1G5TA

The three-dimensional structure of atp:corrinoid adenosyltransferase from salmonella typhimurium. apo-atp form
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
157
structure length
157
Chain Sequence
ERGIIIVFTGNGKGKTTAAFGTAARAVGHGKNVGVVQFIKGTWPNGERNLLEPHGVEFQVMATGFTWETQNREADTAACMAVWQHGKRMLADPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGHQTVIITGRGCHRDILDLADTVSELRPVKHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords COB(I)ALAMIN ADENOSYLTRANSFERASE
publication title Three-dimensional structure of ATP:corrinoid adenosyltransferase from Salmonella typhimurium in its free state, complexed with MgATP, or complexed with hydroxycobalamin and MgATP.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 53
structure length 157
sequence length 157
ec nomenclature ec 2.5.1.17: Corrinoid adenosyltransferase.
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02572 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1g5tA00
3X1WA 2CNWD 4FI3C 2MMCA 4Q66C 4ZI2A 1UKZA 2FJUA 2ONJA 1II8B 2V9PA 3FKSD 4UNPA 3FTQA 2EYUA 3GLHA 2YV5A 1OH7A 5FOWA 2HYIC 2FF7A 2UZ3A 4Z8XA 5FPTA 5JJLA 3EZ6A 3CR8A 1NMZA 4TQAA 3IEUA 4QC2A 4Q4LA 1KJZA 3B1XA 2AX4A 4Q4AA 5E7IA 3OF5A 1RRCA 2ZRDA 4BLSA 2ZE8A 3GJ8A 4QNRA 3AM1A 4FINA 2QUZA 2GKSA 1AS2A 2QA5A 4IOMA 2P67A 4LPSA 3TGPA 3TE6A 2J0UA 4QHTA 3IO3A 4S35A 3L0OA 1SVSA 1VECA 4LCBA 2CL6X 2OFWA 3GJ7A 1KKMA 2B7CA 2F1HA 4KVGA 1GKIA 1ZMXA 1VPLA 1RFLA 2QQEA 4JLNA 3V4FA 4OL0A 2EW1A 3CRW1 3QKRB 4NYIR 2O8CA 4B2LA 1KNQA 2ZR0A 3U4QB 2JLQA 4B32A 4C3ZA 4B47A 4DLRA 3QF4A 4D80A 1KI7A 4JBXA 3SYNA 1DAKA 1RJ9A 5FBVB 5DYIA 1YZUA 4HDQB 1MO6A 4ITRC 4O25A 1BMFA 5DGXA 2QN6A 1G9XA 1M2OB 4DEYA 1DBSA 2OILA 3U7GA 4GP7A 4KLZA 4AY2A 4TYPA 1YZGA 3I3SR 3LVRE 4MUBA 5LD2B 2GRJA 1Z0IA 2F43A 1N0UA 2GJ9A 2P5SA 3PUZA 5DHFA 4MA4A 2IYQA 1NY5A 2VH5R 4YXWA 1OXTA 2QGNA 3RLFA 2IEYA 4PQFA 2WWHA 4UXJA 4EPXA 2RHMA 2CMKA 4QM6A 1ZRHA 4Q9KA 2FMXA 2A5DA 2Z0MA 2BEKA 1JALA 5CIQA 2GVDC 3PEWA 2ZI7A 4G1UC 1W0KD 1YRAA 2DFLA 4N3NA 3CBQA 3SR0A 5KSZA 1NG9A 4BPBA 2W6ID 3FB4A 3ADDA 1IM2A 1FQKA 1TUEA 3EARA 4OI1A 4DLTA 1QHIA 1UDWA 1BKDR 3TUIC 4TTPA 1UBFA 2OSBA 2GEVA 2BEJA 4LHZA 3W3ZB 4OI0A 5BN5A 3BD9A 3BRWD 5DI3A 4JLJA 5SZIA 3LXXA 2PMKA 3LD9A 5DE3A 5KOYA 3CF2A 1G7CA 5GJBA 1NKTA 5ELXA 2IUUA 4KODA 4Q1EA 1NVXQ 1XRJA 4B3FX 5J4KA 4PZLA 1BS1A 3QKRA 1X1SA 3NHBA 1KAOA 4GOJA 5KDLA 2E1RA 2RGGA 1JR3E 1W36D 2OAQ1 1FL9A 3RRMA 5BW8A 1DS6A 4HB3A 4PZYA 2NO7A 3KXIA 4UXIA 4I81A 1AQYA 1TEXA 3AVVA 1JEDA 2QPOA 2P3SA 3FVQA 3K9LA 2ZAOA 4OK3A 4LJ7A 3BB3A 4V0ME 1DTSA 4Q47A 4BZQA 5EE5B 1YZKA 2GCOA 2ZVPX 1A5TA 2LCFA 3DO6A 4AG6A 2V3CC 3KXKA 4TLCA 5C18A 3CNOA 3GP8A 2YVUA 2PZGA 5IK2D 5CIWA 2XXAA 1R5BA 1ZC4A 2KBEA 3AH8A 3O8BA 4M1WA 1KK0A 5A5GA 2DPXA 1W47A 2WPDD 4F91B 4TMTA 1QHHB 1JNYA 3M1IA 4R71A 4OK5A 4TQ9A 5B2ZA 1Z06A 4PR0A 2WPDA 3QENA 5CM8B 2PL3A 3ZVNA 2J0SA 3NDBB 3RSOA 4MDEA 4ZDWA 4YMSA 4PSVA 2V6JA 3CZPA 3CW2A 2IUTA 5CB6A 4LJ5A 1R0YA 4KYUA 421PA 2ZUCA 3OEED 4CGZA 3W34A 4AKEA 1Y63A 2G83A 1T4GA 2G3YA 1D2MA 1YZTA 4Q5IA 1CRPA 2B92A 3CLVA 5E3HA 1E69A 1P2VA 3L0SA 5CJPA 2AKYA 1DAFA 3NH9A 3GLFA 3KQLA 1X1RA 3MJRA 1TF2A 2CLSA 2PLFA 1G3RA 2ORVA 3VHXA 4KFTA 4US0R 1JECA 4M9SA 2PLRA 1ZM4A 2ZIAA 4HI0E 1GM5A 4MQBA 1S9DA 2EQBA 1F3OA 2ZS8A 1EFHA 1UBEA 3C4JA 3K8YA 1F2UB 1YQTA 2GCPA 2JEOA 5GJWC 3W6NA 2YHSA 3AF4A 5BYKA 1R0WA 2D2EA 3T5DA 4QJ5A 1LVGA 1XD8A 1NJGA 1HE8B 1NLYA 1ZUHA 1EFCA 1MV5A 4GI7A 4EJSA 2IC5A 3HYRA 1LNZA 1TQ2A 3T1VA 3U3RA 1KSGA 3KKOA 4DWJA 4DB4A 2JLUA 3WYGA 2FZ4A 2CLDX 4DCVA 3EZ2A 4NYMR 2CCGA 1G19A 4QBHA 3MD0A 1VCOA 5FUXA 4S2EA 2PJZA 2QBYB 1CJUC 3PJRA 2QTVB 1MOZA 3GLHE 2ZU0C 2ZI9A 1QG2A 2WKRA 1KI1A 3C5HA 4QHYA 5KSPA 1I2MA 1ZNZA 3WMEA 4A2QA 2JAQA 4TL8A 1Z3IX 4B3GA 1XBTA 3AKCA 2IX3A 1Q1BA 1SGWA 2ZJBA 4NCIA 4KVAA 4ZCMA 5EP3A 3QXCA 3THWB 4LHWA 5FOTA 4LOAA 4HZUB 1MO3A 5TVKA 4TTRA 3EXAA 5EUQB 3JZAA 3ZYCA 1DADA 1HTWA 1G8PA 1NN5A 4A2WA 2V54A 5KDDA 3EPJA 1XD2A 2VPPA 2ZVQX 3PITA 3R9IA 2ZU6A 5CYPA 1QF9A 1YE8A 1OFTA 3BB4A 3AB3A 4DBLC 2Q9BA 2DYKA 2IHBA 4ZPXA 1IY0A 1OXSC 4I1SA 3ZLJA 2WMNB 1ZUIA 2IYVA 3TQFA 5FR2A 4ACBA 3AVUA 1T3HA 4PSKA 4WZBE 2Z4SA 5IHPA 5ANRB 3NTUA 2GWHA 2KB0A 1ZM3A 2AR7A 2QMHA 4NBSA 4LJ6A 2XJ4A 3QNUA 2BCJQ 2Q6TA 2X19A 3CNNA 3LV8A 1DARA 2FU5C 3MRSA 3FOZA 2QQ0A 4Q7LA 4JLMA 1OE0A 4TLDA 1JR6A 1CU1A 1QHGA 2BVNA 1SXJA 3TR5A 3ZJYA 5KUTA 2QM7A 4UQOA 2BMDA 4MGIR 4RVCA 2WSSA 1ZP6A 2KI5A 1SXJD 1OFHA 1Z6GA 2JIZD 2YNMA 5FTMA 1KDTA 4TSFA 2YJTD 2WWXA 4JLKA 4GL2A 4M1YA 1HYQA 2OT3B 3VX3A 3I72A 1NL3A 4QXAA 1IXRC 4JVSB 3M6AA 4JZKA 1VG0B 3H2YA 3DPUA 2VP4A 5EZ5A 4B48A 1S3GA 5P21A 3SU8A 1NJFA 4KLNA 2GJAA 3VNVA 2PBRA 4EAQA 1OXVA 1ZU5A 1VHLA 2ZUBA 4U02A 1IN7A 3ZS8A 1Z08A 1AZSC 4XH9B 1E98A 3OAAA 5JFGA 1RW4A 2ZJ8A 4G5GA 4DVGA 2RH5A 3K0FB 4PAOA 4QL3A 3F8TA 4HUQB 3HPQA 2C95A 3IILA 5DYGA 2AD5A 4LYJA 1DO2A 2JASA 3R20A 2VA8A 2W00A 5FBWB 2GBLC 5C1BA 1DELA 1N6LA 1IJFA 2PCLA 1E0AA 1GP2A 4WBSA 5KTYA 2ZI6A 2QPAA 3W90A 1HY3A 1HQYE 3VQTA 4ZIRA 1XJQA 2CXXA 1VYTA 4PO9A 4AK9A 2GZDA 4V0NA 2ZJ2A 1NP6A 1W4BA 3AUXA 2HXYA 1Z07A 5EE3A 1T91A 2IA5A 2FEOA 1XMIA 4KCGA 4BFTA 2OEPA 1WE2A 