1G60A

Crystal structure of methyltransferase mboiia (moraxella bovis)
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
256
structure length
238
Chain Sequence
MLEINKIHQMNCFDFLDQVENKSVQLAVIDPPYNLSKADWDSFDSHNEFLAFTYRWIDKVLDKLDKDGSLYIFNTPFNCAFICQYLVSKGMIFQNWITWDKRDGMGSAKRRFSTGQETILFFSKSKNHTFNYDEVRVPYESTDRIKHASEKGILKNGKRWFPNPNGRLCGEVWHFSTPKPRDLIERIIRASSNPNDLVLDCFMGSGTTAIVAKKLGRNFIGCDMNAEYVNQANFVLNQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Adenine-specific Methyltransferase MboIIA
publication title Crystal structure of MboIIA methyltransferase.
pubmed doi rcsb
source organism Moraxella bovis
molecule tags Transferase
total genus 77
structure length 238
sequence length 256
chains with identical sequence B
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2000-11-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1g60A00
4GC5A 4EKIA 2HTEA 2P35A 5GM2A 4E2WA 4HGYA 4MIKA 5GIOE 2YXDA 3AY0A 3NJRA 1F38A 5FADA 3FUVA 1KPHA 1VL5A 3A4TA 2G70A 5DX0A 5FA8A 4X1OA 5K0LA 5K0FA 1JG3A 2AS0A 3HA3A 1KP9A 2ZZMA 1L3CA 2FK7A 1BHJA 5D1NA 5JR3A 1RJFA 2WK1A 3A7DA 3LGAA 4YV2A 2OO3A 1MHTA 2ZZNA 3LBFA 3LECA 1HNNA 2PT6A 2ZZKA 2NYUA 3LDUA 5CM2Z 5FWAA 3BWCA 5EC8A 4AZSA 3FYDA 4GOOD 5FUBA 2I6GA 1Y8CA 5HIIA 1ORIA 1O9HA 4XUCA 1Q0TA 3JWGA 2B9EA 3GRUA 1FPQA 5GOZA 3JWIA 1R8XA 2FK8A 3CJRA 3FTDA 5K0EA 3FTFA 1WZNA 3FUXA 2O57A 2EG5A 1RI2A 4RV9A 1JTEA 1G55A 3LDFA 4PWYA 5DLYA 5HZMA 3UJDA 5LSAA 5M5BA 4QQKA 5C1IA 2VDUE 1TPYA 3DMGA 5BXYA 4XCXA 5K0CA 1KYZA 1NKVA 4C03A 3FPGA 1KR5A 2QRVB 3UA4A 3NWBA 4X41A 1KHHA 4RVFA 2IPXA 1JR4A 3HCCA 4CKBA 3QOWA 2IH4A 4FT2A 4R05A 1Z3CA 5T6BA 1SQFA 3BGIA 2P40A 3TRKA 2BR5A 3G8AA 3ER8A 2ZVJA 3BXOA 3HVHA 4A6EA 2UYCA 2GS9A 3GWZA 3HCDA 3PFHA 1NW3A 2ZBQA 4HH4A 4AUKA 2C7OA 4OA5A 1IM8A 2ADMA 3SVZA 1OR8A 3TLJA 3EVGA 3K6RA 4AZVA 4CTKA 5LQRA 2YQZA 2UZ4A 1NV8A 5FHQA 3FZGA 4PONA 2FPOA 2IBSA 3LPMA 3S68A 4PYOA 1ZQ9A 4AX8A 2PJDA 2PWPA 4QDJA 4ATNA 4YMHA 1SUSA 2I62A 3M6WA 4V0QA 1VIDA 3G8BA 2ONZA 5EPEA 1F3LA 3TMAA 3HA7A 1WXWA 1XDUA 3BGDA 3ORHA 3OZRA 5FULA 1O9GA 4E70A 4CXMA 1SKMA 4V0RA 4EMSA 2B2CA 5JUWA 1XTPA 3NVKI 3X0DA 4MQ4A 3AJDA 2LD4A 3Q7EA 2EJTA 3TQSA 1L9KA 2ZBPA 5E1MA 1KXZA 2H1RA 3JWJA 4GQBA 1DUSA 2PY6A 2AN3A 4IKPA 3U81A 2WA1A 3G2PA 4RTNA 2BZGA 5FHRA 2OXTA 4K6MA 1IY9A 3G7UA 3M70A 5DX1A 3DLIA 1X19A 3PB3A 4OA8A 5LQAA 1I1NA 2XYVA 4R8RA 1SQGA 4U7PB 5ICCA 3NVMB 3BWMA 1UFKA 2YXLA 3FRHA 3VC1A 4ER5A 3OU6A 1INLA 3GRRA 4PGHA 2NXNA 3B3GA 4FGZA 4FP9A 4OBXA 1AQJA 3UJ8A 4F84A 2BM9A 2F8LA 4FT4A 5EHGA 2P1DA 4IV8A 3PT9A 3CJQA 4HC4A 3MCTA 5DRYA 4Y2HA 4DKJA 3HA5A 3K0BA 3LL7A 3MERA 4ER6A 1X1DA 2OB2A 4YMGA 1Q0SA 4F86A 5DXAA 2AZTA 4MWZA 1XJ5A 2BM8A 3DXXA 5B1SA 1YZ3A 2CWWA 3TM5A 1EG2A 3G88A 1NV9A 1ZG3A 2VDWA 2XYRA 4L7VA 4P58A 3UJ6A 5EKUA 2G8NA 3BGVA 4C07A 2JH8A 3P71T 3PLAE 1PRYA 1T43A 2P7IA 3DLCA 3FPHA 3UZUA 3AXSA 5KS2A 4GOMD 4PYQA 5LQJA 4RTPA 5E1BA 1TW3A 3BZBA 2ZIGA 3SXJA 2AN4A 4OQEA 2VDVE 3V97A 4U7TB 2V74B 3GIWA 5DM0A 2NXCA 2NP6A 3H2BA 1O54A 4RTMA 5E9WA 3LBYA 3UJBA 3GGDA 2C7RA 5H02A 3I64A 4AZWA 2ZCJA 1RJEA 4FSDA 5EVJA 1M6EX 5DT2A 2VZ9A 3KKZA 3E7PA 4ISCA 3OU2A 4M7RA 5EIWA 4PYJA 1NBHA 2HV9A 2P7HA 3M6UA 3KQTA 1YFLA 3C3YA 2NNWB 2BR4A 1N2XA 1RJDA 4RYLA 2YXEA 5E8RA 2P41A 5CVVA 2P3OA 3FPEA 5DM4A 4BLVA 2ZIEA 3HCBA 1VQ1A 3GRZA 3EMBA 4OQDA 4DF3A 3DP7A 4QVKA 3ANXA 3FTCA 5T67A 4C04A 4G56A 4EKGA 5HIKA 3CCFA 4HGZA 5K03A 3RODA 4CTJA 3L8DA 3I5UA 3ELDA 5GIPE 4NECA 3F4KA 2IIPA 3OZTA 2Z6QA 2PX8A 4KDRA 3KHKA 3PS9A 5ICFA 5GINE 3TFWA 2JJQA 3M33A 4GUAA 5E9QA 3KR9A 2EJUA 3M6XA 3B7PA 3LHDA 3R24A 4HG2A 4PIPA 3C3PA 4PCAA 2PX5A 4DA4A 2OPBA 1AV6A 1U2ZA 1XCLA 3NDJA 3HCEA 2FCAA 2PXCA 2IBTA 1EAMA 2YX1A 1D2HA 2PT9A 4R8SA 5CVJA 2B25A 1JTFA 1KYWA 3GJYA 4DCGA 4POOA 1UIRA 5HOQA 1DCTA 2ONYA 4FSXA 3EVEA 2PX4A 2PXXA 2R6ZA 1R8YA 2IDJA 2OY0A 3P2IA 4C06A 1R00A 4YV0A 1YUBA 2FRXA 5DM1A 1NBIA 4PINA 3LKZA 5LQCA 1VP3A 1D2GA 1JG4A 3P97A 4PYMA 3SGLA 1ZGJA 2OBFA 2AR0A 5E1OA 2UYHA 5T64A 5DM2A 5HFJA 2FHPA 4ER3A 2CL5A 2Q41A 3DMHA 3VYWA 4QTTB 1NT2A 4GEKA 4GF5A 3T7SA 4C05A 1X1BA 2OKCA 4DCMA 3SSMA 5K0JA 1ZGAA 4BP3A 2IH2A 3DTNA 4QPPA 3OPNA 4KWCA 3A7EA 1DL5A 1KPGA 1MJFA 1G8AA 1SUIA 1VBFA 2G72A 3GNLA 5KYGA 2QE6A 4H0NA 1ZKDA 4FZVA 3P2KA 3CC8A 2AOWA 2PV0A 5DWQA 3I53A 3FRIA 4HRAA 1WG8A 1EJ6A 1M6YA 2ZBRA 5FWDA 2I7CA 2PX2A 2GB4A 2BH2A 3AXTA 1I9GA 2AOTA 5CVUA 3SM3A 3I9FA 2ERCA 2EX4A 1X1CA 3G5LA 2N47A 2PWYA 5DX8A 5EEHA 3DH0A 2QRVA 2PGXA 3LX6A 3P2EA 5GP1A 3KQSA 2PLWA 1JG1A 4WVLA 3T7TA 3MTEA 4YUWA 5K01A 3UFBA 4EQZA 2CKDA 2AVNA 5EGSA 2EFJA 5C0OE 2K4MA 3WSTA 5EQJB 5CVDA 5FTWA 4RTLA 4PYNA 4WXHA 2JG3A 2PXAA 1RI1A 1WS6A 3FUTA 4GOND 2O0LA 1XXLA 4XUDA 5CUQA 1R18A 1P1CA 3GRVA 5DTRA 3EGIA 2BR3A 3SSNA 3DXYA 1NW5A 3R9XB 5EOVA 5DTQA 1BOOA 3UJ7A 3MQ2A 1EJ0A 2Y1XA 5D1HA 3GCZA 3MGGA 3KR2A 3FPJA 2HR1A 3TOSA 3CGGA 3PTAA 3LCUA 5HILA 2PKWA 1RI3A 3HM2A 3P9NA 4PYIA 1VLMA 5EZSA 3O7WA 4YUVA 3KPYA 4FR0A 3C6MA 3GO4A 3KPUA 2HWKA 3IYLW 5ICEA 2UYOA 3I58A 5EZQA 3DR5A 2AOVA 3TKYA 3VSEA 4E2XA 4RTOA 5DXJA 4MHTA 4QVGA 3SR4A 5IKMA 5K0BA 1RJGA 5GWXA 1XCJA 4LWPA 3C6KA 4EK9A 4RX1A 3NDIA 1B42A 1HMYA 3LKDA 