 4IQFA 4YA6A 1QHHA 3H4MA 2XUZA 3IGFA 2PGOA 3QPWA 721PA 2WFMA 5BOSA 3ZWPA 4Q24A 1M34A 5BMVF 4IUYA 4R4JA 5GV7A 1DQRA 3DT9A 4FD2A 1BDJA 2D0PB 5TMPA 5AM1A 3UENA 1QTRA 3IUQA 5GPBA 1HT3A 1KY2A 1FZQA 3NR2A 3OO1A 2ZRMA 1XB2A 1VI5A 2YMPA 3E7WA 1KZGB 1GFSA 1YVEI 3WNVA 5JS7A 2TMDA 1BDHA 4BMSA 1T0HB 4BKUA 3PL1A 1W93A 1Z4PX 1VHDA 2P9HA 3A3NA 1XHLA 4ZU6X 1K68A 4AURA 5LD2C 5K6AA 3VNVA 1ENOA 2J4FA 4QE3A 2QD1A 2I6QA 4B47A 4EJ6A 3RFWA 3EAFA 2X6RA 5EUBA 1R4ZA 3L28A 4WUVA 3KEGA 4ZALA 2KA6B 4I3HA 1P4GA 2FZLA 3AV0A 5E8RA 4NAHA 2VNHA 4L2IB 4CF4A 2QVCA 2EIXA 4DF3A 3HSSA 1H6UA 4GITA 1ZYUA 5ITXA 1AN9A 5AM4A 3CX8A 3QSGA 3JATA 4CGZA 4XYEA 1BC5A 1YJ5A 1U9CA 3IUNA 3MJ4A 4HX2A 4Z0HO 4G0XA 4LKRA 5ILGA 2NPIA 1RJGA 1FY2A 1MG0A 2QDKA 1G2OA 2XWQA 3SHGB 2ZQZA 2NTJA 2YMLA 3LPDA 2A3NA 5KPZA 1TLLA 3TL6A 4EVSA 4X6UA 1Z4OA 2C98A 3Q10A 5FEMA 1HNZM 1J0CA 4S2EA 3RSZA 5EJ6A 4IXDA 1MRSA 1P0IA