1ZVQA 4B35A 1E2DA 1UFQA 1F6BA 1XTRA 1NBME 3K1JA 1T5IA 3ZIAA 3OEHA 4JT2A 4KYIB 4E03A 4LC1A 3QY0A 2DWOA 4NU0A 5F2EA 2PT5A 1GUAA 3TAHA 3KDSE 4N0DA 1UAAA 3B1YA 5BYJA 4Q9JA 1ZD8A 1SXJC 2RB4A 1Q20A 1RKBA 1SVMA 1ZYUA 2IYTA 1Z6TA 2E9SA 5L3RA 3CIOA 3AP1A 4IVQA 4BEBA 2ATVA 2R6DA 1M7GA 1R8SA 2YWEA 4M1TA 2O8EA 2FSIA 1ZD1A 2QNRA 5JWHA 2X2EA 1EFRD 4XVUA 5GVSA 2BBTA 4B74A 2FFQA 1E2PA 5JI2E 3C7KA 4GZMA 1SHKA 2IT1A 3GJ6A 3UXMA 1YZNA 2RGNC 3KQNA 2ZSEA 2V4ZA 4UKDA 3U3MA 4OHYA 1LW7A 1P9NA 5DI9A 3TVDA 3U2QA 2CDNA 2QRZA 3Q7QA 4A2PA 1IAQA 1CRQA 1WA5A 5FI1B 3RSLA 4BFYA 5HZHA 3AP2A 5JSZA 1SZPA 1JPJA 2Z43A 1Q44A 4WA7A 2ZJYA 2CCKA 3H86A 3DKPA 3OE7A 3R9WA 4XWOA 3Q3JB 4OQFA 1XD2B 1IHUA 3G0HA 2O0JA 2H5EA 2FFAA 1HT1E 1VTKA 2XTZA 4TYNA 5JJIA 2GF0A 3EAQA 3JVVA 5JWRA 2WSMA 1M74A 5FOSA 4YDHB 2ZRBA 2O8DA 5K8IA 1E9AA 5BQ5A 2PX0A 3WHKA 3VKHA 4WZAE 1XTSA 3DL0A 3L8ZA 4HB2A 1H8HD 5H68A 2IYRA 3A8TA 4A92A 3BH6A 1U9IA 2WICA 3T1OA 4NL4H 4F93B 4DCSA 3O8DA 5FUWA 1OKKA 4M2LA 4LBVA 3DDCA 4ASUD 4KSBA 5FUVA 2GEDA 2IWHA 1QHHA 2DWPA 4JSYA 1G64A 4MGKR 4OHXA 3RWMB 3U3JA 4B75A 3B7GA 2ZRAA 2GK7A 1E9FA 3Q7PA 5G40A 4HB0A 1KMQA 1QDEA 3ND8A 4ON9A 2FSFA 3B5JA 2GZHA 4EQ6A 2J0VA 1RE0A 1QRAA 2OO7A 2VP5A 3ZD6A 1P2SA 3RRYA 5C46F 1I4LD 1SVIA 3C41J 2WOOA 3QIAA 4NCJA 4OQXA 4TL6A 1ZD9A 1H8EA 2X77A 2H92A 5BN3A 4RKEA 3TNFA 1D2NA 3I4LA 5SZKB 1PLKA 3DMDA 2OG2A 3PUVA 4M1KA 4DDUA 1XFAA 3X1DA 5B64A 4G01B 3A1VA 4DCUA 5GJCA 3FKSA 2G6BA 4G5RA 1P9RA 3BH7A 3SYKA 1S0UA 2BV3A 2JGNA 3K0CA 4FCTA 1ZJ6A 1QHNA 4TLAA 4KU4A 1T3LA 3CX6A 4NE2A 1G17A 5EE0A 2EWWA 1D5CA 3U6BA 4AKHA 4HEJA 1N5LA 2VP9A 3CR7A 4Z1MD 2W0SA 2IF2A 3CKLA 4LV5B 4HUQA 2ZUDA 3NG1A 3A4LA 2ZRNA 4X8OA 2BC9A 2QP9X 3FHCB 1ZCAA 4D4LA 2CHQA 2JLRA 2JJ8A 4DIDA 2ANCA 3EZ7A 521PA 4PC3A 2VL7A 1P9WA 2IHYA 1O3YA 1Q0UA 2QI9C 2J59A 3A4MA 4LRWA 2W2VA 3SDZA 1US8B 1E9BA 1E0KA 1G8GA 1R5NA 3LQQA 2OAP1 3MJHA 5DLQC 1OB5A 4EUNA 3BAFA 3OZXA 1E9EA 3SE0A 1Z0FA 2UKDA 4N0EA 2CBZA 3NBXX 4EPVA 2VP2A 4U7DA 3THXA 3LDAA 4BLRA 2WWIA 2NO6A 2NZ8A 3BIFA 4RD3A 4DLYA 2QL6A 4JLVA 1E9SA 2ODBA 1DAEA 4P4TA 3I8XA 3GLFE 4J0QA 1Z2CA 1GNRA 1YRBA 3RRZA 2AXNA 3C16C 3ECCA 3ZH9B 3VHLB 1HUQA 4XIGS 2N42A 3T12A 2A2ZA 4OBEA 5JMTA 2ZREA 3KFVA 2OE2A 1E96A 4TLEA 1GILA 4LGMA 4Q21A 4Q1AA 1S96A 3NKVA 2A30A 3QEOA 4LJYA 2C99A 1N5IA 2IXEA 3NXSA 1OPXA 4C0JA 2GXAA 3K9NA 4R7ZA 5JHHB 2IK8A 1U0LA 1W0KA 2A5GA 4A82A 1KDOA 3BFKA 1NIPA 2AK3A 2W6IA 4URWR 1E32A 4IFEA 3KTAA 4WXPA 3X1XA 2XOKD 1OIVA 3K70C 2EFHB 3ZD7A 4MYCA 1LV7A 3CRQA 3AF1A 5EXXA 1GAJA 1PUIA 4Z8YA 2Q3MA 2IYSA 4NYJQ 4RD2A 2XXAB 2IEZA 1JXOA 4FMDB 4TQUS 1UKEA 2OLJA 3JVUA 1GZSA 1ZU4A 2R8RA 1OFIA 4JT4A 5JS7A 3QKSA 3TW8B 2HT1A 4C30A 4AURA 3KQUA 1CULC 5AUNB 4FD2A 4NYMQ 2XB2A 4C0SA 4PTLA 2VO1A 3NDPA 1FX0A 4JSTA 2CHGA 1T5LA 4OJKA 4Q00A 2CEAA 2G1KA 2O5VA 4BFSA 2WV9A 1DOAA 5FBRB 1XZQA 2ODWA 2O8DB 1N6HA 4BLOA 2FEMA 1FOEB 3EZ9A 2GDJA 2GF9A 1XX6A 3LQRA 2ATXA 3GQBA 2BOVA 1W7AA 2WJIA 3LX8A 2D7CA 3VFDA 1P60A 3A6PC 1W0JA 4DB2A 5F3WB 1KSFX 2DBYA 2GJSA 3NBFA 4DSUA 1NG1A 4PXAA 2WVJA 1E0JA 3TSOA 4Q9LA 3QXHA 4FCVA 3L2OB 4LDJA 3W5JA 1HURA 2GJKA 4BFZA 4XWKA 1KY2A 2YKGA 1N6KA 2VTKA 4TTQA 2NO1A 1KIMA 4V0OA 1KO8A 1Z47A 1LS6A 3VU9B 4HAYA 3WBKA 5KU1A 3KUCA 5SZHB 1E6CA 3SQXA 3AVTA 5CK4A 3AEZA 2ZQ5A 3K9GA 4I1OA 3WNDA 5AJXA 4XVRA 3RNLA 4LHYA 4NP6A 3K0FA 2DFNA 1TL7C 1UEIA 4PX9A 1E2MA 2EFEB 4DLSA 2BM0A 3BK7A 1E4YA 1T3SA 3IBGA 3PV0A 4JVLA 1W2HA 3BFXA 1JAIA 3OEHD 4D26A 1NMXA 5JS8A 1D8TA 4V0KA 3N70A 4A0GA 4BLPA 5AR1A 3UPUA 4GP6A 1N5JA 5LB4A 3V9PA 4LBWA 5KPJA 4Q02A 3Q5EA 2C78A 1IN5A 4MDFA 3QXSA 2FGJA 5EP4A 1OHHD 3VNUA 1FFHA 1G3MA 2IXFA 2XAUA 4OHZA 2ZSBA 5FTJA 5DN6D 1E1RA 3ZIAD 3UMFA 2C77A 2J41A 1G6HA 2C9CA 3GLHB 1W5TA 3BE4A 3TIFA 4Q1DA 721PA 5GADl 2EFGA 2C8VA 2VHTA 1DAMA 4EIWA 4BLQA 1MKYA 4P4UA 1RYFA 1RIFA 4W5WA 5DSZA 2C98A 2KSQA 3K0AB 4MRSA 2J5XA 2H8KA 5KNCA 3ONWA 4LC0A 1N6PA 3EC1A 3BB1A 4JL5A 3EIEA 3ADBA 3MFYA 1FW6A 3W6PA 4IVPA 3BOSA 2GXUA 4GFDA 5J40A 2RGCA 5TARA 3I1FA 2VBCA 3QVVA 2ODNA 4LJAA 4Q48A 1CEEA 4R2IA 1OT3A 2FFBA 1YR7A 5AUOB 5D3MB 2W2XA 1K5GA 3DMNA 5FOVA 4E07A 2AN9A 2ZPTX 5JCZA 5JCPA 2PZFA 1U94A 2V6IA 3VR2A 2BWJA 1XZPA 3THYA 2HF9A 5G53C 2ZE5A 4RD1A 2CE7A 3KX2A 4BRWA 2QTFA 2ECKA 4KFSA 4Q1CA 1QHYA 1KK3A 2CLCX 3QF4B 4IXMA 5JJKA 5J47A 4P33A 3U5ZB 2REOA 2GZAA 1G8FA 3OHMA 4YONB 1YJ5A 3H0KA 4PANA 2VQSA 3TBKA 3I5XA 1VCNA 1EFTA 5HCIA 2ZYWX 3OIWA 1TTTA 1CBUA 1GTVA 1KI6A 3QPVA 4FXPA 4MGYR 4DT1A 5L3QB 1MRSA 1NLFA 2DB3A 2JCSA 1LTQA 5KO2A 2QY9A 2OV2A 1OFUX 4UNQA 1X86B 2F1IA 4FWIB 4A0HA 3MCAA 4GZLA 2VHUA 4Q03A 4R2HA 1XEWX 5KNBA 1KI9A 5KHOC 1D9XA 1E2EA 2IYXA 2JLSA 3GLIA 3CONA 2F55A 2XGJA 2OUKA 4PSAA 2C9YA 3ND9A 2QENA 2R62A 5L3VA 4TZ0A 1J90A 1AKEA 3I8SA 1AGRA 3K70D 1KDRA 4WZ6A 1OXXK 4IKEA 3LW7A 1FMJA 1U9IC 2YWFA 2BIFA 3LO5A 1XJ0A 2HUPA 2ONKA 2DR3A 4F4IA 5J4VA 1CR1A 2OFOA 1DG3A 1YHNA 2P6UA 3HWSA 4ILEA 4DSTA 4F4CA 5G41A 3BGWA 5B58C 4AC9A 3FHTA 3SN6A 1T0JB 3U7FB 4C0BA 1QHSA 4RD0A 2KE5A 1KJWA 1YR6A 2PX3A 2AKAB 2QMOA 1VIAA 3CNLA 4MITA 3TKLA 1YR9A 3HU1A 2R6CA 4C0HA 3K09C 1OB2A 3W8NA 2QPTA 1N5KA 3PUYA 1ZNWA 4M0LA 1W44A 3HDTA 4KV9A 5GJVC 4FCWA 1MRNA 3IQWA 3AVYA 3SBDA 