5F2OA 5EKXA 1AF7A 4RTSA 1BC5A 1YFJA 1L1EA 1YB2A 5HIMA 3MHTA 4OX9Y 3EVDA 2PBFA 5LQUA 1TW2A 7MHTA 3EVFA 3EVBA 3ELWA 2OYRA 3RW9A 4LG1A 2AOXA 3KQYA 3IEIA 5FA5A 3LCCA 3P8ZA 1WXXA 1NW7A 4KVZA 4P7JA 4RTJA 2GA9A 2HNKA 1JSXA 2QM3A 3O4FA 4LECA 4RVGA 3R3HA 3P9IA 2OZVA 5GM1A 5F2NA 1AQIA 2WA2A 5E9JA 3B3FA 5CCXA 1JSZA 2GAFA 2NXEA 3ELYA 3GDHA 4QTUB 5EMKA 5HIJA 3SSOA 1KIAA 3FTEA 2A14A 4P7KA 1KPIA 3G2MA 1UWVA 1VPTA 2PSSA 3DUWA 4E31A 1G38A 3B3JA 1QZZA 10MHA 3A27A 1JQ3A 4Z2YA 1P1BA 4HTFA 5K8VA 1JQEA 1NW6A 2ZTHA 4BLWA 3THRA 5EMMA 5CD1A 4X61A 3BWBA 4CKEA 2B3TA 4C08A 3DMFA 4OBWA 3B89A 5DPMA 2ZW9A 3HVIA 3OE5A 1SVUA 5EHIA 1EIZA 3EVAA 4X60A 4UOEA 4E30A 1P39A 5DSXA 2P8JA 4E2ZA 4RSRA 1ORHA 4GC9A 3T7RA 2O07A 3OCJA 5E8JA 3HVKA 3VC2A 2V7EA 4M37A 4C4AA 3ERCA 4BLUA 4E33A 3A25A 1FBNA 3OE4A 3TM4A 4PCLA 2ZWVA 3M6VA 2VP3A 3FPFA 4IWNA 3G2QA 3BWYA 5MHTA 4YUYA 5KQRA 3IV6A 4RWZA 2XVAA 3EGVA 5FQOA 3EGEA 3QOXA 1YZHA 3PX2A 3QV2A 1M0EA 5FQNA 3PFGA 3UJ9A 2GH1A 2XVMA 2IP2A 3JWHA 1QAMA 1SG9A 1ZHFA 2C7QA 3HCFA 2NP7A 2IGTA 1QAQA 2JHAA 3GU3A 4MTLA 4O29A 1RI4A 2H00A 4P7FA 5LQKA 4PGGA 2Z6UA 4BY9E 3MCZA 3EVCA 3ELUA 1G8SA 3FUUA 3KQPA 3HTXA 1I4WA 4PIMA 5KVAA 2QYOA 3ME5A 5K0NA 3REOA 3PVCA 3KPVA 3UJAA 2YTZA 4R6WA 5FCDA 3BKXA 1YF3A 4GOLD 4FS8A 4DM3A 5CCBA 1JG2A 2DULA 1L3BA 4DZRA 3E05A 3TPZA 4P7GA 3AWIA 2ZIFA 4QDKA 4CKCA 2ORED 3CJTA 2P3LA 2QY6A 3OZSA 4DMGA 3LCVB 2XYQA 3R0QA 5EIFA 5LR6A 3G2OA 2JHCA 3FUWA 2ESRA 4XUEA 2ZLBA 3UJCA 2IDKA 3OFJA 5BW5A 3LSTA 3NW9A 2O05A 3NTVA 1EQAA 3EEYA 4YUZA 1P91A 2P3QA 4F85A 3EVZA 4KRGA 4KDCA 2B78A 4AZTA 3KPJA 4X63A 4PYKA 5F2KA 3IHTA 5P8WA 1H1DA 5E2BA 4EVIA 4JXJA 1IXKA 4Y30A 3RIEA 4RVDA 2OB1A 1R6AA 3EMDA 3KU1A 4BP1A 3MAGA 4HTFB 4E32A 5ERGB 2GLUA 3KQMA 5HEKA 2YVLA 1D2CA 5CVEA 2YUIA 1VE3A 3HCAA 3A26A 1BKYA 3MB5A 4KW7A 3THSA 3NMUF 3CVOA 5LQNA 3KQQA 2GPYA 1QYRA 4R6XA 2CMHA 4KIFA 1N7IA 4KIGA 4GBED 4LWOA 1L3IA 4QQNA 3HEMA 3T0IA 4YV1A 3P9CA 1FP2A 5ICGA 2I9KA 5EMJA 2O06A 3C0KA 4E2YA 4PNEA 2FYTA 3MTIA 5KQSA 5DTMA 4CWAA 1XDSA 2XBMA 3Q87B 1QANA 3KQWA 3EEOA 4ER0A 2G1PA 3KR0A 2ZFUA 3KR1A 1N7JA 2AVDA 2HMYB 2PVCA 4IV0A 3FYCA 5U4XA 3SMQA 3BUSA 2ZULA 3BT7A 4YUXA 1JQDA 2R3SA 5C9ZA 2C7PA 1VP9A 1WY7A 2VS1A 1QAOA 2YR0A 3CBGA 3NWEA 3TR6A 3BKWA 4RVHA 4PYLA 4B17A 2AOTB 2Z6AA 3KQOA 1X1AA 3HVJA 3M4XA 1V39A 1FP1D 2H11A 2UYQA 1RI5A 4ZTBA 8MHTA 1XVAA 1R74A 3D2LA 3HP7A 3V8VA 2IH5A 5BW4A 2JH9A 3KQVA 5IH3A 5K05A 9MHTA 3O31A 3CKKA 4A6DA 4ER7A 1NE2A 3ID6C 3UWPA 4RTKA 3DOUA 3R6TA 3LDGA 2KW5A 2IFTA 3B5IA 3DULA 5EMLA 5E1DA 4QPNA 2AOUA 3SX0A 2JHPA 1PJZA 1NW8A 2AN5A 5EG5A 2NXJA 3GRYA 4RTRA 2CMGA 3ER9A 3UBTA 1XDZA 5DSTA 3UA3A 3KPWA 3OU7A 3TKAA 4RTQA 3E8SA 5EEGA 5BP7A 2E5WA 1G6Q1 5G02A 3EPPA 2Y1WA 5K0GA 1G60A 3PX3A 4M38A 2ZWAA 3OFKA 3G5TA 2ZSUA 4M36A 5K09A 2AOUB 2G71A 3GXOA 5CIYA 1FJXA 5DRTA 3E23A 2DPMA 3DXZA 3P9KA 4HSGA 3HNRA 4DQ0A 5E2AA 3G89A
chains in the Genus database with same CATH superfamily
3EUWA 1P0CA 2VK8A 3GMDA 5EWMA 2OFPA 1VZ2A 2OSBA 2RARA 4M0UA 4ECAA 3CVVA 4JI2B 3GBPA 2YXDA 2J0QA 2CFRA 2O48X 4AJPA 1EFPB 1W9HA 3O9ZA 3BQNB 1XA4A 1FMCA 1Y5MA 3F6YA 4BLSA 1DAKA 2AS0A 2ODTX 1M2OB 3SIXA 1ZZGA 3W2IA 3TRHA 2PNFA 3U6BA 5F3WB 4EP1A 3ZY4A 1OIXA 2R97A 2YV1A 1QVAA 2FPWA 3BH0A 5DULA 3LECA 3LDUA 3DPUA 3E81A 5BV2P 1LBIA 1S89A 5F3DA 4MK4A 1CLUA 4II2A 1QP0A 2WWRA 1P2BA 1YE3A 2CB0A 3CZ5A 3NU1A 1FUIA 1NVVR 1VL1A 5EE0A 1S7CA 2PMKA 3B38A 4BRSA 1JILA 1I8TA 4NFYA 2ZWOA 3G1UA 2CHEA 3HKDA 3V8RA 3WDMA 5AJVB 2C03A 4W5HA 4QVIA 1NTRA 4PX3A 1H9BA 4RV9A 2IP4A 2JGRA 2J3LA 4HV4A 3WGZA 4QQKA 1U4OA 2RGXA 4MARA 3H1PA 2NU6B 5ESXA 1DWUA 3A32A 1U3CA 3N3BC 4JLDA 2BE7A 4OAQA 1FS5A 4EKYA 1L1QA 2CLMB 2FVYA 2V7WA 4I4NA 2F8TA 1WW8A 4Z4QA 4QC2A 2R66A 2W22A 4X93A 2AB0A 2VYCA 2PTHA 2I34A 2XCTB 4J0HA 2ZI7A 2EAUA 3GWZA 2P67A 2ISCA 4L72A 4BMYA 3UT6A 2IHTA 1Q83A 1F1BA 3G2JA 2BKVA 4K46A 1UADA 1G64A 4JN6B 4MIYA 3FZGA 3PEUA 3TCNA 2VCEA 2ORVA 1ODFA 4Q7KA 3TL2A 1Y6QA 4MICA 4DY4A 4EF4A 2ZETA 2V5AA 4CKBB 5KYNA 5H16A 2PJDA 4AX8A 4CUJA 2PUJA 4O8CA 3KCQA 1G5QA 1WUJS 1XCMA 2QS9A 3FDIA 2CSUA 4HNSA 1P9RA 5LJIA 2WMDA 3B70A 4W4TA 4E70A 3OZRA 4MPPA 1E89A 3BIXA 2Z5LA 3JZFA 4ND3A 1L8AA 1USUA 1U81A 1EJBA 2LD4A 1M8PA 1R0ZA 2Z2XA 4OP2A 5DCLA 3TQSA 3EZFA 1BVUA 2PXHA 2R84A 3Q10A 1GGKA 4OLFA 4ZQIA 5SZKB 3R7BA 3GLHA 2NUTB 3VMFA 3TTTA 4B6RA 3I2FA 4DDVA 4HFJA 5BV8A 4D9IA 1RADA 2XZPA 4G97A 4YJHB 5DT9A 4RD2A 5E6UB 1H94A 4QX6A 4UATA 3M70A 4RMHA 1FYEA 4XZ3A 1I2MA 4CQJA 2PUBA 4ZVUA 4DDUA 2QPLA 2QRQA 2HRRA 4YYZA 3NNNA 2GA8A 4ZQCB 1JDJA 1O3YA 1JSLA 3RTCA 3GPIA 4WHMA 5B55A 2C8JA 3C7DB 4KWHA 3FUCA 2VQSA 3MEQA 1IWPB 4HBGA 1RLUA 2FUKA 2X3UA 4NFLA 1E2EA 4E21A 1NRJB 1HY3A 2P5TB 1O5OA 3BPSA 1YOBA 1QKIA 4X71A 3QNUA 1JQAA 3MERA 3H83A 3DLBA 2B1QA 3VR2D 3MMSA 4JCCA 1JMKC 2V0GA 3C41J 2VAWA 1C4OA 2DJIA 5LYJA 4Q4HB 4RK6A 4IYJA 2W2PA 5K4GA 1FFGA 1Y63A 2JZOA 3U26A 3OFND 1UWCA 1W94A 2B4YA 4FOPA 4P4SB 4QBFA 3WHPA 1M5UA 2X1VA 1XHFA 3BQMB 3FSGA 4BASA 3EXHC 4ENUA 5BXQC 4ED9A 1XTZA 5BUQA 4DXDA 1UXHA 2APJA 3H9CA 4MYSA 3BZBA 4RIGA 6REQB 1JXOA 3V97A 1PYOA 2ZKIA 5H3HA 1U2QA 2NXCA 3G79A 2C7RA 2ZCJA 1YRYE 4R40A 4YRMA 4PNPA 5KWEA 