1GCIA

The 0.78 angstroms structure of a serine protease-bacillus lentus subtilisin
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
269
structure length
269
Chain Sequence
AQSVPWGISRVQAPAAHNRGLTGSGVKVAVLDTGISTHPDLNIRGGASFVPGEPSTQDGNGHGTHVAGTIAALNNSIGVLGVAPSAELYAVKVLGASGSGSVSSIAQGLEWAGNNGMHVANLSLGSPSPSATLEQAVNSATSRGVLVVAASGNSGAGSISYPARYANAMAVGATDQNNNRASFSQYGAGLDIVAPGVNVQSTYPGSTYASLNGTSMATPHVAGAAALVKQKNPSWSNVQIRNHLKNTATSLGSTNLYGSGLVNAEAATR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SUBTILISIN
publication title The 0.78 A structure of a serine protease: Bacillus lentus subtilisin.
pubmed doi rcsb
source organism Bacillus lentus
molecule tags Serine protease
total genus 100
structure length 269
sequence length 269
ec nomenclature ec 3.4.21.62: Subtilisin.
pdb deposition date 1998-09-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00082 Peptidase_S8 Subtilase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1gciA00
1Y3CE 2WUVA 3H42B 5B1DA 1SIOA 4BWGA 4I0WB 3SQOA 1TO2E 1YJAA 1SIUA 1SCAA 1Y34E 2TECE 1SUCA 2GKOA 4H6WA 2Z2XA 1SUAA 3WIUA 3VV3A 5B1EA 1WMDA 4H6XA 5ARDA 4KPGA 3VV2A 1SBHA 3GCXA 1C9MA 1C9JA 1BH6A 1VSBA 2ID4A 1SCDA 2Z58A 4WOBA 3DVQX 2PWAA 3I30X 2ZRQA 4B5LA 3GT3A 5JXHA 4AKTA 3EE6A 4C3UA 1WMEA 2IY9A 5ARCA 1KDVA 3UNXA 1OYVA 2HD4A 2W2QA 3P5BA 1BE8A 4FONA 5AQEA 1SBIA 3F49S 3Q40A 2IXTA 1AQNA 2PKCA 1SBNE 1S02A 2P4EA 1R6VA 1GT91 5JXIA 1TM5E 4J94A 3I2YX 4M1ZA 5JXJA 1UBNA 3TI9A 5JXGA 5K7SA 1C3LA 4C3VA 3VSBA 2SICE 1Y4AE 2PWBA 3DE6X 1SIBE 4DJ5X 1R64A 1TK2A 3BGOS 4ZARA 2SNIE 5SICE 3VTAA 4YN3A 3DE3X 4DWWA 1XF1A 3WHIA 1SCBA 1PFGA 1BE6A 1Y9ZA 3LXUX 3AJ9A 4K8RB 3CO0S 4OMCA 1T1IA 1TECE 3QFHA 2G4VA 1BFKA 1GCIA 1ZVKA 1IC6A 1SVNA 5FFNA 3D9QX 1A2QA 4CFYA 1AK9A 3BPSA 1TM3E 1SUBA 4NMXB 1ZVJA 1R0RE 2X8JA 1BJRE 5I9SA 4GI3A 1LW6E 1WMFA 3DE0X 1Y3FE 1KDZA 3CNQS 4CFZA 3A3NA 3DE5X 1SUDA 1S2NA 2Z30A 