1TEVA 4M8NE 3CO5A 4W5HA 2WIAA 3UATA 2IS6A 2MSEB 1D6JA 5CB8A 3I5YA 3CF6R 1GRNA 1OIXA 1KMHB 2I1VB 1WQ1R 2JATA 5M04A 2Q0HA 2TMKA 1S1MA 4POAA 3GEEA 4RSGA 3OAAD 1ZNYA 3ZS9A 4BFVA 4HYYA 1IJEA 3WP1B 5H8WA 4ZCLA 3E70C 1ZCBA 4E22A 1PVOA 2G0TA 1E0SA 2R9VA 4A6PA 3BERA 2QZ4A 4QG7A 4QM7A 4HATA 4N1AA 3MWJA 3OE7D 3THXB 2FX3A 4QOSA 1G6OA 1KO1A 3R8FA 4ABYA 3R7WB 2JJ1A 2VIIA 4WAUA 3AVOA 2ZEJA 4LX0A 1U8AA 4JLDA 4RKFA 2BJWA 4R98A 4RFSB 3VKGA 4V0MA 2OBMA 1HE1C 821PA 3UK6A 1NSTA 3QPWA 1A1VA 3B82A 1W4CA 5HR5A 3FMFA 2PT7A 1F5NA 2XX3A 1JR3A 5EP2A 5LB2A 3ZZUA 4PPQA 1XCPA 4D4MA 5J4YA 3QG5A 1N2CE 1XPUA 4AKGA 4CF7A 3CH5A 4NZYA 4FMDF 4AIIA 4B43A 1UBGA 4M9QA 2YZ2A 1DO0A 1S3SA 2VF8A 1G4UR 3SJBA 4JJZA 5JWOA 2XEXA 4JKYA 2HJGA 1GDDA 2XNDA 4P32A 2C9OA 4XSGA 4KO8A 3OIYA 4MKGA 4LHXA 4F7WA 1NN3A 3FMPB 2QMUA 4A15A 2YC2C 1L4YA 1TQDA 1NSFA 1OXUA 5JRJA 2XITA 1GSIA 4IDHA 2KWIA 4US2R 1NBMD 4MKIA 2B8TA 5E95A 1VHTA 5FPHA 1OYYA 1XDBA 3U44A 4A36A 5AJWA 3ZVRA 5IF9A 3EWAA 2R6FA 4PC7A 1VYVA 4TT3D 3EASA 3T61A 3ICEA 1EK0A 1VG9B 1Z8FA 3PCRB 2NO0A 4AWXA 4K46A 1UF9A 3NC0C 1II8A 1KK2A 1RRGA 2QP4A 2B7BA 1S8FA 3QG1A 2QP3A 2QAJA 2O8FA 2HT6A 5FPYA 2LKDA 3VR3A 1P72A 5J5CA 4F4JA 4QJ3A 1OSNA 1RRFA 1OKKD 4XTRA 3FWYA 2WOJA 4ASUA 1ZAKA 1P2TA 3SFZA 2BMJA 2ZXUA 4TWZA 1M1YE 2WAXA 1V5WA 2FFHA 2J87A 1SVKA 1J70A 4H9GA 1KNXA 3PEVA 4RY2A 4G0NA 3WY9A 3RS2A 3EX7C 2FSHA 5F98A 3LRPA 4TL9A 2EU8A 4BGDA 3O8CA 1XU4A 3EPKA 4F92B 1X8JA 3WMFA 3KJGA 2JJ2D 1KO7A 4A8JA 1XMVA 4I99A 2NG1A 4C7OB 4Q18A 2H17A 1K5DA 1JR3D 4LZZA 3VR6A 4L16A 3QUSA 1J2JA 1XMSA 3S1AA 1CJMA 1AA9A 2YWHA 5KPDA 2YOGA 3HU3A 2VYFA 3C15C 3K0CC 4LUCA 1G3UA 1PZNA 3ZDQA 1TQ6A 2D06A 2ORIA 1CKEA 1JAHA 2XNDD 1K6MA 2ZSFA 2GILA 2J7PD 1KO4A 5TXGA 4DEXA 4JLPA 1UM8A 2KBFA 3FMOB 4IDNA 3T34A 4QFMA 2X1VA 3AKDA 1NNEA 4TYYA 4UXHA 1KI2A 2CNWA 1XNJA 2R6AA 4B3XA 3CX8A 3GJ0A 4NCHA 3HR8A 4LV6A 1YR8A 1QZXA 4W9MC 4B71A 3OESA 3FKQA 2QROA 1E2FA 4PQYA 4TT3A 2ZR9A 3N2IA 2NIPA 2WSSD 1XTIA 1EFRA 3RS0A 4PQRA 1ZIPA 3QSYA 2FWRA 1NVVQ 2ZSAA 621PA 2W6JD 2HV8A 2Q9CA 1R10A 4U5XA 2REXB 2B8WA 4Z54A 4AG5A 2CK3A 3TSWA 1RVDA 3OIUA 5HCNA 2IW3A 2VSOA 3FFAA 2B6HA 4URUR 2CK3D 4RFSA 2OCYC 4BWYA 2G1JA 2BKEA 2HDNB 2ZJOA 3BORA 2DY1A 3CPEA 3LBIA 2NTYC 2JLYA 2BKUA 5LD2C 2WHXA 1P73A 1SKYE 4RD4A 2JLXA 5D3QA 3RHFA 1E3MA 1FP6A 2EFCB 1FUKA 4IDOA 2IYUA 3CH4B 2ZRKA 3RS7A 2F1JA 4WIAA 1EXMA 4M21A 1ETUA 3I32A 1FX0B 1ZM2A 3LW8A 4MRNA 5JEDA 4JLBA 3TAUA 2QSYA 2WJHA 1G7TA 1AK2A 1XXHB 2FH5B 5A0FA 3CF0A 3MSXA 1OIWA 5FTKA 1KAGA 1N6RA 3MG9A 3L0PA 1C9KA 4PPFA 4YMWA 3P1JA 3GLIB 3NIBA 4YMUA 3B13B 5AWFC 1RYHA 2XOKA 5K8LA 4CYMA 3FDIA 4ZDIA 4JLOA 4KAXA 1US8A 3BC1A 1BOFA 4Y0AA 1IXZA 2XSZD 2HLDD 2V1UA 3A37A 1U8YA 2QGZA 1X8KA 1N0WA 1CIPA 3OEEA 3KB1A 1GFIA 1W48A 2F9MA 2XSZA 2NO9A 2RGNA 2ZTSA 3GFOA 3BXZA 4GBMA 1EX7A 5EUMA 5JI3E 1GNPA 4JYBA 3I92A 4G3XA 5KYKA 2VSFA 4CIDA 2RGDA 3U3KA 3FPAA 5L8VA 3ASZA 3M0EA 4GNKA 1ONBA 2CCJA 2UZIR 1S9HA 1K8RA 4FMCF 4MYHA 3KXLA 2G9NA 4GDFA 3SNHA 2O8FB 4Q4AB 1J7KA 4JL6A 1GITA 4FMBB 3K0SA 2XTNA 4M1SA 3AF0A 1E9DA 4JL8A 2HXSA 2WWFA 3QQ5A 1PLJA 4EDHA 1XXHE 2FGKA 4G5OA 1XF9A 2J3EA 3B1ZA 3KKQA 1Z5ZA 5DISB 1SVWA 2OBNA 2W58A 3EIQA 1G4AE 4BLTA 2GVZC 4Z51A 4DJTA 2Z83A 2ZRIA 1XEXA 4C0AC 3CPHA 2IBMA 4Z1MA 1Z0AA 3H84A 3PEYA 2N1BA 5JZVA 4PHGA 5CLQA 2DHRA 2UVQA 3PR1A 1W36B 1AGPA 3WMGA 2G77B 3AF2A 5HPYB 2JIZA 5L3SB 4XSHA 4NONA 1KMHA 1G16A 1XCMA 4L8GA 2OM2A 2AFIE 5IK2A 1T6NA 2C96A 1XJCA 1EFUA 3S1AB 1IN6A 5E7MA 3D3QA 1B23P 2DCUA 4BQSA 3K0AA 4NYJR 1TPZA 1U90A 1R7RA 3EA0A 2C03A 3P26A 1GL6A 2I4IA 1G3IA 2A5FA 2VP0A 4XD7A 1OLOA 1ZW6A 4LI0A 4NMMA 1AS3A 1W1WA 1WMSA 2FZLA 1NVVR 1JBKA 4LJ9A 4FMCB 1DG1G 3RVBA 3TRFA 1OH6A 1EWRA 1FPMA 1EX6A 1FUUA 4DRZA 1TU4A 4RZUA 2R6GA 4PHHA 1KY3A 3NEYA 3KJHA 2EYQA 4LJ8A 4UNNA 2ANBA 3LAWA 1M34E 3AVWA 5JHGB 1UKYA 5FBLB 4HZUA 2BBOA 4X8LA 1E99A 3QJYA 1XPOA 5HZKA 3W8RA 2IXGA 3VR4A 2IS1A 5CDFE 4ZO4A 4II7A 4A0RA 1Q22A 5DI3B 4IDQA 4BECA 1MH1A 1VG1A 2W2TA 1Q1ZA 1TAGA 3NVAA 4B76A 3QKTA 3QF7A 4H1UA 4IFBA 4CT4B 1E2JA 2Q21A 5F9FA 3U3OA 4B3CA 3NH6A 3FFBA 2HF8A 1T8UA 2RAPA 4HAVA 3L0IB 4DC9A 3Q8XB 5GVRA 1GNQA 2L0XA 4U00A 3DM5A 4GMXA 3TMKA 3PQCA 1TADA 4JLAA 5FPSA 4ESHA 3KB2A 1VMAA 2J9RA 4A1FA 3PEUA 4LYHA 1E2IA 5JBQA 3U61B 2F6RA 4EFMA 2BCGY 3QEJA 3C8UA 1AKYA 1JQJC 1Z6AA 4EFNA 1LY1A 5TY0A 1G1MA 1GKUB 3B78A 1R0XA 3U7EB 3OFNA 3ZQJA 1NIJA 1LF5A 1JPNA 2J46A 4IJMA 3WNCA 3B6EA 2FV8A 1L2TA 5CYOA 2QORA 3DOEA 3PFIA 1S2MA 1KK1A 2RKOA 2VHQA 3GJ4A 4D2IA 4Q01A 3TUZC 4QBFA 2WBLC 2A7QA 3AKEA 1N0VC 1UADA 3P32A 2RCNA 2ZJZA 1UPTA 4H1VA 4HAZA 4A8JC 2GXQA 5JEEA 1U0JA 3HPRA 4KXFB 4DLVA 1E1QD 2GHIA 2YC4C 3ADCA 3VTKA 2O0HA 4RZXA 1NRJB 3H1TA 4DDTA 3FE2A 3DKVA 3PUXA 1AN0A 3KKPA 4HLQB 2FN4A 2H57A 2V7QA 2LKCA 5FL7D 2H18A 1ZIOA 1I4DD 3V00A 1TF5A 2J45A 3B2EA 2XZOA 221PA 4HUTA 4ZCIA 2GEUA 3GEHA 2NPIA 1QVRA 1NKSA 2IYYA 1ESNA 2R65A 5IT5A 2JLVA 4DIEA 1IOZA 3AP3A 1E94E 1G5TA 3X1YA 2A3RA 4NDZA 1WB9A 2HJVA 1UDXA 2QG6A 4ARZB 3DHWC 4LV8B 3IHLA 4BRUA 4NPHA 3AGPA 4EPYA 5L3QA 4CEHA 3TSZA 2AK2A 2BJVA 3R8CA 4KFRA 4OJQA 4YMTA 1MO5A 4EFLA 2RGEA 3IEVA 3DZ8A 4LYAA 4JVNA 3F0TA 3SQWA 3RC3A 4DUGA 5C4MA 1GIAA 