1J2UA 4NU0A 2VCHA 3HJTA 4FMDB 1H8EA 4OREX 4UBMA 4A6XA 1G7CA 2RGBA 3OWXA 4EPYA 5JZBA 2DFTA 5A0FA 1PL8A 2VYQA 5C7LO 2HV9A 3MRXA 1EZZA 1WSAA 2GCGA 3KQTA 1A82A 1JZTA 1DEXA 2HEGA 3BBPA 4GFDA 5H59A 1O94A 5L7YA 4EA6A 4XWGA 1LQ2A 1N2XA 1M72A 5FLEX 4RM2A 1ZINA 1ECFA 1UJ2A 4HNUA 3OZIA 3F3MA 2CLFB 3QVSA 7ABPA 3WYNA 1R4MB 5TX7A 4KODA 2E48A 1ZOLA 1KY4A 5FBQB 5HF8A 1DO2A 1RWQA 1Z82A 4L57A 1WLSA 4D0SA 3LQ1A 4CTJA 1D6JA 3I5UA 4WY5A 3UKDA 3N2KB 3OUZA 3OZTA 4PYRA 4YMUA 3GLIE 1NLZA 1MRNA 1GNTA 2AC2A 2EJUA 3GFTA 3QYPA 4YIKA 4AY6A 4PIPA 4KAJA 4Q05A 3GH1A 3NDJA 1XZJA 4YROA 4EQZA 2EP7A 3C4VA 4YCAA 4HQOA 4X54A 5FUXA 1EAMA 4EG6A 4JLNA 4I9GA 4R8SA 1L4LA 2TYSB 1KK3A 3D3WB 2Q50A 2C54A 2E55A 3MWEB 3FD8A 2A9RA 1K88A 1E3JA 1V1RA 1YO6A 2JDIA 3D6AA 3I3SR 4Q15A 1XRJA 1Q0QA 2J9YB 4O33A 3HL4A 5AJZA 2K5UA 2WTNA 4O2LA 4U1RA 4KHPB 2BDEA 3T9BA 2Y4OA 1XEWX 1Q50A 2VWHA 2NYAA 3A11A 3C98A 3PI7A 3RJ9A 4MZDA 3T0FA 3KZNA 1XTSA 3UMVA 5HW0A 3I6YA 5IWCA 1EX9A 4OHUA 4UFPA 3V7FA 5AJXA 2EFDB 3M1LA 4IKOA 1N2HA 3FOAA 1GLVA 4TXMA 3IUBA 3WMGA 5MDHA 2AJ8A 3ZLBA 1QHIA 4AB1A 2WJHA 1T3TA 1JA0A 1B1CA 2HMUA 1NQOA 4YLEA 4DLRA 1NT2A 3OLYA 3SZOA 4Y98A 1FJGB 2CUZA 5C5CA 1X1BA 5EUCA 3OAAA 1UOOA 4X7BA 3BZUA 4YK7A 2PMBA 1M34E 4IVNA 4QWMA 4RF5A 1F20A 3MK31 3OKFA 3SD7A 4ILKA 2QEQA 4O0MA 4Q7LA 3PQDA 3F4LA 1FNNA 3M4NA 1AQUA 4H7FA 5IABA 1ORDA 3W77A 2PH3A 1WUHS 4TMYA 2RD2A 3AU8A 4HWTA 2A4MA 2WHPB 2UZ1B 1AKMA 1SZCA 5J5VA 3OQMA 4OJKA 3TLMA 4GP7A 2EX4A 3II6X 4MLPA 5AM3A 3AUTA 2JIZD 1QYIA 1B16A 4JNCA 4N5IX 5K51A 5AM4A 5A4DA 3M49A 3IERA 2X5OA 3NXKA 4BHTA 3K71B 3NBUA 2Q5FA 3CRW1 4G85A 1E6CA 4Y2VA 3UGTA 4N5HX 1A71A 1CFJA 2AG0A 3W6NA 1X87A 3FUTA 4MITA 5D51S 3DOCA 1J8VA 1ISHA 2FOXA 3HP1A 1N78A 2QU7A 2XDYA 1VC2A 2Y1XA 3R3VA 5FEMA 2NO0A 3BE6A 2WDZA 4EFNA 3ZVRA 1S1CA 3GCGA 5IANA 3D3KA 1Q6ZA 3A31A 1PTJC 1SD5A 3HM2A 2Y93A 2QM7A 2WYHA 3C2QA 3D8HA 3GYBA 3GWGA 2VAVA 4R2IA 4TRRA 4DG5A 1YAHA 1U8AA 3HGTA 3JY6A 3KXLA 1E59A 4PLPA 4XQCA 3RRJA 1J97A 3GGPA 1CY2A 2GCNA 1HZJA 2D0IA 2OBXA 3Q2OA 5IKMA 5HNKA 1VKOA 5J4LA 1DOAA 1TZJA 1Z6PA 5JW6A 3EULA 4B6OA 4IJMA 1THGA 4HKTA 2ZJBA 2J9ZB 4NYMR 3JD1A 3CCBA 3S2YA 1L1EA 1FDVA 3JQ7A 3QKWA 3IEMA 1WBBA 2P0EA 4J1QA 1NBMA 1JU3A 7MHTA 3ZE1B 4LY6A 2ZB8A 5TNXA 1T0IA 4YMVA 2Q4TA 2HO5A 2GVZC 2B0CA 5FD8A 2PL5A 4X6YA 4FXOA 4EBFA 1QK3A 4RDHA 3IEKA 1GR1A 2OWDA 3UWKA 1F14A 4I46A 4OQXA 2QW1A 2B8JA 3OURA 5K6TA 1A76A 1QC5A 1D03A 1Y4AE 4EUKA 1WCIA 1NJSA 4XB2A 5EIBC 4QOIA 3HDQA 5CAEA 3G2MA 3WOHA 1TQ8A 4CQNA 1G38A 3AIOA 2QTTA 4RENA 4A6PA 2CL7X 2BP7B 3QQ5A 1GGMA 2VOJA 4P86A 4UZFA 2MYPA 2PMWB 10MHA 3A27A 1GFZA 1JAHA 3ICWA 3MS4A 4I4IA 1I13A 1WEHA 2HBQA 4YCCA 3THRA 1U3UA 1XBTA 1B1AA 2OMKA 5KNBH 3OLWA 1BH6A 2HADA 1GCGA 3LXRA 2XH8A 3OIWA 3QF4B 5AKGA 5EMMA 3WJ2A 1Z2AA 2WIFA 3HJUA 4G2TA 2JFNA 2Q3EA 4WAUA 5JLJA 2JBWA 3TXAA 2XUDA 3SJAA 4MA5A 4BO4A 2WKPA 4C0HA 4UEWA 1ZCFA 2FW7A 1O94D 3OCYA 4GMFA 4X62B 3HXQA 3OZFA 5CITA 2WTBA 3UO8B 2P78A 1P3Y1 1TTHA 1IN1A 1VIYA 5M34A 1YONA 1ZGBA 3KT0A 3W6PA 3UWMA 2C57A 3WYEA 3OZUA 4B6EA 4MWOA 1ZMOA 1PL7A 1FFDA 2J87A 3U3JA 3LC7O 3AUFA 4TLBA 1YKFA 4KQIA 4BOYA 2FFAA 4OYLA 3ZZ1A 3EGEA 4KGXA 1O0CA 3NBKA 3EQ8A 4TUYA 2KSQA 4DC9A 3HGMA 4C3VA 2EW2A 1E2BA 3MBIA 1KY2A 5KUTA 4IJWA 5HQJA 2JLWA 1BTOA 3GJ8A 3PKJA 1FNMA 1TLLA 4ETNA 1I0IA 4KWEA 5FRDA 3NTQA 4PO8A 4BXOB 3PD1A 5BT8A 2I66A 4IF6A 1A69A 4Q1AA 4LZWA 4Y1RA 2PH5A 3IQWA 4RHXA 3C74A 3IKJA 1XQ9A 3JQBA 1UXKA 1NM5A 1D2MA 1ZMTA 4K6HA 3ZXXA 2DQYA 4BQFA 5KWIA 4MKRA 4RY0A 2ZM6B 4A92A 9LDTA 3JQ8B 1WZEA 4JEHA 2V7QD 3WLEA 3U9LA 4IMRA 2ETXA 4LZJA 4X9XA 3PQ2A 4S05A 5I7AA 3CRRA 1NVTA 3U7HB 3IAHA 3TQIA 3D4NA 4NTZA 3DEAA 4YH1A 2BBWA 1IEQA 3Q2IA 1OZAA 4RPHA 4WTOA 1UM9A 2GI4A 4Y0AA 3FLMA 2G9RA 2OZPA 5AKHA 4NS4A 2FFBA 5CCBA 1R5BA 2RAVA 2WVJA 3IDZA 3IOMA 4ZI3A 1F0YA 3EZGA 2QUBA 3LT1A 1PV1A 2GHTA 2NX2A 5J2UB 2X9VA 3RVLA 3B9BA 4QYXA 5EIFA 2OV8A 1QZXA 2VEDA 3P1JA 1I4LD 4WI1A 1BS2A 3O03A 3K53A 3N70A 4LZAA 3UMGA 1LK7A 3EVZA 3LYLA 4ERXA 2QG9A 4DCTA 5JT1A 3CVXA 3ZXYA 4GM4A 4G4IA 2QTCA 4CCYB 1E9DA 1ESDA 1IXKA 1GFWA 1GTVA 4GKVA 2OK8A 1MIOB 1VCNA 2OZEA 3NKLA 3TNDA 1IXYA 3EW9A 3ZHSA 2WIDA 4OQZA 5T8KC 1P0FA 4DA0A 5CB4A 1ZX1A 2QZSA 4FQ5A 5CNIA 3G5MA 5BW8A 2JIZA 4B3HA 4I55B 4ZYYA 1K86A 4XIGS 2CJPA 4BRUA 2R2AA 4KFCA 1HMPA 1EM6A 1H3NA 3VNRA 2ZXEA 3PT5A 4EX7A 1M76A 2VKTA 4F3KA 4RNCA 1KXJA 4WASA 4Y9SA 4D9HA 4A26A 3F46A 4OOEA 4EATA 3KSRA 5T41A 2QR3A 4E3WA 1T10A 2H1FA 2YYZA 4PS1A 5CLJA 3MC1A 1Q0UA 3VKHA 1UKVY 2A5GA 1C0EA 2ZULA 4YRGA 3QVLA 1U28C 3VOBA 2W6IA 2QMOA 4P9NA 2Q5QA 2FUG6 4FGJA 5K8IA 1YTUA 4DT1A 1DIGA 1QTRA 2PAAA 2Q1UA 1NFRA 3N9IA 1PEYA 3HVJA 3L0CA 2CJXA 4I6JA 1ZN9A 2XQVA 3FGZA 4R54A 5LZ7A 1DXOA 4CEHB 1XVAA 2O3SA 2JIQA 2R6DA 4U0KA 1X92A 3T15A 3DEFA 3ASYA 4BNFA 2JJ8A 2IH5A 1CUDA 2JKYA 4NBKA 3CKKA 2OENG 2KJQA 2QTLA 1E6UA 3MWJA 3QKIA 4ZYUA 2EWWA 4PEVA 1OYOA 3U3DA 2WHYA 5IVIA 4F4UA 5BQFA 3DBHA 4ACBA 1GGNA 2X5KO 3JQEA 2JI8A 4DRXB 4LI3X 1QX3A 5DNWA 1JQ5A 3LCMA 1DHTA 1JR2A 4X6LA 3VV2A 4UM9D 2XCLA 2D7CA 4I99A 5H81A 1BXZA 2ZR9A 4E4RA 1C9MA 4YAKA 3OHMA 5IH7A 5K20A 5E9AA 3VV3A 5EEGA 2NZWA 4O2BF 4Q9JA 3NIDB 1LY1A 2X0RA 4AD8A 4YUAA 