2HPZA 1SH7A 1SCNE 3DE1X 3HJRA 3L1KA 1THMA 3Q5GA 4HX2A 3TECE 4OMDA 3PRKE 3BX1A 5AMXA 1SELA 1Y1KE 2PMWB 2W2PA 4HVLA 1BFUA 1WVMA 3LPCA 3DWEX 2DUJA 4KG7A 1V5IA 5FBZA 1P7WA 1TM7E 1Y33E 5FAXA 1Y4DE 1PTKA 1HT3A 3D43A 4JP8A 1V6CA 4ZOQI 4LVOA 2DQKA 2PQ2A 1AV7A 1GNVA 4MZDA 1AVTA 2V8BA 3VHQA 3QTLA 3AFGA 3DW1X 1SUEA 2SBTA 5ARBA 2ZWOA 3DE4X 1Q5PA 1ST3A 1AH2A 1NLUA 1GTL1 1IAVA 1GA1A 3ZXXA 1NDQA 4NE9A 2W2NA 1MPTA 2X8JB 1JEAA 1NDUA 5AVJA 1DUIA 3WIVA 2WV7A 4NE7A 2ID8A 2Z57A 1EA7A 3F7MA 1Y3DE 1C9NA 5JMOA 1T1EA 3SICE 1MEEA 4OV6B 4CG0A 3DYBA 3DDZX 3GT4A 1PEKE 1PJ8A 4KB5A 1GTG1 2SECE 4LVNA 1OYOA 2W2MA 3WQBA 3DVRX 3OSZA 4Z2AA 1TO1E 1TM4E 3QMPA 1SN7A 1YJBA 2Z2YA 2WWTA 2WUWE 4WOCA 1P7VA 1GA6A 1SBCA 1TMGE 2DP4E 3DE2X 1YU6A 1YJCA 1SCJA 3PTLA 1SUPA 3DVSX 4AKSA 1DBIA 1KDYA 1EGQA 2PRKA 2QTWB 3LPAA 3T41A 1GTJ1 5CW1A 1WSDA 4H6VA 1GNSA 1AF4A 3A3OA 3DE7X 2PYZA 3DW3X 1T1GA 3EIFA 3I34X 1GA4A 1KE1A 4RYDA 1P8JA 2W2OA 2Z2ZA 1KE2A 3TI7A 2B6NA 3AJ8A 3I37X 1Y48E 3EDYA 1OT5A 1AU9A 4DZTA 1ST2A 3LPDA 1CNMA 1Y3BE 1SBTA 1SPBS 2E1PA 3A3PA 1TM1E 2ZWPA 3VYVA 2ST1A 5AVKA 3F7OA 1CSEE 1S01A 3ZXYA 2XRMA 3GCWA 2XTJA 2Z56A
chains in the Genus database with same CATH superfamily
1AQ6A 4N0PA 1KDPA 5H59A 1SIOA 4QNRA 2GLTA 3ABRB 5BQXA 1E2IA 1SOAA 2GEVA 5HHTA 1R88A 5LC1A 1Y34E 2COKA 3A9UA 1EWKA 4YACA 5ECGC 5IH7A 1XTSA 5BYJA 2N47A 4NQRA 4QM7A 1N32B 1QVRA 2RH4A 2VQSA 4ZVRA 5J4YA 4N54A 3K70D 1ISMA 1F9EA 5B12A 1U0SY 2WKQA 4MV1A 2R7MA 4KBFA 4B45A 1H6AA 1PS0A 3B2NA 4R7TA 3A1TA 4ACAA 4EZEA 4JL6A 1JFTA 4PF1A 3HCAA 1YZFA 4HB3A 3N2LA 4R3UC 3A6GA 4EWLA 4LXIA 1DQYA 1CBUA 4HFNA 4I9GA 1Q7BA 1J25A 1QV6A 2DQSA 2Q27A 1AHNA 1W5BA 5JZOA 2I2BA 3LF1A 4LA4A 3N07A 3TI9A 2O7NA 1TZMA 5FUQA 2G06A 4P0TA 2HO5A 1HYQA 1TC1A 1FLAA 4IIJA 4F56A 2G1PA 2CUNA 3RC3A 1V26A 3TQRA 1MENA 2DE0X 2P9ZA 2FOXA 2FUKA 1J7KA 4COKA 1SXJA 2KBEA 2WU0A 1ZBQA 3AVOA 3X2EA 2UYQA 5KNDA 2BZSA 1JAHA 5D6OA 2DCUA 