4BFXA 4PC2A 1P62B 4QHSA 5EJEA 5LDDC 1WBDA 1SKYB 1GVNB 1XCGB 1F48A 2NQ2C 5FI0B 3LA6A 2W83A 4P4SA 2BMFA 4CEIB 3GLGB 4MRPA 1UEJA 5CLLA 2AD1A 1J8MF 4XWAA 2ZRMA 3BS4A 4NCNA 2J1LA 3VU9A 2XJ9A 4TYQA 4QGGA 2ZRLA 1W4RA 1GRRA 4LHVA 3ICQB 2A5JA 4NHOA 1NBMA 2WJYA 2GTPA 4JS0A 1KZGB 4LWZA 2D3WA 1M8PA 3KKMA 1YKSA 3B8HA 3D31A 4HAWA 4QNMA 1U8ZA 1EGAA 3RS4A 1ANKA 4MH0R 2V8OA 4JBWA 4BFUA 1E79D 2Q3HA 2XZPA 3LFUA 3LXRA 1OH8A 4YMVA 1W0JD 3X2SA 5EE9A 2OCPA 4TMZA 3I61A 4GMDA 4PO8A 2KJQA 1QG4A 4B33A 4OK6A 4EJSC 4M1OA 1KJYA 3F3YA 2O8BB 4OQLA 1JB1A 3HJNA 2GESA 1Q21A 3RS5A 3U44B 2ERYA 2ZE7A 3SZRA 2IF0A 2HCBA 3LLMA 1Q3HA 5B57C 1M6NA 3QOFA 3U4QA 3NBZC 1UJ2A 1S1CA 4RJLA 3ZVMA 3HU2A 5FOXA 2QTHA 1RJ9B 3AGQA 4DKXA 4JVMA 3ZGXA 4R9UC 4L5BA 2XNSA 3TR0A 3D6TB 5B30A 5JRZA 2ZAMA 4KI0A 5FFMA 4GT1A 4O2LA 2ZYUX 4TLBA 4LPKA 3QKUA 1IY2A 5BN4A 1SXJB 1WDTA 3TQCA 1P4SA 2ZANA 2OXRA 4OI2A 1WXQA 2ZS7A 5EZ6B 2IS4A 4I1UA 2HEIA 1EESA 2WKQA 5D3MA 2AXPA 2VF7A 3C14C 3QXJA 3U60B 4Y0VA 3GMTA 3IQXA 3PENA 1T0HB 1LF0A 2ZI4A 3CM0A 4ZV4A 1WP9A 1GWNA 4C7OA 4WW0A 1BH2A 3B60A 1KGDA 2ZRGA 3W5IA 1FTNA 3MGCA 4KFUA 4US1R 2VHCA 5DH9A 1HA3A 4B2IA 1G7SA 2Y8EA 1G291 1L7VC 4YC7A 5EXTA 1IXSB 1J99A 4E5UA 3SFVA 2EWVA 2WKPA 4G5QA 4IOJA 2OCAA 2ZSDA 4D0LB 4B73A 4PHTA 2D4HA 3M4YA 2RMKA 4O2RA 4KBFA 3D8BA 1VCMA 1WBBA 3KL4A 2O8BA 3K70B 2QAGA 2FNAA 1G5PA 2C04A 2GCOB 2ZRHA 1VG8A 5EXSA 4AYWA 5JECA 2IYLD 3CX7A 1XB2A 1E79A 1II0A 1KSJA 2JA1A 4IEIA 1AZTA 1KTVA 3V4RA 3MWKA 5DIFA 1U2RA 2WJVA 4C0QC 2MSCB 2EFDB 3VR5A 3THOA 1VDZA 4CEJB 1BIFA 1H8HA 1MT0A 2JLWA 1PV4A 2WMOB 1JXMA 2ZE6A 4LYFA 4QBIA 4HDOB 3B9PA 1KI6B 4DT1B 2D2FA 4TL7A 3GJ5A 4MUAA 1TU3A 5TDHA 3GLGE 5CJ2A 2P6RA 3IGFA 4Q19A 1R4AA 1YZQA 5E4FA 4M9ZA 1LB1B 3TVTA 1G3QA 4AI6A 3IPXA 1DEKA 1LS1A 1G8YA 4PAMA 2X2FA 2QMEA 3AF3A 1JQLB 4MKFA 1NI3A 3E2IA 4YDSA 1XMJA 5CDFA 1NN0A 4Q7KA 1BMFD 2BHRA 2FPKA 4L9WA 1ESMA 3NHAA 1CJKC 2IWRA 4BZPA 3F5FA 2WJJA 1NY6A 2A78A 4NYIQ 3K09A 1CS4C 1YZLA 2O8EB 4RCZA 3CZQA 1H8ED 2O52A 3E1SA 4K81B 2IUSA 3EA5A 3TW4A 1F2TB 3WRXC 4B2PA 1TQ4A 4C0KA 4ZDJA 2GBLA 3LBNA 5C4GB 1DPFA 3L43A 1SVOA 2H1LA 2P2LA 1IQPA 1SULA 4KBGA 4UJ3A 2OXCA 2CHVA 2RGXA 3KJEA 4Q4JA 3LX5A 4DLUA 4A8JB 2PJRA 3GLFB 2WM9B 3IO5A 1ZM9A 4AYTA 1M7HA 2QEQA 3O47A 1F60A 1Z2AA 4AYXA 1G18A 4HZIA 4PAQA 3T15A 1D9ZA 3CRRA 4C0LA 1G5RA 1N25A 1WF3A 2H16A 1II9A 1A7JA 3REGA 4EPTA 3RDPA 1Z6XA 2PMDA 5AUQA 4A9AA 3GLIE 4MGZR 3IPYA 1P61B 2QBYA 2F43B 2W6JA 1KOFA 3AQ4A 4TMVA 5E7JA 1GOTA 2GK6A 2HCJB 4QBGB 3QE0A 3AKYA 4M4SA 2WWWA 5IDVA 3RYTC 5TB5A 2V1XA 3TK1A 1W36C 3RANA 4ZKEA 1U81A 4EJSB 3GJXC 3A1WA 5FL7A 2A5YB 4TMXA 2SHKA 5AK0A 4WXRA 5DO9A 3CB4A 5JLJA 2ZYTX 3UG7A 2BBWA 1FNMA 2ZS9A 1VKJA 3TH5A 4D4JA 5A4JA 4FN5A 5HKKA 5HE8A 1B0UA 1CR0A 3QXXA 1E1QA 2P5TB 1CF4A 2Z6VA 4B3DA 3BJIC 4XOIA 4EQ6B 4CDGA 4LK2A 1QHXA 1MABB 2CVHA 3ASYA 3LH5A 3A1UA 4TMWA 4BEJA 4PC6A 3KUDA 1KDPA 1E2LA 3R7WA 2ZROA 1YVDA 4LBZA 2N46A 3ADKA 4QGFA 3MWYW 3OIVA 4IOLA 3WP0A 2QAGC 3T06B 1CP2A 1AS0A 2F9LA 4LSGA 5EXPA 4KJZA 1DAIA 8OHMA 1ZUNB 1T8TA 3GFPA 1G20E 4UJ5A 2FOLA 3QI2A 2FDCA 1J8YF 2F7SA 2R2AA 4TMKA 5EQTA 4ACAA 3VMFA 4JBYA 1KI4A 4FIDA 5K8TA 1KZ7B 1X8LA 2IL1A 3MUFA 4RZ2A 2OHFA 2I3BA 2EVWX 4DCTA 5F9HA 2WZQA 3B85A 1NVUQ 2WAYA 4Q1FA 1E2KA 2ZETA 3NC1C 3J81k 1KI3A 2QE7A 2ZJAA 1OH5A 2QAGB 1AM4D 5J4HA 2YYZA 2OLKA 1NN1A 2AWNA 2JDID 3AV0B 4Q1BA 3SBEA 3SI7A 2O8CB 4RFVA 1XD9A 2XZLA 1O87A 1VIYA 4LY6A 2FSGA 5FH9A 1W49A 1XXHA 3REFA 4KITB 1COWA 4GOKA 3LBHA 5EP1A 1GKYA 1W46A 5CM9C 4CVNA 5CK5A 4AKIA 2F1RA 3CWQA 4OI4A 2QRNA 4IHQA 1L4UA 2A9KA 2WWGA 3UANA 2WIBA 5FUYA 1HEIA 2PH1A 2B21A 1BYIA 1WCV1 4GRAA 4MYUA 3GLGA 1KYIA 3MMPA 1GG2A 4CRWB 2ZI3A 3AVPA 3NBYC 4EPWA 5CITA 4KSCA 3EPLA 4D25A 1OF1A 1DVRA 4G5SA 1TX4B 3SC3A 4L15A 2J7KA 1Z0DA 2CVFA 2E87A 4D6PA 4IRUB 1P7CA 5AUPB 1YU9A 4OHVA 1P2UA 2BBSA 1JJVA 1A2KC 2ZI5A 5LPNA 1L8QA 3K0EA 4HDCA 1A2BA 5C2JB 1E4VA 1LFDB 1Z0JA 2ASEA 2ORWA 1ZC3A 1G8HA 3VAAA 1I2DA 2RHDA 5SZJA 4FW9A 4D4KA 1OV4A 2X8AA 3UG6A 2V7QD 4B3BA 2ZRPA 3RRNA 3SS8A 1N6NA 2JJ2A 3G5UA 4XD7D 2WJGA 3AVXA 3CWZA 3KQHA 1F2TA 2D62A 2HLDA 3EC2A 3KTAB 3SYLA 3A58B 1TF7A 3QBVA 3EPHA 1OW3B 4Q7MB 4MRRA 4Q4JB 4XTCS 1NF3A 1MO4A 2I1QA 2JJ1D 3L8YA 3ETLA 5FL3A 5L3SA 2ZRFA 1Z63A 2CL7X 4RCYA 4HSEA 4QGAA 4B6EA 4DSOA 3A1SA 3NEJA 3P4YA 4CZ2A 1W5SA 4YXWD 4PPGA 4B6FA 3SJAA 3QKSB 1Z28A 5H1YA 1A4RA 1CJVC 2JDIA 4NTZA 5DHAA 1OHHA 2ZR7A 4URZR 2REBA 3UMRA 1MR3F 1NMYA 3SHFA 2ERXA 2YINC 3GD7A 3N2EA 3PVSA 3BFVA 4OHWA 1XP8A 5AJZA 1HV8A 1KI8A 1U98A 2QT1A 1C4OA 3E5HA 2FPLA 2PCJA 3T1QA 3CRVA 4ZDKA 3Q9LA 2CJWA 4IDPA 4BUJA 2OCBA 3GPLA 1FNNA 1GL9B 2GXSA 4HLCA 3FHOA 3LVQE 4WOPA 1QVAA 1AJEA 1KHTA 3A1TA 3IIKA 3SEAA 1S4QA 1E9RA 3GJ3A 4HB4A 4HLDA 3WXMA 3ZZ0A 1E2NA 2W0MA 3RWOA 1W2GA 2OESA 4DXAA 1Z83A 5FTLA 1Q3TA 1R0ZA 4DUGD 2QM8A 3IHWA 4DDWA 4HLUA 1DE0A 3PIRA 1PUJA 4GSYA 3WBJA 3IDQA 1MABA 1P6XA 3WYAA 1X6VA 1G21E 2FG5A 3IKJA 4LJ4A 3MLEA 1EWQA 5HKKD 4KHZA 4M1MA 2QT0A 4YQFA 1SXJE 4TSFD 4CW7A 4BFWA 1RC8A 3AVQA 1GL7A 4JMPA 2Q9AA 1W4AA 4IVRA 2VP6A 1ELOA 1P5ZB 3FYHA 4X8HA 1HQCA 3UWOA 3UIEA 3ZVLA 2PEYA 2Q3FA 4DCNA 3Q72A 5FTNA 2WWYA 2ZJ5A 2Z5FA 4CEJA 1ZNXA 2OZEA 5LBIA 1XPRA 