4F3TA 4FOOA 5K0GA 2X2OA 2JLZA 1G60A 2RGAA 3NX4A 1CR6A 1DS6A 2C2ZA 3K15A 5C8YA 1YA4A 3N2LA 1YHYA 4AZ3A 5IUNC 3AVPA 3GXOA 1CY0A 2EDCA 3ASZA 4G36A 1YOVA 3WGVA 2F9FA 1IB6A 4RHFA 1K3FA 3FMFA 2BHNA 1UKCA 2HGZA 3DDHA 5AD1A 3B1WA 5ELLA 3RVJA 3BORA 3I4CA 3BHJA 3D8NA 1ZSNA 1EBBA 1LVHA 2CHVA 1F38A 2NPOA 4R2XA 4BKUA 3QBVA 4KN8A 1FDSA 2YY5A 3TNJA 3FMPB 3N0TA 2OO5A 1JG3A 1WV1A 3HFJA 1G41A 5C4IA 1TVEA 2FK7A 3OPXA 3WTBA 1GTG1 3H17A 4FYVA 5JR3A 5DJ5A 1ZY2A 3D4PA 1JA9A 3ML1A 1SIWA 3QYAA 3B1JA 3UOWA 5JJKA 1U9JA 2PT6A 3QOYA 3FFBA 4AZ0A 1M33A 3PTZA 4K3VA 4WJKB 4DSZA 4GEGA 3O4VA 1NI5A 1G2PA 5AWFC 1R8XA 4ZVQA 1V2HE 3R40A 4UW9A 1VLQA 1N6HA 2PAFA 4PPYA 1QG4A 2WD7A 5TMEA 2GF2A 1O03A 2BKUA 1XTKA 3LDFA 1MNAA 4MR7A 4MW1A 3N5KA 4RZIA 4TKMA 4Y0NA 3SJCA 5LSAA 2VSYA 1TPYA 3R7DA 2AD1A 3CZCA 5BNTA 5CYOA 4MQFB 3VRHA 1J24A 3CWCA 2FUG1 3RSSA 4ZREA 2J09A 3BF8A 1GCOA 4IHAA 1QTQA 1K5HA 4AKGA 3E3OA 3HP4A 3FNGA 5E38A 3RTEA 2B2XA 2JK0A 2AFHB 2IUTA 1PG5A 4IW3B 4B3MB 4EDHA 1SQFA 1ZQ1A 5AI9A 3HU5A 1BOFA 1YDGA 1VJ1A 1M8GA 3O9MA 5KOJB 2WWVD 3JZAA 3YASA 2Y6VA 1PZHA 4TWJA 4B5LA 5JI3E 2Q9AA 5L9AA 4I1VA 3SVZA 2ADMA 3V2GA 4BO9A 3FCUB 2YQZA 1EXWA 4WZAE 2FPOA 1BO6A 4RWEA 1IPFA 1AH2A 2KQUA 2N46A 3S68A 4CEJB 4UHDA 3ST7A 4GX2A 1DARA 1O97D 1S8NA 2IELA 5G3ZA 1XNQB 3KBOA 2I62A 3TLAA 3HHPA 1ECGA 4GL2A 5GJBA 2ONZA 1QE5A 1W59A 2Q5EA 2IBMA 5H5JA 4X1KA 1II9A 1ESMA 4AP5A 2W2NA 2BGRA 3WAKA 4QYWA 4IRUB 4TV8F 1XRLA 3GELA 4CGYA 3K1TA 3TDMA 4J0EA 3UOGA 4KJZA 1PS8A 1HLFA 1Y37A 1PJ2A 3NHMA 4RTNA 3JSAA 1F2VA 3RQIA 2PZGA 3VZDA 1G7SA 1KI3A 2WVGA 5CT8A 1Y6GA 3DLIA 3PF8A 5JY1A 1KI2A 3EGOA 4NJOA 1QHHA 1WB9A 2C31A 1W1WA 5FI5A 4A36A 2XMPA 3QTLA 4WWHA 3NHUA 2ASEA 4MQLA 1GL6A 1AN9A 1NXTA 4L0MA 2PCLA 5K6AC 5BWOA 2YXLA 5FPSA 1PR1A 3VPFA 4D6YA 1QHNA 2ZVPX 3P2MA 4F1WA 1EWVA 4R0NA 3CLKA 3VU0A 4RSMA 5EHGA 1KDVA 4BMSA 1LLQA 3CJQA 4HSEA 3RF6A 3WO1A 4BWYA 3HM9A 3AY3A 1U0OC 1YU9A 3HLYA 4CHGA 5JJCA 5JSQA 3FHJA 3E03A 4JFRA 2FMHA 3K0AB 1QS0B 4D4JA 4E5YA 1W35A 3OPQA 1IOZA 1NQXA 3EZLA 4M1KA 4Q12A 4U2GA 2H8KA 2AZTA 3OVMA 4H1VA 3OZ7A 3BJIC 1HTTA 1MAAA 3BMOA 4QYMA 4V0KA 2XB9A 1FJ2A 4P58A 1S2NA 4EPWA 2IX3A 1RRMA 2DLNA 4EJFA 4AT1A 4CYMA 1SU8A 4B2PA 2VFAA 4H4DA 1Z0FA 2Y4NA 1XAJA 3AX6A 3ED1A 2IV2X 1RIFA 3KALA 3VGPA 1J5EB 5LYYA 1HTBA 3ZVNA 2CVPA 1QCDA 2EGGA 1QYDA 1Z5PA 4DLUA 3OESA 3EB9A 5D2CA 3VKUA 4LJ7A 4IIJF 1XZQA 2OORC 4TKUA 1U7OA 1DNPA 3OX1A 4NBLA 4U2FA 1M54A 3X1YA 3H2GA 1XEXA 3B5JA 2ANCA 3IIMA 1XZLA 3BRWA 4TXJA 1NBHA 3RK1A 3F49S 3TW6A 2XZLA 1BS1A 1ECJA 1RM4A 4TOIA 5JYCA 2A3RA 2JA2A 4KFRA 4CMEA 5AP9A 5ILGA 3Q0EA 3TN7A 1H22A 3RBZA 3HCBA 2FJ0A 2H16A 4BLVA 3QUSA 4DSTA 1I3MA 3GRZA 3RYHB 5KSOA 3L43A 3ZKAA 1CEQA 3FVQA 1CIPA 1YRHA 4ZVTA 2Q4DA 2ZB2A 3ADOA 3RUHA 2DCMA 3I2YX 2NV6A 4HDNA 1DJNA 1SPXA 4NG5A 5JMPA 5AJUA 5GIPE 3F4KA 3T1YB 5TRTA 2Z08A 4AO6A 1UT8A 3PS9A 1Q84A 3E9CA 4KAXA 5F33A 1GU7A 5HBRA 3CR7A 3LHDA 3NONA 1I01A 4NAUA 3V8BA 2VLIA 4JI5B 4DLAA 2OM2A 1K7XB 1XLTC 2HZ7A 2WUEA 4LFCB 1RXCA 2P90A 3U7QB 1QQ6A 4UUMA 1DQPA 1RFLA 2PT9A 3WB1A 2B25A 2HSJA 1GQ2A 1IHPA 4PG7A 5CXQA 5FO0A 3B52X 3V8MA 1B73A 4XOIA 4PAWA 2DECA 2HSWA 4FHGA 3EVEA 2PXXA 1DBWA 2VATA 4GPIB 2DYKA 1UXGA 2A5DA 3C97A 4N8EA 1Q0HA 5ARCA 1S02A 2MR5A 2X7JA 2O8CB 1JBKA 5ESWA 4PYMA 2A5JA 3SGLA 3MMZA 1DBRA 1UFQA 4TQAA 4DVGA 5MN4A 1KDZA 1ETUA 2FEKA 3WNCA 2N42A 1MTOA 1Z0AA 2B37A 4HO1X 5CJJA 3QHQA 1L4UA 1VGQA 1N6NA 4DCMA 3NG1A 2QTWB 1Y33E 3DTNA 1W4RA 4PY2A 4NBNA 4UHCA 4GLLA 4G1VA 2NUPB 2CD9A 3QLUA 3FSJX 3TTYA 1J23A 2YWHA 3R5JA 4J1TC 4UAJA 4QOEA 4WGFA 1GZ7A 1ZKDA 3TOZA 2CLSA 4KXNA 4F6RB 4JP5A 5JAIA 2AGVA 2AOWA 4FONA 4G9BA 3DMRA 4S04A 4UQLA 3BG5A 2IITA 3P4XA 3MGAA 4B80A 4QGAA 4DQLA 4KQJA 3F5DA 4CW7A 1L5SA 2VP4A 5JH7B 4NVRA 1U2SA 1Y1TA 1BX1A 5BNWA 3K6JA 2F1RA 2QRVA 4BBJA 3W78A 2HK6A 2F3SA 2FFQA 2WEKA 3SZUA 2EFJA 3OM0A 2Z58A 2K4MA 3MINB 4I6EA 2PSDA 5CVDA 5LKRA 1W5EA 4WXHA 1DAMA 4UREA 4J0IA 1XL0A 2VSOA 4WFQA 3V1LA 4XUDA 3DD1A 3WX0A 2JLAA 5L3VA 2Z4TA 5KMGA 2I3BA 2VHEA 4YRSA 4RE5A 1POXA 2QXTA 5FNVF 2HR1A 1GSAA 3AEYA 3DDUA 1T2NA 1T3GA 3WHIA 4PQGA 3CGGA 3COSA 1LDNA 1S2OA 1UDBA 5L7WA 3DVQX 2LIPA 2Q5CA 1CNEA 1MVNA 1N7GA 3PRYA 1QWSA 4LSGA 1MDFA 3GEIA 2VJPA 5AOBA 4PGFA 3BL8A 2LRHA 2UYOA 2ZWIA 5EZQA 4IHKA 1BGWA 1PK8A 1X15A 4QVGA 4XRRA 4AZ3B 3JVIA 1XCJA 5CBKA 1FFXB 2EL7A 1A8QA 3TLEA 3QLVC 2AXEA 3BB3A 3RVPA 4YRIA 5KSWB 3MRSA 2RB4A 4QJBA 3HXKA 5KTPA 2QAGC 3HGQA 2TRSB 3AG6A 4GDMA 4HQRA 4L27A 3GX1A 4CR8A 5FNVB 3WICA 1KBQA 4LDRA 4LK3A 4YX9A 5LQUA 2E49A 2FAXA 2GEKA 3EVFA 1AURA 1KDPA 4REMA 1P45A 2X2PA 3F7TA 4XIIA 1LPNA 2QRZA 3RNOA 2BGLA 1ND6A 2O2JA 5DGIA 2ENUA 4JJFA 3H4TA 4BUZA 1P1KA 4ZV9A 2E4XA 1ZM3A 1JSXA 2VNSA 4JT2A 2OHIA 3CEHA 4L07A 1G9XA 4NJEB 4P8RA 3NKVA 1ZAKA 4EW6A 2WWIA 4RFSA 1QG0A 5CDYA 3HRHA 1CUXA 1T8YA 3NM6B 4JLBA 1NU6A 3ELYA 1IK6A 1ZCAA 1IN8A 3UAWA 2AX4A 4I36A 1MB2A 3ETEA 4LOJA 4P7KA 3N6VA 3V6LA 2F67A 3BTOA 4QLOA 3V9AA 2AK3A 4DL9A 3RR2A 2NSJA 3E15A 2ZI3A 1K9SA 3ZHZA 4HH3C 2YXPX 3OZWA 3TS1A 3DM5A 4HTFA 1XK7A 1N1MA 4B4VA 1M8FA 1SO8A 2P2GA 1ZK3A 2BJWA 3WJ7A 4WZ6A 1KHTA 5JNWA 1FZTA 5KCZA 2K87A 2B3TA 2IOFK 1Z2DA 1ZL0A 1SNYA 2ORYA 5DPMA 