1DFGA 2QQ5A 4X0EA 4CFZA 3AJDA 2ATVA 5KKNB 4ISCA 4F11A 3HP4A 4JR0A 4ZT4A 5K3BA 3DCYA 4WL0A 1E20A 3KE9A 4JP5A 4HVAA 4IW3B 3KXPA 3NHYA 1QVAA 1W93A 4MH0R 4YJGA 5DT2A 5EGNA 3CLTC 2ODAA 1JJIA 3OZUA 2WZDA 3T7SA 4E94A 1KO4A 2A3RA 3KWMA 3V1KA 1P4JA 2VRWA 1NZDA 1N5MA 2MIIA 3STXA 4D6PA 5KUTA 4BKMA 1M75A 1QFSA 3KEOA 3LC2O 1TC2A 3CE9A 5DJ5A 5EQJB 2HRCA 1JX6A 3IB3A 2J9XB 3TJZA 1ZK0A 1Q6ZA 2EIXA 4F04A 1Z4JA 3IB6A 4EB6A 2H1HA 2ID8A 1U1CA 1XT6A 1UBJS 2IA5A 2Q6LA 5DWQA 4XQCA 3SC4A 4GIBA 3HACA 2GDJA 4KB5A 6AT1A 1ZN8A 2LCIA 5C4GB 3GJTA 3ROXA 4OQDA 1K6MA 4KR9A 3A4TA 3GELA 3WADA 5K99A 4G4SP 1SN7A 3PX2A 3COYA 1TNDA 4JJAA 2O19A 1W2GA 1G66A 2AJCA 4JUDX 5BRAA 3F4BA 4K28A 3C8ZA 4AZTA 2WFMA 2NZVG 3IUBA 1JDUA 3DAYA 3PEUA 3L8YA 4JOCA 1BQ3A 1D6JA 2D2VA 2BGMA 3IX7A 4IUDS 4LDNA 3RJZA 3T94A 3TQOA 3S5UA 1NURA 1WVGA 2C77A 4ZQIA 2R8OA 3Q85A 1N6KA 1DDIA 3SI7A 3VDRA 2H4JA 2EXXA 1NM5C 1SC6A 3A06A 4P31A 2GJAA 3U37A 3UW3A 4B6JA 2IZ5A 4NDAA 2GTPA 4DE5A 2P11A 4YEDA 3KQVA 2ZTVA 2ST1A 2IOQA 5BSGA 4E7OA 1WQ3A 4LUCA 2ZW9A 3UKJA 1WJGA 4PX5A 3ZZ1A 5LM3A 2J6BA 4LRSB 4NK4A 3KB1A 2W4MA 4N3NA 1ULSA 4WK6A 3PGJA 2YVQA 1SHZA 4G01B 2I1QA 3D0RA 4NOMA 3TQTA 1RZRA 4HJXA 4UKDA 3CLTD 3ZQUA 4ZAWA 2QK4A 2Z04A 2ZPUA 2FP4A 3FTQA 2ZZKA 4CUZA 3U4MA 1KEEA 4EFDA 3PGKA 4ARCA 1V1RA 1RTTA 1UBFA 3KCNA 2ZJ1A 4B3TB 1G8HA 1NUQA 4UBMA 4EF6A 4I50A 1AXEA 2PBLA 1XMXA 1E1YA 3WZMA 4C5AA 2QR5A 1WKBA 2HF8A 2OZLA 3LUBA 3PQ3A 2A78A 4LGMA 1R8SA 1OE0A 1U11A 3HCPA 4NABA 3QKRB 5CPBA 3WB9A 1MT3A 3PUZA 1L5RA 3USCS 2JGJA 2ZE5A 1D2MA 1EJ6A 3FNFA 4IH4A 1RRKA 1I7SB 2G0AA 3H8WA 4PTZA 2JFVA 4YO8A 2B4KA 2VDLB 2VN8A 3QPBA 1A98A 1N7GA 2P0YA 3M1YA 4UMEA 3NORA 4ZO9A 2RGCA 4GM0A 4TV8F 3JRWA 3TRHA 2ACWA 2G76A 4JKIA 5BNWA 3D7SA 1Q1AA 1UDWA 5TGTA 3DG9A 1BW9B 1R0RE 1Q0QA 1SHLA 2QSJA 2CJFA 4TVSA 5DIZA 5K5EA 4LRQA 1P61B 2RJNA 4UE6A 4MB2A 1ZQ1A 3N7TA 4NDNE 3BD6A 3FJ1A 3UJDA 2FMFA 3HY6A 5GADl 1XMIA 2WW8A 