1DAHA 3HR7A 4PHFA 3BWDD 2BDTA 2VHJA 4L4UA 4Q7JB 4B44A 3EZFA 2IS2A 3K9HA 4HAUA 4TN1A 4FWTA 2PEZA 4NKRA 2FA9A 2O0KA 3IIJA 1FQJA 2XTMA 3LNCA 4IEEA 2CL0X 1F2UA 3EWSA 4D0NA 4MRVA 4CEIA 1P75A 4MYTA 3DVLA 4P3YA 3D7MA 4MKHA 2WTUA 3B1WA 1VCIA 5FOUA 1JEEA 1ZINA 4UNSA 5KSOA 5DN6A 1CR2A 2GETA 3QPUA 4RD6A 2MMGA 5EE1A 4V0LA 1E9CA 4C4PA 1RRPA 3LY5A 4URYR 5HE9A 4PFSA 1Z0KA 2GAOA 5FPKA 1AQUA 1E2QA 1IONA 4JIMA 1BO6A 3T35A 4CT5A 5BWMA 2YOHA 3A36A 4ESVA 3ZZTA 2K5UA 2C2HA 2J0QA 1CLUA 1JJ7A 1DAGA 3LWNA 5TV2A 3ZQ6A 2G0NA 1FMLA 4PPNA 4F38A 4QKQA 3PG5A 1SQ5A 3TJZA 1Q1EA 1R8QA 2GNOA 1BYUA 1H65A 3N5CA 2HYDA 4BZXA 3SJCA 1XTKA 3BBPA 3KJIA 4RZ3A 3DOFA 4C2TA 5IRCD 1FTSA 2XB4A 2Z4RA 3NWJA 1E2GA 3THYB 2OBLA 4DDVA 4E09A 4Q4HA 1TNDA 3U7HB 3P27A 1FP7A 4D0GA 3T1TA 4A6XA 4BE7B 3DEFA 4IOKA 1QBKC 2D7DA 1IN4A 3W3AA 4HLUC 4DSNA 2YOFA 4URXR 4OQMA 1UBCA 3UWKA 2DWQA 1SVLA 3CRMA 1XEXB 3RABA 1XEWY 4ARZA 3T5GA 3W6OA 2OFXA 1RPZA 1PJRA 4O0MA 3SOPA 2G88A 3WYFA 1EG7A 4I4LA 2ZM5A 3FGNA 1CR4A 4M9XA 4P31A 3QVUA 3FMIA 2V55B 4GPTA 2VRWA 3DM9B 4Q9HA 2NMVA 3TUJC 4D82A 3HP1A 3MWLA 3EIHA 5H70A 1ZBDA 1FZQA 4BASA 3SJZA 4ZKDA 5DNYB 4TZ6A 1IBRA 3VKWA 4IXNA 5KNDA 3UKDA 1HT2E 2F3TA 1Z6YA 4P0TA 3B9QA 1Z22A 2JLZA 1ODFA 2LWIA 1Q12A 2NOAA 1Y3AA 3O8RA 2ODEA 1N3BA 4PZZA 1V43A 4I1VA 1R5OA 1Z29A 2IYWA 2VSXA 1PLLA 2FE4A 2RGBA 4OYHA 4DLXA 1T9HA 2CJWB 4PC1A 2NZJA 4C2UA 3X1ZA 1SHZA 2H7VA 3TLXA 1I4TD 3BH0A 3LLUA 3HYTA 1X3SA 2IYZA 4QJ4A 4Q4HB 5HTKA 4Q9IA 4IW3B 2AHOA 5AJVB 2DFTA 3WRYC 4UNRA 2NGRA 4JKIA 4B34A 1OJLA 2RGAA 3RAPR 1OYWA 3GCGA 4XVQA 4OQNA 2J7PA 3P20A 4NCKA 2YWGA 5K8UA 1C1YA 1XTJA 3KKNA 2PZEA 2VEDA 1TMKA 3KZ1E 1XEFA 1CTQA 4K8OA 1KO5A 4URVR 3Q5DA 4DHEA 2DFKB 2AFHE 1SKQA 3B1VA 4WVFA 3PXGA 4HAXA 4M22A 5KSYA 3R9XA 4W5JA 1CJTC 2NPFA 4ZI3A 1RZ3A 3A4NA 2ZITA 1NLZA 2P6NA 2GAAA 2BM1A 3VR1A 5KDOA 5FR1A 5J4LA 3SHWA 4ZIRB 1P3JA 1WRBA 1N6OA 3WNBA 5G3ZA 2F3RA 3OFND 4NH0A 3RC8A 1Q57A 2P65A 4YLGA 1R2QA 1GRQA 5AJYA 4EPRA 1G7RA 3CPJB 4GOXA 4QGHA 2AL7A 2VLIA 4M53A 3Q85A 1CXZA 1AIPA 3MAAC 2QU8A 4DLZA 1XWIA 2ZYVX 4V03A 4D81A 3DZDA 2BMEA 4QRHA 3W9YA 3K53A 6Q21A 4AD8A 4JYCA 4V02A 3EW9A 5G3YA 3IIMA 1D2EA 3IUYA 4EKDA 5UKDA 2FPMA 1IY1A 1M7BA 3THWA 4DLWA 3IBYA 1A82A 1U99A 3CUEF 4O3MA 3QBTA 4DZZA 3KFXA 4ERNA 4PO1A 2J0UB 4L9SA 2ZRJA 4A0FA 4TYWA 5BXQC 3VX4A 3L82B 3PUWA 1G41A 1N6IA 1U0HC 1KSHA 5TMPA 2CE2X 3KQKA 3UMSA 4CEHB 2GCNA 1IN8A 1R6BX 3G82C 1KKLA 2D74A 1JI0A 3WHLA 2R44A 4OKSA 2C5LA 5FBQB 3GEIA 1UKVY 5JSZB 2ZRCA 3RS3A 3JZMA 2GA8A 4X8MA 2AWOA 3I62A 2P0EA 4A4DA 4W7SA 1E1RD 1HH4A 2QE7D 3H4MA 2MSDB 3U6KA 3C5CA 2QSZA 1XTQA 121PA 1E2HA 1VYUA 3P4XA 4XJXA 4LBYA 4JJKA 1NVWQ 4P4SB 3AUYA 3EG5A 3I73A 1TUIA 2GJ8A 3GFTA 4C9BA 1Q1QA 1COWD 1ZM7A
chains in the Genus database with same CATH superfamily
4RLFA 3PX3A 5JQGF 4FI3C 3LPAA 3L4BC 4LYGA 4WL0A 1RU3A 5B1IA 4ARBA 4DARA 1XPJA 2BZ0A 3VSCA 4DR4B 4H7FA 3FTQA 2EYUA 1SOWA 3PR2B 1OH7A 3R75A 3ODGA 1IK4A 5FOWA 2HYIC 2UZ3A 3VDMA 4TV8A 4ANFA 4ENRA 2OOSA 3GLTA 2FPIB 3IEUA 2CLMB 4Q4LA 2E49A 4F3TA 5DIZA 1VJ0A 1Q1GA 3DFUA 4LRSB 5ECGC 3W5CA 3G59A 5ILOA 4IXWA 2GKSA 1Q19A 2QA5A 2XWQA 3DT9A 3ORFA 3OOYA 4L51A 4AMZA 2P67A 4LPSA 1YJCA 2PH3A 3L6DA 3DBRB 2DE0X 4LWQA 4R8KA 3TGPA 1VB5A 1XVTA 2JI9A 4S35A 4TMYA 2RGWA 4GICA 3P5BA 4DG9A 1YSCA 2N0SA 4Y6OA 4N7MA 4L76A 2GBFA 4TTIA 5CCDA 3ORSA 2F1HA 1SQSA 1LZKA 4KVGA 4P3KA 4OFWA 3S28A 3T15A 5FFNA 4RTLA 3OCWA 1GKIA 1ZMXA 2AYZA 1PQPA 3L0DA 3HCPA 3IALA 1KA9H 4JLNA 3V4FA 5HF6A 4FX2A 1EUYA 3H13A 1QVVA 2O8CA 1UDBA 3I6MA 2PGOA 2ZR0A 5DBFA 4B2LA 1M10A 5J2UA 1L5OA 3W4JA 4QTZA 2LCQA 3ZV6A 3LQFA 4RVNA 4RK6A 3G85A 4GE3A 4HDQB 1MO6A 2DP4E 4ITRC 4O25A 5KHAA 3I9OA 1BMFA 4AXBA 4P0PB 2QGFA 1KOJA 1GTJ1 1N2ZA 3UTDA 3DW1X 2O06A 2JW5A 4J4BA 1GARA 3RLIA 2FP3A 3LVRE 1MVLA 2Q29A 4ITVA 4RA6A 5LD2B 3LHFA 1SH7A 2C0CA 2Z58A 1PJ3A 4JR1A 4YCDA 2Z95A 2GJ9A 3PUZA 1XCBA 3IAFA 1NY5A 5IDYA 3U80A 2VUSA 3JW8A 1GY8A 1CZNA 2QUJA 2ZVJA 5IPFA 4LXXA 4MW2A 3AJRA 1XTUA 4RESA 1QKKA 4FTWA 1CJSA 4B82A 2RHMA 1ISHA 3DAFA 4INAA 4PSDA 4I4TA 2Z0MA 4B8YA 2Z6AA 1XAIA 5F51A 1ZGCA 3T7SA 1AZLA 5TGTA 2Q6IA 2VF2A 3GRVA 4G1UC 3T9BA 3Q9UA 4N3NA 1ZLXA 3KPVA 3MIIA 3OQBA 2QX4A 3IDZA 3V33A 1IM2A 1FQKA 1E5QA 4B7CA 4Y6SA 3RKUA 3NP7A 1QIDA 1A8SA 4BEVA 9ABPA 5A0VA 3ABSB 3OQOA 1QHIA 1Q74A 3B51X 3EIFA 4UFOA 1CZUA 1YE5A 3RUDA 3W3ZB 2C7OA 2P9CA 4LHZA 5LYJB 3I6QA 3GZNB 2XMCA 1C0KA 1QAQA 5SZIA 3TW0A 4P6VF 4B4DA 5TIIA 1FJGB 1EWVA 1OAOC 4JC0A 1NKTA 3GC6A 3VU0A 4CHTA 4KODA 4JEMA 3WGGA 1SUFA 1X7YA 4DJDC 2WABA 1NVXQ 2HK9A 1Z25A 3BWCA 3FSGD 3ZDDA 3CZMA 1KAOA 2Q5JA 3IX7A 4XQEA 5KDLA 3W8FA 5B6JA 3OIDA 1T4CA 5AKJA 1WV1A 3OJ0A 1W36D 3PXXA 2V4UA 3LKDA 4PZYA 2NO7A 3JQ7B 3PK0A 4F5EA 4HX5A 3AVVA 3DDOA 4R41A 3A4YA 3IP3A 2BFEA 3NTQA 3WRWA 1JH8A 1LK0A 3ELYA 4RMHA 1IG3A 4OK3A 4BS9A 4LOIA 3WTBA 3BB3A 2DM6A 4XI9A 1YZKA 3M6MD 3UZUA 2OGUA 2XV1A 4JI5B 3ZWCA 3G1TA 3CNOA 3GP8A 4JODA 1Q0TA 1XZKA 4B6QA 3OIFA 5IK2D 2YFQA 1XAHA 3OE4A 3NAGA 1SKMA 4KR6A 4ND1A 1YJBA 2KBEA 3TG2A 1Y3FE 4XWTA 5C8YB 3UGKA 4Y6LA 3KEMA 1W47A 4F3KA 4F91B 5BUSA 4TMTA 3M1IA 1L5HB 3ZNQA 4TQ9A 3WAJA 1ZKMA 2PL3A 3PNLA 4NX2A 1T2AA 3R7SA 3AC0A 5FB3A 1A88A 