1ENYA 4RD6A 3TSCA 4F3RA 2HXSA 3EVAA 4PVCA 1XVLA 4TS3A 5HKAA 2D1TA 1T4BA 1UXOA 2Z57A 4R69A 4L85A 2O7SA 3Q9SA 3QY9A 4RQBA 4FB5A 3RAEC 1RQPA 3L92A 3U0BA 3AQ4A 3ANSA 1ORHA 2Z1NA 3LQ2A 5B64A 2XIQA 4O2AF 3UUGA 1MAWA 2D1FA 4QDTA 4FNOA 1NN0A 1UJBA 4EY3A 4PLYA 4ESHA 4ZZIA 1MAUA 2IYFA 4PCLA 5K99A 1U1FA 1VL2A 1EWYA 2UVDA 1M0TA 1PFQA 3CUVA 2VPIA 3HDYA 4PG4A 1PFUA 4UUOA 1EUYA 6ADHA 1NQAO 1C9EA 1L4EA 5CVTA 4ZOCA 4NZMA 3DJFA 1V7PC 4QRDA 3QV2A 4TYMA 1HGXA 2NUAB 5KWVA 2GPAA 4M8LA 3DA8A 3CB2A 1NBWB 2X40A 2IP2A 4JITA 1P2FA 1Q6YA 2ODPA 3AOEA 3ESQA 3N2GB 4PR3A 4ZO6A 3SX4A 4HDMB 7ADHA 2AFIB 3DCJA 1ZVMA 3ICCA 4NZPA 3LFUA 3PNYA 1EFRA 5DNCA 1WB4A 1WULS 1K89A 1QV6A 2OO7A 1FU4A 2P4EA 4L78A 5KVAA 3K9FC 3TO5A 3I6QA 3DO5A 2G1JA 4M9XA 2YJNA 1C8VB 4AJNA 2XZTA 2PUVA 5GZ3A 1SAYA 1W96A 4TSFD 1E0DA 4C0KA 3ZKWA 5D3QA 5J4HA 4P84A 1L4MA 1NUHA 3SEAA 4BVKA 4ZMRA 5ADUS 1GU1A 5B1DA 1P1JA 2FG7C 4B6PA 3R0XA 1CNFA 5KQLA 1BMTA 1VSBA 3ZUPA 4ETWA 4G5FA 4N5LA 2P3LA 4E1BA 1FVXA 2WOJA 5U1PA 3UV3A 4YMIA 3UW3A 2EEZA 3ORQA 1H23A 4L8YA 3BHIA 4RGBA 4BECA 5AO9A 3A8TA 3QVVA 4OJMX 4XUEA 4HUTA 3IALA 4MRNA 3GRKA 3UMMA 5HTOA 1QB7A 1PDOA 2X9LA 2DEUA 2MR6A 2Z2YA 2B4KA 4ZQBA 2AHRA 3W79A 1W49A 3WP1B 1U99A 4MVJE 1X7YA 2WPDA 5EJ7A 1BE8A 1OFUA 5GADl 4Y7DA 1BGXT 4DWOA 2A9QA 3PXUA 1MVOA 3FCYA 4HZIA 1KJ9A 5DHSA 2CNWD 1QS0A 4H08A 4WOPA 1PW5A 2FF7A 2V65A 3VU1A 4U2BA 3GF4A 1QVVA 4M7WA 1XCOA 3R5XA 2ORWA 4HFMA 2HU8A 4S1VA 1TAUA 3MYRA 4J9UE 1LLFA 5BMVB 1TQDA 3HXLA 4CKEB 2A67A 1JZSA 2N1BA 4K5QA 4QG7A 4KIFA 1N7IA 1T9GR 1ZMXA 2I0FA 3M4JA 4NHOA 4RF3A 4GNRA 2PSJA 3PHJA 1JH9A 1KVQA 4FJ2A 5JD6A 4XFKA 4FUQA 6Q21A 3VHLB 4BFUA 1ODTC 2GK7A 3GGOA 4KR2A 1W87A 3AO0B 4AG3A 1EP2B 3NYRA 4E5VA 1NQ5A 1O6ZA 2BBOA 4GNKA 4KN6A 3EEOA 1GZSA 3C8ZA 4IV0A 4IFBA 4OAOA 1MMFB 1JHXA 3SMQA 3GLGB 1FW8A 2O2CA 4MPTA 3BT7A 4BJ1A 4JOQA 4DHWA 1DKMA 1I2CA 1WY7A 3CIFA 4DIUA 3IIEA 4WX2B 4RVHA 1YUNA 2Z6AA 1JI3A 4A8JB 4EI7A 4KVFA 2A9OA 2PVPA 2BMVA 1WHSB 1E4EB 2QZ9A 4UTRA 1E5VA 3VAAA 4GKJB 2FV8A 3NASA 1OC2A 1YZLA 4IJUA 2B8EA 5G0TA 1X77A 3RJ5A 2RH9B 1HE4A 1GAQA 2V6BA 1XEWY 1QV9A 1NE2A 4ENRA 2IYNA 2MYNA 4Q3BA 4ZDJA 2ID7A 1JBEA 2G9UA 1MB4A 1RBZA 2AXNA 4DJFC 3Q12A 1KGDA 3QVTA 1DX4A 1J8DA 5E1DA 4BTVA 1OIWA 2IYOA 4N9QA 4QPNA 1Z17A 3H4IA 2YWXA 3SZ3A 1H0RA 1YL6A 3JYOA 1ICIA 4GOKA 4INOA 1DWQA 1BXRB 2X0IA 3NBYC 4JIGA 2RHMA 5B3JC 3K5WA 5BN5B 3K72B 3ETHA 3T9FA 2UYGA 2BEUA 3T8YA 2ZAYA 4DB4A 1H65A 3JASA 1F1JA 3QE3A 4GX5A 3SLGA 4CL3A 3HUFA 3TE6A 1CF2O 3ADKA 5IX8A 1BAPA 3GJXC 2VP2A 3ZHUA 4ES6A 2EC5A 4M0MA 4RJLA 2BI8A 5LZ9A 2GXSA 3IPRA 1MZPA 3SCZA 5AXDA 3ZCRA 3I83A 1Q91A 3GJ0A 5TJHA 4TKVB 3VPAA 4C01A 2IPNA 1CQPA 2G3YA 5IM5A 4FLFA 1AJEA 3WWDA 1G1AA 2DUMA 3BSWA 1KPHA 3PNBA 5BSRA 4MUMA 1XDBA 2PRIA 2I8LA 4QRHA 1J0CA 5SY4A 2X4DA 5FFMA 3SU8A 1WDMA 5YASA 4ARBA 3ETLA 7AT1A 4F8YA 1PLJA 3EBOA 1Y9JA 3G1WA 3WQRA 4IILA 4YAGA 1PV4A 1NG9A 3RVSA 3WL8A 1GPJA 3IC5A 4MUYA 4UMVA 4X7PA 5JWHA 2EBWA 1YH3A 5NULA 5FWAA 1CUYA 2DAPA 3BWCA 5EPUA 5F78A 2OUIA 5FUBA 2QOEA 4FFMA 3V5NA 4AZSA 3AEUB 5BUCA 1FSSA 3QUBA 2H2IA 1K6JA 2AEMA 2WB2A 1E2NA 5A5VA 3AVVA 3NCTA 3L41A 1K27A 1WXGA 5UKDA 1UBUS 3H3FA 1XJ0A 4GZ6A 3M4YA 4NK5A 2B1RA 3CHYA 1RI2A 2BGMA 3TSOA 4BB5A 1UAAA 4INZA 1U3VA 3RV4A 4EFDA 4CM9A 1P9LA 4ZIRB 1JXMA 3TIXB 4IJVA 4YMWA 4R1QA 3V4FA 1C2TA 2AEJA 5CLQA 5BURA 4Y18A 4E4TA 5BXYA 1KYZA 1H1LA 2GPTA 1GPUA 4IF4A 1DQZA 2IPXA 4MS4B 4TVKA 4YA6A 3HCNA 5HGJA 2ZJ4A 4B35A 4WT7A 3QJGA 3QOWA 5JDCC 3AU9A 2OAEA 4LMPA 5J2TB 1OW3B 2YWFA 3PDHA 4RANA 4ARCA 3KYBA 2G5TA 4A6EA 4N0MA 1NJGA 4B76A 2BJVA 1JWBB 2HEIA 3WWPA 2N75A 3MWLA 4AUKA 3ENVA 4KXLA 3KETA 3N6RA 5C7IO 1UBSB 3DUFA 3TZHA 1JE1A 3M89A 3RFFA 2OHVA 1MOPA 3TECE 1TJ3A 3CPEA 4HCJA 4HYYA 2OD9A 4HDKA 1ULAA 2BPOA 4IGFA 1JTVA 2W42A 1HYBA 4M53A 2I7VA 1FNBA 3ED5A 1MORA 1N5IA 1A2BA 1D0IA 1WDKA 2CE7A 3VC3A 4HLNA 1U7XA 3UK2A 1ULBA 4J6EA 2Q1WA 4GKBA 4B7XA 1EDEA 1O9GA 3LL4A 4UCFA 3KG2A 3TK1A 3UBMA 3QU2A 3PQ3A 3AR6A 2Y1FA 3FB1A 1GV1A 2A5FA 2ZBPA 1Z4LA 3HBMA 4OUDB 4Y2GA 1XF1A 2F6RA 4PHGA 2M9MA 4HF7A 2QUIA 3FOZA 3JQRA 4IKPA 2FOIA 2OHJA 2WA1A 3G2PA 3P5BA 4TKUB 4BNKA 3KE9A 4AQ7A 1D1PA 1Q14A 5IFKA 4NJEA 1RZRD 3QTBA 3UKOA 2XYPA 4TSRA 1WMEA 5CB4F 4JZYA 3EXFB 1AY0A 1G8GA 4NYIQ 1YBVA 2NTVA 1GG9A 2G1KA 2Z9DA 4ME6A 4U7PB 3ZDEA 2HIMA 3M1YA 1B14A 2V7QA 3OWHA 1E1RA 4FK8A 4M9QA 4DUGD 2JATA 4BAZA 3R9IA 4FGZA 4TLEA 4DMCA 4ZK2A 5I8WA 3O4HA 2D5CA 3CH4B 4RPJA 1O5IA 4WOKA 2GETA 4NBWA 5AJYA 1J6UA 4C2AA 2GAJA 1SXJA 1E5TA 5DRYA 1JR6A 1QVWA 4JLMA 3LL7A 2X9NA 3F6EX 1K9VF 3GJ6A 2NTEA 4GOXA 2CVQA 3RBXA 3EVNA 1KJIA 3RSQA 3U7GA 1TCUA 1MG5A 1WDTA 3IQZA 5AOVA 4AJJA 1PF7E 2GWRA 1QOQB 1SUFA 3KT3A 1AMNA 4Y9DA 9GPBA 1ZG3A 1Z75A 3PLAE 3EDQA 1SBNE 3P26A 2CNOA 5EKUA 2X0DA 4DAEA 3GGGA 5KJEA 2VEOA 3L6CA 1HC7A 5ED0A 3DLCA 3NR2A 2SKEA 3MAJA 4D4MA 4U4AA 1OFVA 3KP1A 4E07A 3PGLA 2HFJA 3B6ZA 3F9CA 3TTVA 3DLPX 1GL9B 4FYXA 4JUFA 4CM6A 2P2NA 3U4QA 4E94A 4U02A 4MWTA 2GN2A 4L16A 4MR9A 3F1KA 3ZHXA 1RAHA 4AM8A 4B44A 1TMYA 2IEZA 2PSEA 2W37A 1OWNA 1E0JA 4WZAA 5BYKA 4M7RA 1VFNA 4AJ4A 2IW1A 5TQJA 1HETA 1ZICA 3UK1A 3UXEA 1BQ4A 2DKNA 4S3MA 3RS3A 2G7ZA 3W6UA 1XEAA 4Q1BA 