4FMPA 1U8YA 3QYFA 3B9PA 3QOFA 1ZJ6A 3GJSA 5C18A 4BMDA 4IG9A 5A4IS 1OZHA 4MJ7A 1E0JA 3HSYA 1FDOA 3HA5A 5J43A 4JP8A 3VYWA 5DBEX 1R2QA 2BUBA 2CB0A 1WWKA 2IE8A 5EKUA 4B74A 3U5ZB 3ZHQA 1GQ2A 3EIUA 3TGPA 1DGQA 3E03A 1DRJA 3OCVA 2R2AA 3TDMA 4EMSA 4KSCA 1AH2A 4FDLA 3I73A 4KDRA 8ABPA 1NVUQ 2NADA 1DC5A 1NDQA 1TQ6A 1VJGA 1G20B 4GC5A 4ZOLF 2H7YA 5DTMA 3CUSA 1N4DA 1XOIA 3VSDA 4QOFA 4M1EA 3ZBQA 4YCSA 4QATA 1NW8A 4GQIA 2HUNA 4CF5A 4JEHA 2TMYA 2IX3A 2NZ8A 2VPWA 1FRQA 4LJ7A 3PHJA 4ZU6X 3QEBZ 3DKVA 4MEAA 4HY3A 2V7BA 4E22A 3PDIB 4RIIA 1NMEA 1EWRA 2LXNA 3KQSA 3GRVA 3DVRX 1G9SA 3WBKA 4EO7A 4NMHA 5KC8A 3T7EA 1JIQA 3MLBA 3JR7A 3FCCA 4K88A 4N0EA 3QBJA 4MUFA 4WHMA 3K2QA 1EVYA 5IBPA 4MAFA 4L3VA 3T4EA 1EGMB 4WSOA 3WLAA 1MF7A 3RJMA 4Q00A 2IHVA 2PYIA 3L07A 1BKDR 1P8JA 1Q0HA 4RYDA 3EW7A 1ZXXA 5JW6A 2H2IA 3I37X 1VKJA 3L8ZA 4Q4HB 2B21A 2ZEJA 4F2DA 1COWA 5FHRA 1FRVA 3WNBA 3B5IA 3P2MA 4QASA 1CQIB 1ZIDA 2J7KA 1I2AA 4FLEA 4OHPA 5LWQA 3FYCA 4WA8A 3LZ6A 4FI3F 1Q0TA 3RRXA 3SX4A 4QGAA 1CHNA 5HRCA 1TO2E 3TPFA 5FLYA 5C35A 6YASA 4YASA 4DQKA 9MHTA 1NKTA 3U09A 1EUYA 2W9XA 3K8YA 3K32A 3WNVA 5C1PA 3CZPA 2UZ0A 5TX7A 1HYHA 4YHHB 1A4RA 1BROA 1L7NA 1UJMA 2H5EA 3KUUA 5AOBA 2RAVA 3T3IA 4MA5A 3FPEA 2IT1A 3R7AA 1RFGE 1YNOA 2E49A 2PEZA 1BYIA 1RAHA 1N1EA 2ZRQA 5KNDH 2YMQA 3K4QA 3GAMA 2HA4A 1HEYA 1PS9A 3IP5A 4BMOB 1DJLA 4JHXA 1XDSA 3HN2A 2LV8A 1RS0A 3KPJA 5EJEA 4PO1A 2F8TA 1H3NA 2NU8A 3OIFA 1OWMA 3KUKA 1CP2A 1YV9A 3N3AC 4GKJB 2HXGA 2WYOA 3QXJA 1L4KA 4DR2B 3Q1LA 3AK4A 3D3EA 3PYMA 4XPZA 1QYWA 1OKKD 5K6RA 3SC6A 3WHIA 3CH5A 3ZW7A 2OM2A 2WSMA 1SY7A 3A1UA 3PV0A 2D4AA 4X24A 2QORA 4Y67A 4ZI7F 4M89A 3BXGA 4DDMA 3PQ6A 1QO0D 1F8YA 3L7DA 2HX1A 1C5KA 5HF9A 1J22A 4MA0A 3VVBA 1H66A 2GSWA 3KXDA 2PK3A 3VU9A 4EGQA 4R1QA 3QFSA 2XXAB 1MP0A 1QB8A 2CLIB 4TWZA 1U80A 5HM8A 4AZSA 4BS9A 5CFLA 1NF2A 2AKYA 2V6FA 1Z26A 4MW5A 2QD2A 1ZSYA 3N6XA 4LYGA 1RMTA 1YL6A 3C43A 4UNPA 5IK2A 