2IZ5A 2PZMA 4WCFB 4PSVA 2VZLA 2AOUA 2XUPA 2QTZA 2XMBA 3PX7A 1U1CA 2PIDA 5CB6A 4OBBA 4R2LA 1Z45A 5LKRA 1OFGA 2IBTA 4LRUA 2ECPA 3EBOA 2EGUA 4KYUA 1RVV1 2R1UA 2ZUCA 2H1WA 2HA6A 5EIHA 4YN3A 1HZZC 3W34A 4ZI7F 5KKNB 1WXHA 4I4TF 2IITA 2G3YA 4RF5A 3SX2A 4XGKA 3ZKWA 2BRUC 4KGXA 3WB1A 1O95C 1MQ8B 1T15A 1YZTA 5C5DA 2CLOB 2B92A 3JQAA 4L8VA 5LOVA 2E0IA 2H2AA 4MWZA 3LE8A 5ALIA 5E3HA 5AQ1A 2FPPB 2J85A 2C94A 1DWQA 2AKYA 3NH9A 3GLFA 4H15A 5I9NA 1CQPA 1A9PA 3MJRA 1TF2A 2CLSA 4K28A 3BDAA 4US0R 4CETA 2PUTA 4AZ0A 3TZLA 4BDSA 2FUG1 3KRTA 1HDIA 1NW3A 1CUYA 1QOQB 1R12A 1THTA 2AFHA 1OAOA 3AJ8A 2P4SA 2LP4Y 4HI0E 4XQ9A 3IR5A 4MQBA 3I2JA 1GM5A 1S9DA 1F3OA 3MJDA 3M3PA 2ZS8A 5E1MA 1Q1NA 5I8ZA 1UZUA 4RHYA 3C4JA 1NA5A 4UEQA 3TLMA 1ZR2A 3K8YA 1F2UB 3O92A 2DXIA 1VRWA 1F0YA 4J1SA 4OH7A 3QFTA 2YHSA 4GU5A 1UPFA 1RHUA 3D7KA 3EN0A 1R0WA 3LXMA 1J9ZA 5BYKA 3ONDA 5EWLB 2W2OA 1LVGA 3V2HA 1ZUHA 1WU7A 1EFCA 1MV5A 1XFDA 2YWXA 1GGVA 3ILVA 3M6FA 5FNVB 4DWJA 4LY0A 3OQNA 3ER6A 1N2GA 1OYVA 1V3VA 3CINA 4M21A 1MP0A 5DYWA 4DB4A 1OI4A 3OZTA 3B1KA 3IQHX 3UMCA 1KQPA 1ZOLA 1CDZA 4AZ3B 2CCGA 1P1FA 4RTOA 4YBZA 3C8DA 2XADA 4EWLA 2X0NA 3CUSA 5BY2A 4WCFC 1S02A 1VSBA 3UXYA 1NR7A 1Z8NA 2QBYB 1CJUC 5LU8A 4CQMD 2ZJ4A 2QTVB 4AX8A 1UM9A 2VK4A 4TPKA 2L82A 3DP7A 5DJ5A 5K0LA 3SQMA 2ZI9A 2VHYA 3C5HA 1KI1A 1I2MA 1XRNA 3DTYA 5TE9A 4DCCA 1YVRA 4TL8A 1R6DA 2Y68A 4E13A 1SIUA 3W5AA 4RQTA 3AKCA 4OSPA 5EGSA 1WS6A 4ZAFA 1F9EA 2IX3A 4ZYYA 3NRBA 1SGWA 4OGGA 1NULA 2PWBA 3V3TA 1UOQA 1EFVB 4A3SA 5EP3A 3QXCA 2YV4A 1DKOA 4LHWA 1IB0A 3LF1A 2O57A 2PSDA 2QV0A 4R8LA 2QL9A 5EUQB 3TS1A 3BIJA 3RBXA 1DADA 3UB3A 4DABA 4EY8A 3TPZA 3H6KA 3UUFA 4DBZA 2PT6A 2E3JA 4HQLA 2ZU6A 5CYPA 1QIIA 3AONB 1YE8A 4Q6BA 1C1DB 4J0IA 3AB3A 3OTWA 3LOQA 1RAAA 4EB8A 4WE3A 2J3LA 2Q9BA 3VISA 5GZ1A 2IHBA 1JJFA 1R64A 3A6GA 2HTFA 5K09A 2MSWA 1J0XO 2YVAA 4F2PA 2IQIA 2EJBA 1ZUIA 3TQFA 5BNFA 5TVGA 5KNCD 3T3GA 2BGRA 2Z4SA 1PL6A 1AMOA 2QD2A 3HWRA 1O9BA 4RTSA 2FUEA 4NBSA 3ESBA 3WISA 3HUEA 4N3BA 4UAUA 4Z53A 1LQUA 3OKCA 3E5RA 4LJ6A 3R6WA 2QG9A 1L6RA 2OCDA 3U3DA 3FHLA 1HDYA 3D1LA 2JVIA 4JFAA 4M46A 3LV8A 1M73E 1A95A 2B98A 1B15A 2H9IA 3PNYA 4PCLA 1L4NA 1JWLA 4GM1A 3FFTA 4QUGA 3RUPA 4TLDA 5FAKA 1JR6A 1UANA 3AY3A 3C7AA 3S8MA 4AO6A 4JH0A 3R1IA 1KH2A 1VZ3A 5KUTA 1Z37A 3EEOA 2WSSA 1DQNA 2KI5A 4M99A 1I7PA 3H75A 5CEFA 3QELB 4ZZ3A 2Q3EA 1BC5A 3F5DA 5IFKA 1KDTA 4MW6A 1TZKA 2LIPA 3MILA 4MVJI 4OYRA 3KZOA 3OP1A 3L49A 2WWXA 3GPCA 5DHSA 2QW0X 3G0OA 3WOVA 1T9GS 1HYQA 1YL5A 5T6MA 4CR8A 4YCLA 1CE8A 1NC1A 1QFSA 2VUIB 1X2EA 2VNKA 4JZKA 4Q3EA 4I9NA 3TFQA 2XYQA 5FJJA 4S1VA 5EZ5A 2RGUA 5JXJA 1Y4UA 1KORA 1JLKA 4PBRA 1O2DA 1VBKA 1YASA 2Q1SA 3D3NA 4Y2VA 3ZY6A 3UJCA 3HI4A 3FPHA 3PNQA 2VJMB 5AKYA 4IIFA 4XX0B 4Z7NB 5JVDF 1D4AA 3VNVA 1P3DA 3TH5A 1ZU5A 5E6RA 3A3PA 3QHQA 1JBQA 1RYEA 1Z08A 4N54A 2NZUG 3ZS8A 3OT1A 5JFGA 4W5QA 5HEKA 4AQ7A 1PFGA 1RW4A 3EQ9A 5KTNA 4DVGA 4DR2B 1SC3A 5JAQA 3HPQA 5DYGA 2AD5A 2HB6A 2FB9A 4YAOA 2CMHA 4BQIA 2PS0A 3CNQS 1UBOS 1L8OA 5FBWB 3NJ4A 4WVLA 4DL9A 4RENA 1DELA 1QO9A 1P5JA 1E0AA 3ZNPA 4WBSA 3UQYS 4FEEA 2YRWA 2LPMA 3ILYA 1ORDA 4QFDA 1HQYE 2QVGA 2PK3A 2B99A 3JQBC 3P2EA 1KE2A 1WSBA 3VQTA 4ZIRA 3NATA 2CXXA 1KTIA 1TRKA 4KUEA 4YDRA 3NONA 4GF5A 4HDSA 1JF8A 4AK9A 1G59A 5BV8A 1M0TA 1CZHA 4HDMB 3K6SB 3GLRA 2HXYA 1CX9B 1TM3E 1Z4KA 1Z07A 2QV7A 5EQJB 2IA5A 3L05A 1D1QA 4KCGA 5COBA 1Z8HA 1NM5C 2BI4A 2OEPA 3D0QA 2OGWA 1VLHA 1UZNA 3G2MA 1E2DA 3TRDA 2VQFB 3M89A 5B6IA 3K1JA 4GLLA 1NBME 1V9CA 1T5IA 4KYIB 4LC1A 3HVKA 1DZ3A 1O8CA 1PSWA 2AUTA 4NU0A 5CTAA 4C3OB 2UV8A 1JHQA 3PU6A 5IAJA 3TAHA 3TKAA 2QRJA 4KRXA 1UDRA 3B1YA 1UAAA 4PTZA 3GT4A 2RB4A 3FRIA 1DJOA 3FJOA 3INYA 4I50F 4IO1A 4ND8A 1NV9A 1P7VA 3VBCA 1O03A 1M1ZA 3WOHA 2XGMA 3CR3C 1E3DA 2R1VB 3FDFA 1EFPB 5J5VA 1R8SA 4M1TA 2O8EA 3BD6A 4O02B 2B78A 1FBNA 2JVJA 1QCCA 4OQZA 5FQNA 1M2HA 2QN2A 3DDNA 4FGWA 2FFQA 2IOQA 2XY4A 2AOXA 2G7MC 4D8UA 1KVSA 4CLRB 2VOJA 4KMSA 1HLGA 2V4MA 2CUZA 3CQ9A 3P9YA 4KQWA 2X0DA 2ZSEA 3PXBA 1LW7A 1P9NA 3TVDA 3ABQB 2CDNA 1G6KA 2XE8A 3U0BA 5IT0A 1VHQA 3NUZA 3PX2A 3Q7QA 2FWAA 3ZHTA 2SKEA 4BIIA 5HZHA 3RSLA 2A8YA 3BREA 5FI1B 5DK6A 4WZBB 3KVOA 1SZPA 1NQVA 1C5KA 1N3LA 2QHXA 1CLEA 2OKGA 4E3WA 2WMYA 5HJ2A 2ZJYA 2IW1A 3DEKA 2WTAA 3DKPA 3X2FA 3OE7A 3QVKA 3Q98A 3R9WA 5LA6B 3VHRA 3ZWXA 3Q3JB 2GN6A 2W71A 1G4HA 3OTOB 1EXWA 1IHUA 3LT2A 2GO1A 1CUJA 2BFEB 3PRYA 1AC5A 2CBXA 5IVIA 2H5EA 2FFAA 3KPJA 5A5VA 3MM4A 3W8EA 1QKIA 1C7FA 1Z35A 3JVVA 4IZHA 4EECA 2HSWA 4C14A 5DTIA 4C5AA 4YDHB 4ZVNA 4Z3KA 5JCJA 2PX0A 3WHKA 3VKHA 1J07A 1XTSA 2XMSA 3DL0A 1H8HD 3L8ZA 1USIA 5H68A 4KGDA 4ES6A 3BH6A 4N65A 1U9IA 2WICA 3LOUA 4NMHA 2EW8A 4C76A 1STOA 4DCSA 4KJXA 5FUWA 3DDCA 2VYNA 4KSBA 4LF8B 4X00A 4EFDA 4EEXA 1V5EA 2Z8YM 3A4VA 4I9HA 4DCMA 4P1ZA 3B7GA 4M86A 4E21A 1YMQA 3AFIA 4XW2A 4IV5A 5M3BA 2FPIA 3FZNA 1E9FA 3ULKA 3SBOA 2YR0A 3Q7PA 3H5RA 3P2YA 1Y33E 4KVZA 1NJSA 1FRFS 1ISIA 1PJAA 4V39A 2Z2YA 5JNRA 3Q8LA 4DIOA 3B5JA 2GZHA 5P8WA 4EQ6A 7ADHA 1Y5IA 3A28A 4S2UA 3V1UA 5EJIA 3U7RA 3AHFA 2VDWB 2XGOA 4NLLA 3RRYA 1VBMA 1BXKA 1SVIA 2BEWA 4GBJA 1WCXA 3B3QA 1CDDA 3X1JA 3R09A 2PUFA 5IEJA 3MC1A 1OBOA 2H92A 1H5UA 4RKEA 5G0WA 3TNFA 