3NS7A 3LG2A 4IS2A 5JXGA 1GVHA 3GN1A 4YLGA 4RYLA 1XVTA 3F6SA 4KXUA 5TE9A 4OJTA 4QTZA 5IF3A 4BNNA 4Y9RA 1DT3A 1K8RA 1NRXA 1VQ1A 3CRZA 3QWFA 4IQFA 2A0UA 4M83A 4WA8A 2WRZA 4Z0HO 1Y5LA 4E5UA 4C04A 4X45A 2FZGA 2KBFA 1RQXA 1LVGA 5B7PA 1X8JA 4PAQA 1EFAA 1JLLA 1XU9A 5ALQA 4CQMA 1MN6A 5KNCD 2FMFA 1CRZA 2PA0A 4YP9A 4OGKA 2AE1A 4MO9A 4JMLA 3TFWA 1VE5A 3ZKWB 3KR9A 1UBOS 1REQA 1ZBDA 5KOJA 4V0LA 2VUHB 3GA7A 3D6UA 4UU1A 3ZDQA 1KYIA 1MKYA 5AVJA 5A5FA 2FCAA 2I6FA 2HHAA 4C2BA 1A9RA 2WSSD 1D2HA 5CVJA 1O96B 1YJCA 1KP2A 1AUPA 2PRKA 4WCDA 4XVQA 3UT5B 2ES4A 1U1EA 3A6DA 3DZGA 5D01A 3V7WA 1YQWA 4URFA 4BN5A 1QUFA 2QENA 4D45A 1C3VA 1EFLA 1NUTA 2PX4A 4PO3X 1KY5A 5E0KB 3SG0A 5BR4A 4LF7B 4ZZ3A 3UHAA 5MN6A 2HLDA 4F46A 2YFQA 2W6PA 1DCMA 5J43A 4RKQA 1TD1A 4PINA 5HZKA 2I1LA 1LU9A 3B6IA 3A1FA 5DB4A 3UAGA 2HXYA 4OXKA 2F55A 3I1JA 4GP9A 5H8WA 3DEYX 3R7SA 2JAPA 3LUHA 4TM8A 3E8XA 3KJQA 5K8UA 3B60A 3VNBA 4BKRA 4EL0A 4ABTA 4W6ZA 1FTYA 1WQ1R 2R7AA 4BVEA 3BMXA 4RVOA 2PK3A 2QE7A 3BN3A 2PA3A 3SSMA 4DBLC 1DDIA 3KWJA 4UM7A 3PQFA 3A7EA 4G4JA 3QXHA 5DYTA 4BYMA 2UVQA 3H0KA 2Z2IA 3CTMA 3D0KA 3ZNNA 5L4SA 3ASUA 4HUQA 4P4SA 3GQBA 3NAGA 4MW2A 3FRIA 3HFRA 2QXUA 4P92A 1NKSA 1Y1LA 3A10A 3FZQA 3TUZC 1VKJA 1G66A 3IXLA 3RBVA 4EB8A 2JC3A 2VSFA 3FZYA 4L4ZA 2Q62A 3ICEA 2IHJA 2QK4A 4RGYA 2ZYGA 4TL7A 5AH0A 1XHEA 4E5PA 4A03A 4WNYA 3LY9A 4F9FA 1TIBA 3DONA 4OXIA 5HCIA 2IRWA 3UMCA 5HKKA 4G8CA 5GP1A 3PGVA 4N03A 5B57C 2C7BA 3RYFB 4BV2A 2MYTA 4JJ6A 4F2PA 3O8LA 4KNYA 1HEUA 1UQUA 2P4HX 3IEUA 4BVHA 3J80A 1P61B 3FDXA 4HEQA 1AKTA 1XAHA 1U2GA 1GD1O 4JNKA 1QF6A 1JH8A 1WU8A 2PXAA 2Q8QA 4DR2B 2VK1A 3VTZA 1AS3A 1EVKA 2Q5HA 3EGIA 3B78A 3GGJA 1K8XB 1A5AB 2FFJA 2QN7A 3ZE2B 4TLDA 3ZX4A 5I48A 3C8UA 3MD9A 1S2LA 3TOSA 1GTSA 3PTAA 1PGPA 4GPZA 5AW5A 5BSWA 2ZJ8A 1PKXA 1RI3A 2GJKA 2JHFA 4X84A 4GYKA 4C6TA 5L4LA 3PRKE 5FNVA 2RSLA 3TKLA 3FDFA 3TQFA 1LH0A 2B61A 4AWAA 4G9EA 4LY9A 5JSZB 2HWKA 2QN8A 3I58A 2VJQA 1N57A 5IRCD 3IA2A 1VE1A 4JDUA 4KIUA 3SR4A 1OV4A 9ABPA 1XKLA 1KEUA 2GMWA 4EG3A 4WXRA 2VJLA 3L18A 3TMKA 3IOYA 3WIUA 4TKVA 2COKA 3SF0A 1SU6A 5JCXA 4LF5B 3BSSA 4B81A 2BI7A 1TW2A 2NUTA 3UGJA 2JAOA 4RV5A 1QO9A 3SYLA 1OE0A 2XUFA 1V1RB 4PQRA 3ICVA 4GRIA 2IEGA 1O94C 3GFPA 2X6RA 2R8ZA 2NU8B 1GQYA 3H6KA 3IJ5A 4DGSA 3RSOA 4YJGB 4LECA 2X8JB 2WILA 1YL7A 1ZW1A 4BNTA 4P2GA 1NDUA 1E9BA 2GYYA 3OQJA 1AQIA 2ZUSA 4YJFA 1PWXA 1NNI1 2XYGA 4CTMA 1LBSA 1NE7A 1UFRA 2H7XA 2C5LA 5K4AA 3C39A 3IPXA 3K6KA 4FGWA 1Y6JA 3AP1A 3VKVA 5FORA 4KACA 2IS2A 2OBNA 1RPNA 1XRSB 3G59A 4CM3A 5B3KA 3DKRA 4ZOLB 3KB8A 4Z2YA 5CNMA 1C7EA 1ZCZA 1KEEB 3O5AA 4EG7A 1DKNA 3MT8A 3M81A 3TAXA 4BMDA 3U62A 5JEDA 2GCOB 5L3SA 3OPVA 3T3NA 2AJDA 1ATZA 3OMLA 3AFMA 3DOOA 1U1DA 5F1PA 1XXHA 4ZEWA 3O26A 3V4VB 4QXPA 4AJOA 4KB5A 2C4NA 2YWBA 4OBWA 1XWFA 4UARA 3RSFA 3QEMA 4JU9A 1HBJA 1RCTE 3O1LA 4E30A 3DHEA 7MDHA 1ZUNA 2QD1A 2OLKA 3PICA 8ADHA 4WGGA 1DAOA 4KAAA 5D87A 5FWYA 5LMZA 2DUUA 1ZOOA 4BVGA 5JASA 3KL4A 3TRIA 3BILA 3IILA 2LTAA 1M2EA 3HU2A 3IP5A 2H2WA 2GN6A 2XECA 3HJAA 3RC9A 2GSDA 1Q21A 1YQDA 1NMZA 3A6GA 3EGVA 3ZY6A 2B34A 4FQ8A 4X7RA 1IIBA 4Z8YA 4CQMD 4CU5A 4EZIA 5EKDA 2GCPA 4RVNA 3NP9A 5REQB 1FMFA 4ZC8A 1ZOSA 3QPBA 3RSZA 4TMZA 3RDPA 1J00A 3OP4A 3CUUA 3BXEA 1QYCA 4KE9A 4HX5A 2NP7A 1UJNA 4LBVA 1HPLA 3D1VA 3MELA 3IDFA 4RIEA 4IIUA 4K88A 4FB4A 4KREA 3DV0A 4C30A 5EJ9A 2XHZA 3HXTA 1G8SA 2GD1O 2OCGA 3C3MA 3GOHA 4LGCA 2DQ4A 5ALMA 4ITVA 1LSUA 4Q3AA 1E5DA 3WLRA 1JFSA 2OCDA 2VUTA 2WMYA 3HFSA 1OVGA 1T0PA 3D2BA 3REOA 4OQ4A 2ZSBA 3X44A 3UJAA 3M6IA 2AV6A 3VO2A 1GN9A 2JPDA 2O0HA 5DO9A 2JKVA 3URKA 1MO6A 4XWWA 1LKZA 4RA9A 3EH2A 5HBGA 3ROFA 1AM4D 4QLBA 3FLBA 3BA6A 2ZE8A 3HPQA 4EY6A 1TO2E 3KAKA 3LGXA 3SVTA 1OH8A 4LISA 3S29A 1YB4A 5A5GA 4LDZA 2ESRA 3O9VA 2RGCA 3V4ZA 4DZZA 5A4MS 2O6HA 2GUGA 1J33A 3NW9A 2ZBVA 3CRMA 3LYUA 2YZMA 4ZHQF 3I12A 4KQFA 1YMQA 1HT1E 1H42A 4LA4A 3VTKA 5JAUA 1TKAA 2WW8A 2EZ9A 2P6NA 1KVUA 4KR7A 3LLUA 3DMTA 1CJKC 2EU8A 4BP1A 3KU1A 4Q48A 3MAGA 4G2NA 4AMGA 1JI0A 2C5EA 1RLMA 2W9XA 4UEOA 1JIVA 4O63O 4C0BA 4LOIA 2L0XA 2ZJAA 2X5NA 5HZHA 1A8HA 2C0CA 4D3FA 2FVXA 3G9TA 4YV1A 1L3IA 1OFGA 4MVJH 3T35A 1CBUA 5G0UA 1Y7LA 3F3YA 3GMSA 3O2SB 4J16C 5F3RA 1HI9A 3M3HA 2NUPA 4IO0A 1TAQA 5LM3A 4HNHA 1Q0ZA 4LHZA 5JTTA 5F5XA 3KR0A 3ZYZA 1V3VA 2BVNA 3FLEA 3GUVA 5EI5A 3U4HA 1Y1QA 2R8OA 3AI3A 3H84A 4MWEA 2X77A 4WJLA 1JQDA 3DWIA 5WRFA 1JW9B 5AOCA 5E7MA 4XIYA 3AL2A 4R2WA 3CBGA 4ENSA 3LKVA 4D02A 3SEQA 2Y8EA 4QYIA 2A57A 3MJ4A 4J29A 3DQZA 1S2MA 3QXCA 4D9EA 5LWQA 2H2FA 2OCYC 3HP7A 5L6LB 1FIUA 3N8NA 2EX0A 4E14A 4MB0A 3C8DA 1IOLA 1XLVA 4D9NA 2GBGA 1LRJA 1EVIA 3DOUA 1V8BA 1X1SA 2J5QA 2BHRA 2D2FA 2YH2A 2DWQA 3SQMA 1WZUA 3C7TA 4J2HA 4LFBB 3NIBA 2Q5JA 3BRWD 1E2PA 2AN5A 3MGBA 1SKQA 2JLRA 1R37A 2G8LA 2CMGA 3WIVA 3RV3A 3ANMA 5JECA 4EG1A 1CB7A 1DQRA 2J1LA 2I3GA 2PUDA 3NXSA 3PIIA 3WKBA 2Q2QA 5FJJA 2E5WA 1XYYA 4R2MA 3CMMA 3K8YA 1E2GA 1WKCA 4LZOA 1NN1A 1TF7A 4V03A 3ZPXA 1L0BA 2EGHA 3X1WA 4MINA 1ZK4A 3OKAA 1Z2CA 4KUGA 5IT9A 2QTNA 1TMOA 3H9BA 3BJEA 4DQ0A 4TT3D 2C2XA 2HPZA 1IEXA 2V5VA 3VJLA 1CUGA 4DLNA 1IAVA 2HV8A 5HG0A 1FP6A 1Q19A 3OH8A 4MIKA 4OLHA 2D3WA 3PNOA 1B7GO 5J2TF 5BT9A 