4C4TA 5L6MB 1JBKA 2Z3WA 2FCRA 3AHJA 4NH4A 1YC5A 3R0JA 4LEIA 1PR9A 3NHSA 4RHUA 3MJFA 1EFTA 2ZRAA 4PXSA 5NLLA 4H7PA 1P77A 1XTIA 1QIDA 3JQGB 4NCJA 4UVDA 3BSSA 5IRCD 5CCBA 1A5BB 5BY2A 4MV6A 1WPXA 4D4MA 2J31A 5ALQA 3T7AA 4X20A 4OB7A 4HDNA 5GONA 2CCGA 3PS9A 4QTZA 3UKDA 4BUCA 3EAFA 4JR2A 3Q3HA 4OF4A 4I08A 4YAGA 4FMCF 4BC1A 3B3GA 2CZGA 3AIMA 3BTOA 1PZXA 5LPNA 2ZUFA 4MS4A 2HMAA 5B3AA 4D45A 1RHJA 4R9RA 4R31A 1AK1A 2H57A 4GKAA 5B4VA 2CDBA 3VZCA 2AC2A 3DLTA 4LHEA 4YP9A 2C9YA 1CU1A 2V4MA 5BW6B 5DHUA 4TZ0A 1JKJA 1UXJA 1E1DA 2O3JA 4QUJA 1E6UA 2N3ZA 3PQ4A 3W2EA 4Q7EA 1I6WA 1U1EA 2I6XA 3GEBA 5ED4A 2PYZA 3CBQA 3F9IA 2DJ5A 2R44A 2NTYC 1NE2A 3DYIA 4L9RA 4BJ5A 3RU2A 3P0JA 4OAQA 3CNNA 3GLVA 1LSUA 1AA6A 1JN0A 2ODEA 5EUCA 4R7GA 1G3QA 2QTZA 1ECFA 5DNWA 2JCVA 5A4KA 3PICA 5JALA 2N0SA 4XSVA 3QVKA 3EY9A 1F4LA 3L93A 4JEIA 3ZYZA 4RF4A 3HMQA 4E07A 2B6HA 1FMFA 3AU9A 3BE8A 3NH6A 4GRDA 3VVLA 4B1FA 3M6AA 4A5SA 2J0QA 1S7CA 1LVHA 3H1FA 4DR4B 3O9ZA 3SBXA 3E2IA 1WSWA 3IKTA 2VHUA 3GPLA 1WMDA 1D3AA 3P7MA 4M0CA 1ZK2A 2LNDA 4XASA 4XEUA 2PDAA 4GUDA 4RPCA 3RFXA 1YRYE 2WJYA 5DM0A 1AOXA 1BN6A 3IAM6 3VKHA 3LLSA 1BE1A 1BXGB 4DMGA 1DIAA 1SRRA 1UBRS 3OU7A 5ARCA 3R75A 4EI8A 3HWSA 4DW8A 2IZZA 1KQOA 1SUWA 2WWHA 3U7RA 2D5LA 3JVDA 1SUIA 2OQIA 4K5QA 3OX3A 1ZC4A 3MWFA 2Q6TA 3AXTA 3AERA 2V7UA 2GRUA 3K15A 1IWPB 1U1FA 4UNIA 4G5FA 4BV3A 1VBMA 5TNXA 4CTJA 3EEYA 2CSUA 2VUHB 4UM9D 3W5HA 1P91A 2I7VA 3FPAA 4ZT3A 3GOQA 4W4TA 3COZA 1Y6QA 1J8FA 1ZI9A 3QWIA 4U7FA 2OXTA 3R7NA 3VC3A 3IPXA 3V8MA 4J7AA 4PG7A 4UREA 3T1HB 3B20A 3O8NA 1XDWA 3HYRA 3HJBA 1NPTO 2B4YA 2JRLA 3BRSA 3OE5A 4M0FA 4M7RA 4GRAA 1MOSA 4HWKA 3QUSA 1UKVY 4YJFA 2OFXA 2OD7A 3HU3A 4YCBA 3MS4A 3OP4A 3A8TA 1P4RA 2QTCA 4HNRA 4O4IF 2E4ZA 2Z5GA 1A97A 2HYDA 3ITNA 4RQBA 1QB7A 1EE2A 5J2UB 3LOUA 4Q19A 1RW4A 3LGXA 3K73O 3H2YA 3NTRA 2WTNA 4BEVA 4HUTA 3Q8KA 5EUMA 4IYJA 3IQDB 1F17A 1TVKA 4P7BA 1Z39A 2BFCA 1N2JA 4A82A 1Q3TA 