4DNPA 3FCCA 4FFLA 3ZXYA 2YH2A 1PLKA 2AOVA 2YMQA 1UDCA 3A26A 3E9EA 3NXKA 5JMPA 2OG2A 4FFVA 1I10A 5E1BA 1P45A 4KLAA 4WKPA 5F5NA 3X1DA 3IHKA 4G01B 3FKSA 1U28A 4G5RA 1UC5B 1S0UA 3D0KA 2ZUSA 4U6QA 1QHNA 1V9LA 2GPTA 4TLAA 3WLSA 4YMLA 1C4KA 1Z18A 2DVMA 5F77A 5JCXA 5EE0A 2XKKA 4BNDB 4AJKA 3OF2A 4WMLA 1D5CA 3AG5A 4HEJA 7REQB 4TTTS 5BSRA 4YRBA 3MERA 1OBCA 4YUZA 1RM3A 1L5LA 3BIWA 1ECFA 3TIGA 4J3JA 3ICCA 3NWPA 1U02A 2ZUVA 4HUQA 3D8TA 4MCIA 1RHRA 3N8HA 5EIXA 4N0PA 1H4QA 1BGXT 5BR7A 2QP9X 4Q05A 4M7RA 1PGJA 1Z5VA 4D4LA 3GVXA 4F84A 3HK2A 3GH1A 5K3OA 4UTRA 4JC4A 2JJ8A 4DIDA 5IFLA 1OASA 3C1OA 1JFRA 2VDVE 3GA5A 4I08A 2P68A 3GP5A 4AKSA 4F5WA 1XNQB 1O3YA 3QYJA 4FNAA 4H4DA 4IIJF 4YUAA 4RDHA 4PZ0A 2XT0A 1MMFB 2UZ1A 4LRWA 3G5LA 2VWPA 3WYNA 1US8B 3I6IA 1LRLA 4ZODA 1OD6A 3TINA 4BB6A 5DLQC 1OB5A 5CIYA 3M5PA 1Q0SA 3BAFA 4JYPA 1CNFA 2FDXA 2F1OA 2BGTA 2WZDA 2CBZA 1QE3A 1UXIA 3UM9A 4EPVA 1WETA 3THXA 3ROZA 2WWIA 2XDAA 2NU8A 3D8HA 1VE3A 4RD3A 4HGNA 3J7AC 2ODBA 3LUAA 3I2FA 4J0QA 4WFIA 3RRZA 2VZEA 3QEKA 1ISJA 3VOAA 2VPTA 3BCSA 3VHLB 3BWYA 3MUOA 3T12A 1P6QA 3QLJA 2QL7A 4TLEA 4ZVTA 1NUSA 4LGMA 4Q21A 4XGRA 1YR2A 1IB6A 1A3CA 1S96A 4FNGA 2VAPA 1VJDA 1JQ3A 3PFWO 3LPDA 4KO1S 5FQOA 4AZVA 1D2AA 1N5IA 2PSSA 3W5VA 4EG3A 4BU1A 2G5CA 5JHHB 2FFRA 5JNUA 1BMTA 1WB4A 1WKVA 1C2TA 5IZCA 1U0LA 1GTL1 3O8QA 4A82A 4EQZA 3JQCA 2AK3A 2W6IA 3F3MA 3HXOA 1A0OA 3JD3A 3KTAA 5TT0A 2BDUA 4WXPA 4KTTE 1K7CA 2DETA 4XWYA 3FNRA 3VSBA 3FM9A 3QJGA 2AN3A 1ZH0A 3EULA 3MWFA 5CDUA 3X43A 4PLTA 2NO5A 1VSQA 2Q3MA 4NYJQ 4RD2A 1DU4A 4D8VA 2OQIA 3V97A 5ARDA 2IEZA 2G7ZA 3PQEA 2H4HA 1XRPA 1UKEA 4IKPA 5AVVA 1JX6A 2FEWB 3OG9A 1JA1A 3JVUA 1GZSA 3M8KA 4O1HA 2R8RA 3IT3A 4JT4A 5IKMA 3VPBA 4NV3A 4GX2A 4LYEA 1MAAA 2CLEB 3RRFA 2P4EA 1YNOA 3M4XA 5AKGA 5ADVA 4OJKA 1T5LA 4Q00A 4YCJA 2G1KA 3LM8A 1GGNA 1DOAA 3MAGA 4N39A 4J7CA 3ZBQA 4XYBA 1B0ZA 4QTYA 1N6HA 3K0BA 4IPTA 4HDKB 2GDJA 1XX6A 2ISSD 4MINA 3LQRA 4OFZA 5EJGA 3WA6A 4PN3A 3R0JA 2PQ0A 3BSWA 2WJIA 2HRDA 3BWVA 3CN9A 1DWUA 3E9DA 3GCDA 4GD3Q 5LXTF 3U16A 4DB2A 3QW2A 3EHDA 2GJSA 1NRXA 1XV5A 3NBFA 3NNNA 3RE1A 4P35A 1T24A 2Z56A 3IVXA 1K68A 3HU5A 5IXJA 1MEJA 4L3OA 4OB8A 4Q9LA 1G8SA 3KVRA 2BKVA 2QY6A 1QORA 4IDCA 4LDJA 1T0BA 3ZWAA 4D43A 1HURA 2GJKA 4ZOLF 3C6BA 1JU3A 3D4BA 4C3VA 4XWKA 3JX9A 1K06A 1Z2PX 1H4VB 2QG4A 4JI2B 2EKZA 5KNDH 3KPUA 4D0SA 2NO1A 2X8JB 3GUZA 4V0OA 3FVRA 3IULA 3VU9B 3L7BA 4HAYA 4KAFA 1L7NA 3PNBA 5CK4A 1NX6A 1D4ZA 4XVRA 5AJXA 4M0FA 4WI1A 4LHYA 1K7FB 1DGQA 4GL4A 2DFNA 3LDHA 4D46A 1UEIA 4PX9A 4F96A 1E2MA 4UNIA 1XHFA 1I7SB 3BK7A 3IBGA 4FYHA 4AP9A 1FX1A 1JHRA 3OEHD 4TWAA 1RS0A 1M2KA 5HF8A 1PD1A 4HDRA 4DMLA 1D8TA 3JATB 3QEMB 4FFPA 2BHLA 3R8XA 4A0GA 4C6RA 2V5VA 2XT9A 2QI9F 2V7BA 4GP6A 5FPQA 3WV5A 2O14A 4D97A 3GGCA 4LBWA 3MWEB 1QH8B 2P9QA 3UMMA 3ZQKA 1G2QA 2C78A 4AO7A 1IN5A 4JWKA 5FHQA 1QH1A 3UJNA 1LK7A 1X0VA 2E55A 2FGJA 4Q15A 3VNUA 1K2WA 1G3MA 1MA0A 2IXFA 2XAUA 2ZSBA 5FTJA 2JI7A 1PV1A 4PGMA 1UWLA 1FSGA 2J41A 3EIOA 3DMFA 3GT3A 1YU6A 3GLHB 3BE4A 3TIFA 721PA 4ARUA 1XMXA 3PE6A 1MAHA 2VHTA 3H0EA 3KBBA 3PYMA 4MTLA 3UT5A 3GRZA 1EM6A 3GLQA 2YRXA 2IZ0A 5ER9A 3CVXA 1YXMA 2CFCA 2KPOA 3NZEA 5T64A 4EJ2A 5D87A 2REQA 1O95A 1Y89A 3EIEA 3MFYA 5DASA 4MUJA 5AMXA 2IU0A 4O29A 4IVPA 2R3SA 1VCHA 2GXUA 4J0EA 5J40A 3W6PA 2WTBA 1U2SA 2B25A 4R0NA 3MT8A 4IRMA 3QVVA 4D9FA 3TLAA 2ZBDA 4GPEA 2AEFA 2DTDA 2ODNA 2GYYA 2FJPA 4LJAA 4Q48A 2OZKA 5JZSA 3RR2A 5LXTA 3WLNA 1I3OA 5IBPA 1O57A 2W2XA 4C88A 1K5GA 1N2SA 1AX9A 3DMNA 2G80A 5DM2A 2ZW9A 1MIHA 3O2SB 5JCZA 4RA9A 2PZFA 4MUKA 3QXGA 5EFZA 1C8BA 3MCTA 4Z4EA 3VR2A 2BWJA 1XZPA 3AHDA 1X1QA 4KRFA 3GUCA 2CE7A 3A9UA 3FCUB 4O63O 3LQ4A 2AJBA 1DJPA 2I33A 2UAGA 4Q1CA 1QHYA 3WL5A 3QF4B 1JSXA 1UFKA 2REOA 1NQWA 3QUQA 4NFSA 4UU1A 3VAZA 4P7BA 2HJHA 3RT1A 2CF6A 1A7AA 1VCNA 1EFTA 4JBLA 5HCIA 4C7JA 1AKRA 1N9GB 4LE2A 4F4HA 1TTTA 2IPOA 4DT1A 4EW6A 4RPGA 2GPJA 4HNQA 2D8MA 1NLFA 4F7DA 3B12A 4UW9A 2OV2A 3DJYA 1R4MA 3HVJA 2Q5LA 3NRJA 4QPPA 4UNQA 3D2CA 2K2QB 4W1RA 2AJCA 2CZCA 1LBEA 3MUEA 5I9LA 3GRCA 5CDYA 1UXOA 3ONVA 1X86B 4FWIB 5IDXA 4C0XA 1VL6A 1WKBA 1JKXA 2JK0A 1XEWX 2YJGA 3DPSA 3IFSA 4NBWA 4QPNA 2NQTA 5LA6F 3R7LA 5KNBA 3GLIA 4PONA 3IT2A 4B3SB 1EG2A 2F55A 2HJRA 1NW9B 3UK2A 4V3CA 4IICA 4TTJA 1TGVA 3ND9A 3PPIA 1I3MA 1L4HA 4DNFA 5L3VA 4TZ0A 5HIKA 4WK2B 3I8SA 4TRJA 3PICA 1AGRA 1IRIA 3ZDYB 2IY9A 3BSSA 1U9IC 3OVMA 3HNPA 5I4IA 3T3EA 2ONKA 4B3MB 5J58A 1QTRA 3W04A 1Y7IA 4PNEA 1Q0ZA 4MV1A 1OWPA 1QK4A 5ALDA 7AT1A 1RI3A 3FIJA 3KXDA 4M1QA 3T3HA 2DWCA 4PYQA 1GZVA 1U3CA 2XQGA 3MQFA 1DFHA 2CVZA 3IVGA 2RJ3A 1EE9A 1JIXA 2JI6A 4YRFA 2XZDA 3NW9A 1SBCA 4B0PA 3EQ6A 3BGWA 1IMJA 1ONPA 3BULA 3CVOA 3DKKA 4JR0A 1YBHA 4C0BA 3FR8A 3O4RA 1KJWA 4O4JB 5CAEB 1E66A 2AKAB 2RAUA 3VGJA 2JHGA 3P2MA 1OLXB 1F9AA 1TCVA 3AW9A 3OPYA 2VRNA 1PJCA 4MQ5A 4HYTA 4I66A 1CRLA 2V7EA 1SXPA 1OB2A 3C3YA 3EXEB 3PUYA 4YTEA 1W44A 2Q8PA 5THKA 2QQGA 2B35A 3VC7A 2X9QA 4BEWA 4M38A 3KOOA 3PDJA 1TDJA 1UPUA 2J30A 3Q5GA 4R54A 5KVQA 5KTMA 3RTBA 4NVRA 2JS7A 1UMBB 3AJDA 4Z4QA 1N8SA 2WIAA 2PWPA 1D2HA 3DFKA 1VL5A 1M1XB 2RAVA 4MQ4A 1D6JA 3N5KA 1EJ6A 3PXDA 3V7YA 1L5ZA 2AEEA 3TGWA 1T4CB 1XZBA 4B80A 5I45A 