5DI9A 3W3AD 1ONPA 2COUA 2M1ZA 3CNQS 3FTQA 3S40A 4EJ2A 5KTSA 1QLHA 3A4TA 1G21A 2PZLA 2CK3D 2ZB4A 3FPAA 3G6KA 1FX0A 1J1ZA 3I6IA 1IIRA 1XCPA 3BAZA 2J9XB 1RXIA 2HI0A 1HDIA 4WK6A 5CB6A 3S55A 5HKOA 1BHJA 1XAIA 2X8JA 3ITKA 2BLNA 1WBDA 1MHTA 1XDGA 2CVZA 1OLUA 4BFYA 1WB5A 4IH1A 2ZZNA 1QYXA 2Z5GA 4F38A 1DSSG 1IJFA 5KSYA 4OSPA 1JHDA 1HV8A 4EYOA 2Q6LA 2OT3B 3H5NA 4OQPA 1VM6A 4BRWA 4HAIA 5HMLA 1TZMA 3WIBA 3DZCA 2ZIXB 3UFXB 1ZIDA 3WYDA 1TA9A 4ZAFA 4O5AA 5KC9A 5HUJA 1THZA 1NVAA 2IUYA 1EFTA 1ZBQA 3Q11A 4IZOA 4Q37A 2FLVA 1TF2A 2GEJA 5JROA 4DUYB 3KFVA 4L4RA 4UUPA 3PR3A 4ZQFA 4NARA 2B0JA 3DMGA 2BGWA 1NDQA 3UICA 2NU7A 4OHVA 1Q3KA 3NFRA 3A6JA 3VH3A 3GLTA 3MA0A 1DE0A 1SOVA 2QRVB 3JATB 2P6PA 3D4BA 5E3IA 4WKGA 1KHHA 1W73A 2J9FA 1ZKMA 2WHXA 1BDIA 4FT2A 5G3YA 5F52A 3IQFA 1DAEA 2FSUA 5T6BA 3PENA 2HRCA 5ALNA 5C8YF 1HKHA 2JAUA 4JQYA 4CF7A 2TMKA 1NW3A 2DWUA 1I3KA 1EK0A 1UBJS 1JDTA 4J03A 3U39A 1UJMA 4AJLA 4BQQA 5T8KA 5J1SB 3D3WA 3Q3IA 1GN8A 1W36D 4QDJA 5IUKC 1SC6A 2VK4A 3LP5A 4WK0B 1EFVB 3LC2O 4KJXA 3NI2A 4P32A 5A4FS 2VHWA 5K8TA 3ORHA 3Q8LA 4FFBB 4CXMA 4QOGA 5C8YB 4DSNA 1I2ZA 1P5JA 2ISSD 3L1UA 1OT5A 1KMMA 2DGDA 1YMVA 1AKRA 1J4AA 2XX3A 1SOMA 1UFOA 1XZFA 4K05A 3I04A 4OSEA 5KVCA 3K70B 1CR1A 4FEEA 5KDLA 3NC1C 3VU9B 5FKJA 2XKBA 3HLTA 1N36B 3PFBA 5C1OA 4KNWA 1H2HA 3AHJA 2IC5A 3G2IA 3O8OA 1PJ4A 3DPIA 3TTXA 5SYAA 3GLIB 2H65A 5HRCA 5HK9A 3DBVO 3JPYA 3K9BA 4K6GA 3A37A 5C4MA 1PQPA 3B3GA 4YRZA 2NMVA 4GGOA 3S70A 4FNMA 3V1UA 1A8UA 4M98A 4LGYA 2QIPA 2C29D 1DLJA 5KAMA 1RVDA 4UM9B 5C81A 4Y2HA 4LOAA 3HN2A 1KI9A 1OGJA 2X86A 3I34X 4RXTA 1NI3A 3KHSA 4ZFNA 2C97A 4P33A 3VPHA 2FX5A 3L84A 2XKAA 3AUSA 3NVAA 4GUDA 4INJA 1XJ5A 3OO0A 4KX3A 3DG9A 1YZ3A 4FKZA 2CWWA 3TM5A 3QE9Y 1PZFA 4RCZA 4L7VA 1QFYA 5BYJA 1U9IC 3K0CA 4K9NA 2GX6A 1X74A 2BFAA 2HRDA 4Q34A 3PE3A 1MAVA 4CM4B 3STXA 5G53C 1FPMA 1ZM4A 4RZ2A 5L6MB 1R6UA 4F4JA 1TI7A 5I4IA 2ZIGA 4IY1A 1KAEA 1HYHA 4JB0A 2BE9A 2PX0A 4P3NA 2RHRA 4N5DA 4F7DA 1N5OX 1X1TA 5IULC 1NI4B 3PQ7A 5EVJA 4L6AA 2P69A 2WJIA 4BMVA 2A5YB 3GQVA 1FUUA 2C9ZA 3CLRC 3OJLA 5CT6A 2P7HA 1LJLA 2O9JA 4AN4A 3O4GA 1AO3A 2ODWA 2NNWB 1X9IA 3MF4A 4XVHA 5B5SA 3LT0A 3TG2A 1NX6A 1D1TA 2ZUDA 1KDRA 1K1EA 2AFIA 2Q3DA 3IESA 4MRAA 3EMBA 1VG9B 2W2OA 4MHSA 1M8KA 3COVA 4HEA6 4QVKA 1NWHA 2ZI4A 3AUKA 3R2JA 3KUXA 3DVAB 1S3IA 2HT6A 1FC0A 2I03A 2XNSA 4RY8A 3TJMA 5KYYA 4RK1A 3ZXIA 3BMCB 4KYVA 3E48A 5JNSA 4GUAA 4TN1A 3KVYA 4BP8A 3DDSA 3TFQA 1P2UA 2FUEA 2PX5A 4DLTA 4Y2JA 4YYEA 1ATIA 2DSNA 2XMBA 3LQQA 3FPLA 2YX1A 2M6RA 4POOA 1PQWA 1ANKA 1F6WA 5IM4F 4D98A 1QGYA 1DEOA 1Y9ZA 1L4FA 2C9DA 2IY8A 2W2XA 5K0SA 5KYYB 4P0PB 1J09A 2PR2A 4ZVPA 2ABWA 1NYLA 1T9DA 2W2KA 3EGCA 4FSXA 4ISBA 4WLEA 3W2FA 1HE8B 1TLFA 1H8HD 1L7EA 4XGKA 1EK2A 4MMZB 4B45A 4X8HA 1UKAA 3DL4A 3KOYA 1TZBA 1YFZA 5CW1A 2CXSA 5AI8A 1XMPA 3SHVA 2NYRA 4J3NA 3TZLA 2P79A 4GM1A 1K7EB 3BGSA 1VGVA 1B0ZA 3CR3C 3HLKA 2KM1A 2ID9A 4A15A 3EIEA 4F91B 4GI5A 2DLCX 1YCGA 2FR0A 2Q41A 2Y68A 3RGWS 4QTTB 4DWVA 1JHOA 4QBTA 4NCHA 4BMZA 1VPDA 1KTVA 2R8PA 3LS2A 3CLTD 3DOEA 4LHVA 3TL3A 4N40A 4O59O 4UHBA 2O59A 3KWLA 2PH1A 5TT0A 3Q3HA 3WZMA 2WUWE 4A0SA 1JKIA 2HF7A 1FS6A 2WWXA 1S8FA 2VDKB 3NT4A 4MWBA 1WCWA 2C5HA 1BCRA 1Z5UA 3OLQA 2BRUC 2RI1A 1K5GA 2WPDD 3GT7A 4H0NA 5B6IA 2HHHB 1SOWA 4I8IA 4J75A 3IKLA 2PV0A 3MLAA 3L40A 1PQUA 1FSFA 2DH5A 2YBDA 4HRAA 1JLRA 1LRLA 3IQDB 4IJ5A 4LZNA 2XGOA 5I7UA 1WWKA 2ZBRA 4YMLA 1Q16A 4KQWA 4MR7B 3UG6A 1V5IA 4QYIB 4F2WA 2AOTA 1J8FA 1W93A 1EXVA 4DJAA 1E79A 2PKYX 1B93A 2Y9PB 2P9FA 5ITVA 2BV3A 1PWEA 2PWYA 1L8XA 4P80A 4Y2RA 2FWAA 1KI4A 2NU7B 3WC4A 4LVUA 4EHJA 5AUOB 1X8LA 4R68A 5AKEA 1EFDN 4I1OA 3A1SA 1ZGGA 3ZCPA 4ENQA 3EPKA 1WA5A 3H8SA 5C0OE 4NBVA 4HK4A 1I3OA 3C4QA 2YICA 1CT9A 3FF4A 3JVEA 8OHMA 3EMVA 2I1QA 2REQA 3IVGA 4G0WA 4DKJA 2EARA 1P73A 1M73E 5JSZA 2BR3A 3DXYA 2XIJA 3IR6A 3UHFA 4GO1A 4TWZA 2IY7A 3UHJA 2RKWA 2OV6A 3TNLA 3H05A 1C7ZA 2WNIA 2ZVDA 3CYFA 1YMUA 2QV0A 2GAIA 4XIFA 2MHCA 4H77A 4ZOLF 1FLDA 1GHTA 2Y1EA 3MYYA 4CDNA 1QRSA 4XSVA 5EZSA 3HCOA 3M7IA 3RSHA 5IG2A 1C30B 1X7HA 2AW3A 2IEBA 2WP0A 2WSIA 1E60A 3GO4A 4DA8A 1XALA 4EY4A 2QTFA 3VPCA 3PXDA 5LZ8A 1JDSA 3KYCB 5K0BA 1DEAA 3S81A 5JBIA 4YCLA 4C0JA 2AJCA 4QA9A 3FWYA 1VOTA 1YB2A 3ZH9B 1MO4A 2E4ZA 3BE8A 5JEEA 2G0TA 2PMCA 3UENA 1QNLA 5AW8A 1JNXX 4NCAA 4KPYA 1R0YA 2CYBA 1HDOA 3RW9A 4U5XA 3X1DA 3PFWO 4IINA 1CRPA 3INNA 2KB0A 1RKBA 4D74A 3FFTA 3Q4GA 2Q99A 3PLRA 4RVGA 5IJWA 3V33A 1YZYA 1PFVA 1YS7A 3LMKA 4L3WA 2HWYA 3CEAA 4P81A 4MQMA 2XA2A 2PSHA 1E4YA 3EXFA 4DQVA 1Z9BA 4GI1A 5DNYB 2WWFA 2Q0SA 4YMSA 5AXCA 3G9ZA 1NKTA 4H3VA 1UWVA 2WMOB 3M1AA 3RT1A 4DJ5X 5EIOA 5JS2A 2BH9A 2B69A 4QJIA 3JD2A 2Z9CA 4IX9A 4O6VA 1Z73A 4R1NA 5HJ2A 3RS7A 3T6KA 1R8QA 4X6XA 2H1WA 4OK3A 5CCEA 3WGNA 2ZTHA 4C4ZA 3IOBA 1XLTA 3OCCA 4INPA 3GV0A 5K3BA 3AJRA 4FFPA 2C3UA 1VMDA 4LHEA 5ERYA 1C29B 4B9AA 4E5NA 5HRUA 3K5PA 3TGPA 3DDOA 5ICGA 3AF3A 1R88A 1NLYA 2OBYA 1F9EA 4KI0A 3E2IA 1SXJD 2O07A 4GX1A 3R76A 1P5ZB 1X80A 5BR1A 3HVKA 3IQXA 5FWXA 5GJWC 4BO7A 1CIVA 2V1UA 3DUFB 3IIIA 5M3BA 4RH0A 2XGGA 3AKEA 4IWNA 1JFLA 3NANA 4TVSA 4CM9D 1FYVA 3GB9A 1ZUNB 1KI6B 1YFKA 4IGIA 4KOAA 5DNAA 3DZKA 4MV8A 