5CD9A 4BPBA 2W0MA 1WUTA 2PKWA 2R7KA 3EBPA 3VO9A 1M1UA 4DN6A 4M6WB 2FU5C 5AVXA 2WZBA 1FFXA 4NNJA 3BYZA 2C96A 3DTVD 4M53A 4CYMA 4DTIA 3T1OA 4HQRA 3EXIA 3X2SA 3NAGA 3JYNA 3WL4A 3P4XA 1KU0A 1PU2A 3NLLA 4RPGA 1XBTA 4RJTA 3WR5A 5BSRA 4ZALA 2YYAA 3DV9A 5DGDA 4DR7B 3WBBA 4AX4A 1P1BA 2PKYX 1PTJC 2GF2A 2J32A 3K16A 4WNCA 3WRYA 4KZKA 2ZI4A 4P33A 2DWUA 5DI3A 1ORVA 1CZOA 1O8CA 2P40A 2YOFA 3KJXA 4MMYB 3HCOA 5ISMA 3U4IA 4J3NA 3V3KA 1Q91A 3ZIAD 4UEKA 1QLJA 1ZGAA 1YU6A 3QLJA 3R7SA 3R74A 3L79A 4AKSA 3WC4A 3SD7A 4BLWA 4H6VA 4K8OA 1ZESA 4GXTA 4BKUA 1JH9A 3S4YA 2PQ6A 1O94D 4MVWA 1XZ8A 2XW6A 5ES3A 1HI9A 4W8HA 3UMFA 1CW2B 1NR7A 4BP8A 3EN0A 4PHTA 1ZLXA 4DV6B 2FDCA 1LDYA 1SZDA 2O20A 2PO7A 4QJIA 3KEMA 4V1CA 1VG8A 1TJNA 4F8YA 5LIRA 1Z5ZA 1A2BA 3LY9A 2ZSIA 5C7LO 5L6LB 1NC3A 2OCGA 3LXXA 3Q98A 4PPNA 2M6LA 3GLGE 3IUNA 5TEWA 1JZQA 1UEIA 2PL5A 3DD1A 3GEPA 5F3WB 1RXUA 2C0PA 1QU2A 4KX5A 1L5WA 4X97A 1LS6A 4A03A 5F12A 2P6UA 2BI7A 5BOSB 5C9ZA 3A9SA 3H19A 4B3RB 2V58A 1QG0A 2VL7A 4ZVNA 3DVQX 1OHHA 3OIVA 1F0NA 1QUFA 1OI7A 3FTNA 3G1WA 1WZCA 2HHAA 3JQDA 3QVJA 1QR6A 5CCDA 3TDKA 4BUZA 2H9AA 2QP4A 3AC0A 1IEQA 5GONF 1UBSB 3HO1A 3AY7A 3IR6A 1ZU5A 4XFKA 3O8LA 3CNEA 2FVXA 3F3KA 4L72A 1A50B 3R3HA 4O5OA 3JVEA 2PLRA 1E6EA 2AX3A 2CXUA 2FWPA 1SIBE 2JAQA 2HNAA 4TL6A 3E84A 4YMGA 3HKEA 3VNSA 1WXXA 1P8AA 3FUVA 4JJ8A 1XA4A 2FPUA 4KAJA 3WL3A 4EA9A 5I5EA 1IZYA 4J0GA 2W6IA 4N01A 5CU7A 4OMCA 4CTMA 2NU6B 3KTAB 2YIJA 2QUJA 2D59A 4M21A 1W0JA 4PC3A 1MA0A 1XTZA 2FR0A 2FN7A 3II6X 5H80A 2J3KA 4UPEA 1A1VA 3A10A 4DEVA 3ZE9A 5J1SB 4QRHA 4FGJA 2DWPA 4W63A 1WU7A 5G3ZA 1NSYA 4FHEA 3CQ9A 1SK9A 4I3FA 2VDQB 3C6XA 4IS2A 3ST7A 3ANXA 2XMGA 3IP6A 3PGMA 4OVKA 3EARA 3EG9A 2EFYA 1ADBA 4UEJA 4CMCA 1D4ZA 1URPA 5LP6F 1D7AA 3LUAA 2BKVA 2AMFA 3PFGA 5K05A 1B4DA 1T2NA 1Z4KA 4GXQA 3FMFA 3OLZA 1I7DA 3G7NA 3O84A 3FJYA 4QO8A 2ZCUA 4I4IA 1QH1B 2F48A 1D5WA 3CRQA 5FWYA 1KAEA 2WWRA 3L6CA 4GM4A 