1GRNA 3BXHA 1OIXA 5EMKA 2C58A 1KMHB 4OGKA 1G8MA 1TB4A 1GYRA 1ZNYA 4Y67A 3OZWA 4HYYA 1DBWA 4LAFA 1YB7A 3DNMA 5AK4A 2A9PA 3OLWA 3KYDB 3RU2A 3GCWA 3E70C 4CMAA 1GXSB 4M1ZA 1NW6A 5ALSA 2G0TA 2R9VA 1BG6A 3PVZA 1MCZA 4FFDA 4OMDA 2QZ4A 5DEOA 1ODCA 4C78A 6LDHA 1N9ZA 1NWHA 1UJBA 3ELUA 4G8DA 4Q3BA 4QOSA 3A6JA 1QWSA 2DPYA 5CA1B 5EXEA 1OROA 1SUPA 2PVPA 3SSOA 2CL5A 1EXDA 1WCIA 3OA0A 1T5DX 4U7PB 5BVGB 1Z5WA 3AEXA 2QYHA 1N78A 2ID4A 1KEUA 3VNQA 2BJWA 2PTHA 4RFSB 2FZWA 1SXGA 3DVAA 4U9IS 4EUEA 4UPEA 4YRNA 4MWGA 2GPWA 4IXDA 2FLVA 3GAAA 3G88A 3UK6A 3QPWA 2CF5A 1VIDA 1QIHA 5HR5A 3ISJA 3K7EA 2XZTA 1MUUA 2G70A 1F5NA 1DHTA 4Z2AA 2EGGA 2PKCA 2FP4A 3K8ZA 4UM7A 1HE4A 2BRUA 4YUYA 1VQ1A 2VPQA 3DLPX 4PPQA 3WFZA 2GF2A 1EJBA 1XPUA 4AKGA 3RS8A 3CZ9A 1GQ2A 2BLLA 4NZYA 1UBGA 4B43A 1Y6FA 2YZ2A 3G9XA 1CR6A 2HLPA 2WUDA 1G4UR 2WF8A 1XK6A 4OOFA 3O8LA 5JWOA 2XEXA 2HJGA 2XNDA 4P32A 2C9OA 1M6VB 2O2EA 5FEMA 1SQ0A 4G9EA 1GUYA 4E5PA 5AW2A 4F7WA 4LHXA 5DX1A 2FUKA 1KZ6A 4BVAA 4UU7A 1SAYA 1DWOA 3FMPB 1DCKA 2GZRA 4PXYA 4QLOA 5IMBA 2OM6A 1S8NA 2YC2C 2X23A 5AH0A 1L4YA 4A15A 3CJQA 1Z15A 3NOXA 4Y9RA 4P92A 5JRJA 4X6LA 3CXRA 5KQLA 4FFWA 3NTXA 5AKXA 4AS3A 4BB0A 1UPAA 1PJ8A 3LHDA 3CCFA 3C43A 5K3DA 2IHNA 4US2R 1NBMD 2B8TA 2Q4RA 4MHOA 2KYRA 4GH5A 4ROTA 1HKUA 1OYYA 1FNDA 4XIYA 2G8NA 4A36A 3EWAA 3F4BA 5DHFA 6YASA 3FBGA 1VYVA 2DUWA 3DAPA 3JPWA 4XQGA 1KVRA 3ICEA 1VG9B 3PCRB 3RC1A 4AWXA 3QNWA 1KJIA 4K46A 4KPUA 3NC0C 5FNVA 4AF6A 1WXGA 2BMVA 2JNWA 1RRGA 2QP4A 2VWHA 3VR5D 1G21B 1UIMA 5D7BA 6ADHA 4NXMB 3ZY4A 1NW7A 4UOQA 1QE5A 5HBRA 2LKDA 3IUSA 3W2EA 1YIAA 2QL5A 4Z9YA 5J5CA 1U8TA 2PAAA 1OSNA 2NUPB 3SHOA 1O96B 1V5FA 1DV2A 3HNRA 1C3VA 1S2GA 4DSAA 2VQEB 3N87A 1SKAA 3SFZA 1HT0A 5ECYA 4YPFA 3D64A 3NP9A 4H9GA 4LZOA 3PEVA 4I5DA 4PLPA 2W6QA 3RS2A 2FSHA 3OMWA 4R1TA 5C8DA 5F98A 2IEBA 4ZAXA 1Y9ZA 5T4FA 3LRPA 2H3EA 2QLFA 4F1WA 5B7GA 1Y6QA 3D3EA 3LP6A 2HRZA 4MI1A 3TDNA 1GEEA 3EPKA 1J25A 2FVYA 2JJ2D 2MTBA 3DOUA 3E3OA 1J1IA 3OICA 4NULA 4YRQA 2NG1A 1WSDA 4JVOA 1QRSA 2H17A 4WZBA 4R05A 3VNAA 1YQ9A 2FYTA 3H8WA 3OUUA 3PYXA 2RI1A 3VR6A 4AG3A 4D8TA 3GVCA 3QUSA 3HXPA 5ITVA 1J2JA 3JALB 1TYDE 2I8CA 1AA9A 4G07A 1E59A 4WOJA 1FDRA 2VYFA 2XCIA 1R00A 2XXJA 4L57A 1G3UA 1PZNA 4MVJA 5CVCA 4A5OA 1XDGA 3CF4G 2HNBA 5JH7F 1ECPA 2BI8A 2ORIA 1RJDA 4C1NA 2XNDD 1HT3A 1R5JA 3WGTA 3NHSA 4BN5A 5KEIA 2J7PD 3EDYA 4UAGA 2H5JA 1GGKA 4G41A 1OGYA 1XTZA 4JCOA 3RUFA 2GASA 4AY5A 3VM6A 1JJBA 1E7WA 3ZBPA 4IDNA 4DCPA 1GGJA 2YN2A 2P91A 3E8SA 4FBMA 1LLCA 4UXHA 3C3PA 2AEJA 3CX8A 2OD9A 4X71A 3H2IA 3LRTA 3X1KA 3ZR4B 1OA1A 2FQ1A 2E89A 4D42A 5B3LA 3L6BA 3VZQA 1YO6A 5JECA 1GZ3A 1XQ1A 3N2IA 1M33A 1TJYA 1XTIA 1DWPA 1L5RA 1Y8CA 2WHRA 1QRDA 3ESCA 3FUXA 2XUHA 5A7FA 3QSYA 1ID8A 3AUJB 1NVVQ 4DYHA 1UWCA 1YJXA 4NBNA 4XFJA 5AVWA 4W7IA 1TFUA 1RKUA 1QQ6A 3TG8A 1EQAA 3L84A 3V7WA 2BEVA 4E5VA 5JS1A 1R10A 4HDAA 2Z09A 3D4NA 4AJNA 2FZGA 2YHUA 2CSXA 4P22A 4REQA 1DCFA 3L07A 1FU4A 2RHRA 1YRHA 2IEGA 2Y93A 3B3JA 5FBZA 2WR8A 4BVKA 4D3ZA 3AUAA 4GW3A 4URUR 4KO3S 1NXQA 1A4UA 2PUGA 2EEZA 3O9VA 2OCYC 4O4LB 1P80A 4LRYA 4OHMA 3RKSA 4AVYA 2O59A 4UZEA 3FMVA 1RYBA 4NI5A 4UOEA 4RVGA 3BORA 3HL0A 4OIMA 4MKRA 2DY1A 4QBKA 3V8RA 2BKUA 2J31A 1JMVA 2OWDA 1GFWA 1XA4A 2WHXA 3GB9A 2GN1A 2ZYIA 3PD1A 3DFIA 1SKYE 2BFDB 2HNKA 2IHVA 4MX8A 3TJRA 2VQDA 2WIKA 2EFCB 3WKBA 1IHDA 2ICAA 1N9GA 4JOSA 3RSZA 5C8YF 5K3FB 1U63A 3RS7A 3V4ZA 2YUTA 2P62A 1ZM2A 5CVEA 4D9CA 5BWCA 1CERA 3IDOA 1RYMA 3NBQA 4NCXA 5JEDA 3TAUA 1ZG3A 3HJGA 4N0QA 2WJHA 4E5KA 3A1NA 2WJAA 4HDKA 5FX2A 2QM0A 3B6ZA 5H3LA 3UPTA 1MC5A 1OZFA 3PXEA 3ZDCA 3H17A 3CF0A 3MSXA 3DG9A 4OXIA 3KHSA 5AVYA 2Z8XA 5CT9A 2H4FA 3LS2A 4RTRA 2XYGA 4HRVA 5IW8A 3P1JA 2VJNA 5C32A 3OT5A 3GLIB 2VK8A 3B13B 2GI4A 2BFMA 1RYHA 3W2HA 4ARSA 1LBIA 3ZCRA 3FDIA 4ZDIA 1QO0A 3O90A 4B4VA 4DPMA 2WY2D 4Z49A 3G79A 1LLFA 2XE6A 3K2EA 3PI7A 2X0KA 2D59A 3GRUA 4HQOA 4MB0A 5KQMA 1U2GC 1CIVA 1X8KA 4XJTA 2VT3A 4S3MA 1GFIA 3UCEA 4PAWA 4BUCA 2ZTSA 4MXDA 1RJEA 4B2YA 4IGFA 4C08A 2VSFA 3K6KA 1DBVO 1FPQA 4LSZA 3CUWA 3BF8A 3RU9A 2BFFB 5LYJF 4HNSA 3RUIA 1QGED 2FN9A 1Q7BA 2UZIR 3E7FA 3PLRA 1K8RA 4H4EA 4MYHA 3KXLA 3G0CA 3OQHA 1U7UA 4G1FA 4Q4AB 3DONA 4JUCA 3K0SA 1XQYA 1GITA 1XL0A 3EFOA 2AT1A 3HXKA 3BKXA 4U5QA 4YUXA 2PUBA 4EA7A 1E9DA 5DXJA 1UMCA 2J6IA 3O4FA 2H4XA 2WWFA 2ZIZA 2OB1A 3DVRX 4H2DA 4EDHA 2FGKA 3MRTA 4JROA 2J3EA 1E1YA 3KKQA 1V5IA 3W7AA 2OBNA 3N2KA 4MR7B 4WASA 4C4SA 3FOAA 3AR7A 3G2IA 3KT8A 2Z83A 3SSNA 2IBMA 2ZIXA 1Z0AA 4C20A 4Y2TA 1IBCA 2XWSA 2XVXA 2OCGA 3PKZA 4QECA 1OLUB 2UVQA 2X5XA 1AGPA 1DRVA 4MVCA 5DW3A 4ZCQA 3R7AA 5AVUA 3Q15C 2JIZA 3CC8A 4UUBA 4CM7A 5L3SB 5JS6A 1DIHA 1ISFA 1KMHA 3CKYA 3QFCA 4I2VA 5K45A 1XCMA 2C4KA 4WNCA 5DDIP 1C4XA 4KR9A 2AFIE 3HHPA 1K86A 3UO8B 4EENA 5INTA 2HSDA 1Q5PA 1PK8A 1T5TA 2HD4A 2X5OA 1IN6A 3O1IC 3T0FA 3RO7A 1B23P 1T1IA 4HWPA 1BJKA 2XUFA 1U90A 1W581 3FHJA 4IV0A 4QJIA 2WHEA 1CDEA 1RWPA 3JZIA 3WV4A 1DX4A 1OLOA 4UDYX 4PNHA 3L8HA 4LI0A 4NMMA 5ICEA 5JDIA 5DOZA 3BHIA 4AQYB 2OYRA 3RD5A 3ET5A 1YZHA 1ZK4A 2BF4A 1XI2A 4RH3A 1H2RS 2WT9A 2NU9A 1FUUA 1DIBA 2YCLA 2P40A 4K87A 1DRUA 4M0EA 2YYAA 2C84A 2EJTA 4N49A 4OQPA 1GT91 4CKWB 4DJAA 1L5SA 1K66A