1IOVA 5LUBA 4UM5A 1VA4A 1BD3A 2V6JA 3DHWC 4UDYX 4YRJA 1QAMA 1LS1A 1T5TA 2RHLA 2BEVA 2C95A 4C43A 4NZNA 3QLUC 3S2ZA 4P7FA 1RI4A 4WY8A 2FGJA 4ZO9A 3RQSA 1FK8A 1N8SA 5H4HA 1D7OA 1ZJZA 4BY9E 2OHGA 3MWEA 1DEHA 2VJKA 2FN9A 2NQ2C 3L2OB 3I5MA 3V2UA 5HFNA 2FA9A 3H5WA 1BFDA 3P9PA 1F48A 4Q3DA 4DIMA 3OZDA 4QAQA 3SDSA 5U4QA 1L5LA 5EJEA 1YK0A 4ZDIA 5I3ZA 1G4UR 1HFWA 1TUGA 1GKYA 3F74A 2VL7A 2YTZA 1XRQA 3H2SA 2Y1LA 1U1CA 1N2JA 4TRMA 3DHYA 1XZNA 3F9RA 4MPJA 4RD4A 4WZBA 4DM3A 4QELA 4BWFB 1JG2A 5FBWB 4LF4B 3CPSA 1OI3A 4FFVA 4FZ3A 1LTHR 2R68A 4P7GA 3K35A 5JYEA 4DMGA 2Q2NA 4H18A 4YMTA 3IBGA 2FFHA 4ZJUA 3U4MA 1TF5A 3FUWA 5IU6A 2POQX 2IDKA 2QMHA 3GAFA 4IQ0A 1OB5A 3OLXA 3D3JA 2YDXA 3ONWA 5ALGA 3D0RA 1GTRA 1NHWA 1SRQA 4P0TA 4I14A 4WNIA 1U7DA 1Z4OA 3QM1A 3JQ9A 2LDBA 4KLRA 4PYKA 3C43A 2PE5A 2ZRMA 4N82A 2AFHA 2LKDA 3ENQA 3LT4A 4GE0A 4RD0A 3ZJ4A 2ZTUA 2VF4X 3E22B 3OQHA 2OB1A 1RZRA 1M1XB 3K20A 1R6AA 3L7LA 1E3MA 4LYDA 1XMVA 1CP3A 2QQGA 1I7QB 4YO7A 3KRTA 5B53A 1X6VA 4HX9A 3W3ZB 3QKSA 3EDYA 5CA1A 1RWOA 2J41A 4UEQA 1U3TA 2QVLA 3KQQA 1LK5A 1BS9A 2Z2JA 5TB5A 3GK3A 2GZAA 3WLIA 5AW0A 4RTKA 1A1VA 4KKVA 2YWJA 3T0IA 3WKAA 4LX0A 2QAGA 4MVJF 3RVMA 1ZM9A 2HPHA 4CNQA 2D2IA 2J5XA 5L3ZA 3WLTA 2PUAA 5KQSA 2OCXA 1PG2A 3KB2A 1SKBA 4D1YA 2BMAA 3H4VA 1F8YA 3ZWPA 3FVRA 4PHCA 2CJYA 3DDWA 3PV0A 3BTUA 4OFZA 2R3SA 4RM3A 1E3IA 4U6QA 1GA1A 4LQDA 3X2FA 4B5KA 5TQ0B 5C52B 2Y2VA 4PICA 1P3DA 2QDKA 2F64A 4A2PA 2WUFA 4FU0A 1XU7A 4FSHA 3EBPA 1C9JA 1I10A 4FZJA 1VDMA 4GZ5A 4EZEA 1CZLA 2G06A 1LTQA 3DFZA 4HX2A 5ALZA 2JH9A 5BW4A 5EWJB 1DCFA 3T3PB 4JUAA 2NT4A 3AFHA 2P62A 3PUIA 1A9OA 3BCUA 3DTVB 3EISA 1FSPA 4ZCMA 4JYPA 4D25A 3LQKA 3V42A 4QUIA 2RHWA 2XXBA 3OOSA 4YRNA 5EXTA 1EWTA 1QP4A 1EUCA 2Q3HA 5AYVA 1MQAA 4P3OA 5FYQA 3CY6A 1K0FA 4IR7A 2DQKA 4O4IF 3CF0A 4YJ2F 2HU5A 1MPXA 2XSZD 1TCVA 2GLXA 4BWGA 3DLTA 4OHFA 1Q12A 3DCIA 4TMVA 4CEIB 2EKBA 1TK3A 3G13A 4CU2A 3MGCA 4D3ZA 3CEJA 3ZWKA 3QYFA 4TWIA 1ZNXA 1E3QA 2YVQA 4V1CI 3EAQA 4JJGA 4HGYA 1S1MA 3UHOA 3CLSC 4YO8A 3LIIA 3PWZA 2AH5A 4DMHA 3A3OA 1A4XA 1NC1A 2JEZA 1T8TA 3IDQA 4EABA 1XLWA 2YNMA 2LXNA 3HY6A 3I4FA 4TYQA 2PEYA 3EGDA 1QG6A 4P4LA 3V4SA 3PEYA 3I9LA 1KMHA 1N2GA 2YMMA 1V11A 3DVRX 2GD0A 3GFOA 4RFSB 4FEGA 1RC8A 2W93A 3B53X 3H5AA 3R5TA 1E32A 3G0HA 4JYMA 3AVTA 2SCUB 1EDZA 1ZA1A 3RF7A 5LFAA 1MH1A 4G0UA 2ZSFA 4NRDA 1T4GA 1Z08A 4Q9DA 2XMGA 4TMFA 3AR9A 2I6GA 3K0FB 1LPSA 4MGKR 2BEWB 1R1DA 5ALLA 2B9EA 2HZBA 2Q3CA 1C5KA 5GOZA 1HSZA 2O0MA 3NATA 3FTDA 5KSZA 4ARIA 5B2FA 6ABPA 2O8EB 3RJTA 1T36A 1LF0A 2XF2A 1P4JA 2AKEA 2XMZA 1G55A 2ZE7A 3DWGA 4ECEA 3BB1A 1RAIA 5C1IA 1FFYA 4ZXFA 3SICE 3U13A 4D8YA 1DZIA 3ACCA 1CUSA 3RYFA 1Z2EA 2ZTMA 4GG1A 1NKVA 1J2YA 4G0NA 5DM60 3HKDB 4BZZA 3FWKA 2DBVO 1DHRA 5BWLA 1NF2A 1VLLA 4B7CA 1BW9B 1R27A 2UDPA 3A1TA 3C8HA 1JJFA 3OF2A 4CV1A 2A59A 3NORA 2DHEA 2ZRDA 3MWGA 4TYYA 2HA5A 4TWAA 1PIWA 4Q03A 2ZVJA 1L7NA 3AHEA 3EY4A 3EXIB 3HMQA 3IMEA 2HRQA 2GS9A 3PA8A 5CU7A 4I9UA 1PWHA 1YJ5A 4KYTA 3MB8A 1MXFA 1KP3A 4MUIA 3PPYA 4DLKA 3T0GA 4OA5A 4GKAA 5TC4A 2OHXA 5JAHA 5J23A 3QKTA 5IAGA 4J7AA 2JFVA 4NF2A 4A27A 1PNTA 4B2YA 1BRMA 1E6EA 4GLBA 5LIPA 2HF9A 3C3CA 5JBQA 2RGYA 3DBOB 4D6XA 1K0UA 3HS3A 1GLGA 2Q5LA 4HAOA 1YI0A 5GY7A 3AVUA 1YRLA 3F67A 3OCUA 1ORRA 4HQ6A 5AIAA 4HI0E 3HA7A 1K3TA 4FYWA 4I1YA 2ZIUB 1N1GA 4I2NA 4RSHA 1GUFA 3DV2A 3BULA 1KQPA 3K0HA 3LCJA 3ETJA 2ZYIA 1EDBA 3NJ8A 2W6OA 4QPJC 1FTSA 1GL7A 2OECA 3Q7EA 2BEUB 4FYJA 2J85A 1P33A 2B6NA 5K3AA 1XTIA 1V95A 4J4TA 2IYUA 4YT4A 3F2IA 1LNQA 1M6VA 3Q40A 4G65A 3I4LA 4RJKA 4OI1A 5JXWA 2X8WA 5JFOA 4RH3A 2PBLA 4BL5A 4W1QA 2F3QA 2JAQA 5FPYA 3STUA 4I1IA 1UZUA 4NAVA 2AZXA 1WHTA 3GVIA 4RIFA 4BZQA 5ELMA 2Y9MB 5AUPB 5LQAA 3EUFA 1H9AA 1AVTA 3ZGNA 2CDNA 2HSEA 4DQUA 4QEZA 4PSAA 1T9AA 2J5RA 4JC8A 1U8CB 3DNFA 5BRAA 4M46A 4OYRA 2MSCB 7GPBA 4EKNB 4WKCA 3BL5A 2NVUB 2CKMA 3AILA 5IN5A 2ZE5A 1PSDA 3DT8A 1PJ8A 2F8LA 4ZZ1A 4UXIA 4IV8A 2R65A 2DPLA 4KO3S 5D7BA 1OTXA 3DBRB 2QN1A 4KMSA 5FOTA 3T38A 5JD3A 3N2YA 4F60A 3EA4A 3BMQA 5JPDA 2W6ZA 4G5GA 5JISA 4J6FA 1PR3A 3WFZA 3LW8A 2BM1A 3WQHA 2AZMA 3NNSA 2VDWA 4J2OA 1XCGB 2ZPUA 3BERA 3BGVA 5KX5A 1HM5A 2IZZA 1YE5A 4C89A 4KPEC 2Y0DA 1PX2A 2C7GA 2WU0A 3CA8A 1LD3A 4DC1A 1ZU4A 3ZQ6A 3IXQA 1YZGA 2O2ZA 4GOMD 4UQOA 5A4KA 2PQ0A 2EJWA 1MD9A 3NDRA 5E1BA 2BGKA 1N0IA 2CJFA 3UPTA 5DWDA 5EZ6B 1UJ4A 2AN4A 1Y5IA 3UXMA 2V74B 1ESEA 3L1JA 3FYUA 3H2BA 3ZD7A 2IWHA 2SKDA 1E2HA 1MX1A 3SQOA 4GDFA 2FQ1A 1TRKA 1PFWA 4HWRA 1NQUA 2ROQA 4K1LA 4R8LA 1RM5A 4YRPA 1D8TA 5EGNA 2H5IA 4PYJA 3O95A 1V3TA 2B8TA 3WDKA 2ZCVA 2NO4A 2FI1A 2C78A 3JYQA 4N5MA 4HMOA 1WO8A 3GA5A 3O2JA 3OG9A 1RCFA 4G84A 2Y99A 2P41A 2NIPA 3FPEA 5BW6B 1EG7A 3ABZA 2QV7A 1AZWA 3TJZA 3CE9A 1J9EA 1G8FA 4MI6A 1G5RA 4D26A 2E6KA 2GHIA 1LSSA 1XRRA 2CLDX 2E21A 2NTNA 1DIRA 1U2DC 2HJGA 4HVCA 4EL5A 3W1EA 4YV7A 3OOEA 4Q4LA 4GPD1 1E66A 1IWBB 4YGXB 4XJTA 4CL2A 2QN3A 5M2QA 4D4KA 2OPBA 3RC3A 3X2EA 2AG1A 4QATA 1SEVA 5FO1A 3OJXA 3A1VA 1EFKA 3ESDA 3M82A 1XMJA 2PPLA 2VO1A 4WJZA 3ZCSA 3MILA 1JLLB 3A1NA 2QPOA 2WVHA 4DCCA 3TW0A 7REQA 2W7TA 2R5FA 3V8PA 3JVUA 5BV0A 3I92A 3TLXA 2BDTA 4WZZA 2G4VA 3LNCA 1Z6XA 1NBEA 2H08A 4RU1A 3FDZB