5B37A 3KV3O 1JU3A 1RJEA 3HKDA 4OB6A 5T7BA 2P4SA 2JZNA 2JKVA 4IDHA 2V7QA 5I9MA 3TOXA 2Q8QA 2P3QA 1G42A 5I7VA 4XIYA 1VMKA 5B64A 2YICA 5AHRA 1NULA 4BQSA 3IR7A 3HBMA 1U63A 2ZVQX 4MDYA 3OOEA 1VIAA 5E7QA 3GUYA 3RM3A 3BZUA 3SLGA 5BORA 1KY2A 1SVKA 1NQ5A 2AFIA 2DBVO 2DUUA 5GV8A 1PVVA 2NNWB 2XKKA 2WJGA 3I5XA 1PD0A 4JVSB 4ZT5A 2BUAA 3C15C 2AFHE 2EGHA 4KH0A 1QKIA 4MPPA 3RH0A 4IJWA 2V45A 2XUZA 1B7GO 4D9HA 3PC8A 1O7JA 5HG0A 5BWBA 5HUHA 3UMMA 1W0CA 3MPUA 3W8NA 2QMEA 1NATA 3O8QA 4J76A 4PIPA 3UAYA 2VHJA 4MUJA 3KPWA 4LNUA 4TYYA 1Z5GA 1WXDA 3IHKA 1X7XB 3GRYA 2VAXA 4QGFA 4RFLA 4EHFA 4ALIA 2I3AA 4RVFA 4Y1RA 3RDPA 4JAVC 4JA0A 1FNCA 2NTNA 1N7HA 1B0AA 1X74A 1NZJA 3UCEA 1ZK1A 1KEEB 2YNMC 4DC0A 1ZRSA 3RUPA 4DV4B 3MN1A 4Z51A 3SIXA 2VP3A 4GPTA 1YHYA 5F2OA 5IXJA 3I0NA 3I2FA 1ZGCA 4O4IA 3DZIA 4LXGA 1I1HA 1VIDA 1T2AA 1G4AE 1GKKA 5TRTA 4NCBA 2JDID 3H05A 4RL6A 1A9XB 1CE8B 1YQGA 4MB6A 4Z5XA 5I3ZA 2AKEA 1V3TA 1XGKA 3IOEA 4AKHA 5F21A 4ZTZB 4MWGA 4L74A 4MYDA 4L78A 1U1IA 1U6JA 2C07A 4KR0A 5K0CA 1SVWA 2IH2A 3SYRA 3WL8A 4BVHA 2WD7B 1K3UB 2O8FB 4DJTA 3N8GA 2IODA 5E1MA 1NVWQ 3LWZA 3LD9A 3D8NA 4XAQA 4P2GA 4QJ3A 1R18A 3U7IA 4IEIA 2HLNA 4E11A 4O0LA 1WO8A 3PTZA 3WLJA 1RM3A 1US8B 2FEMA 3KOMA 2NNLD 3NNDA 2BTQB 1ISRA 3OPYA 2O07A 3OUZA 4E13A 2Q1TA 3DLIA 3Q5EA 1XUOA 1EZ1A 1R3DA 3AJ9A 4WK2B 4F3CA 1AO0A 1K5PA 3IQXA 1F5NA 1N5LA 4GLBA 2VH1A 4OLHA 3C2QA 3HR4A 4CFYA 1E9CA 3T7JA 1E2QA 1MB9A 3PUYA 4DG9A 1EP1B 5DKFA 5ALSA 1ZOSA 3S5JA 3GAAA 4POOA 5KMGB 5T8KC 2X8WA 1ZJWA 5JJLA 1E2KA 5EXSA 3BB4A 2OHXA 3U3DA 3H1PA 5DN6A 5AQ1A 1NW4A 5BOVA 3CXUA 5H82A 2YQ4A 4DDWA 2MSCB 5CEJA 3H8JA 3DTTA 1XAIA 2H51A 2F43A 3FPKA 3KYBA 3OJXA 2H1RA 3LYAA 4P3NA 4BQQA 1G9TA 1NR1A 3DEIA 2Y77A 1KZ6A 2R751 5SZKB 2JASA 5AK6A 2C5BA 4JB0A 1JQJC 3EJWA 4BTEA 4CNBA 3DZDA 5I7WA 1VPLA 5AW1A 2WRZA 4NE7A 2CFRA 4LYFA 4OJNA 4O8ZA 5FWXA 4FDAA 2MYTA 2ZT7A 2R48A 4J0DA 3GU3A 1LBTA 3ADPA 2AXNA 1OW3B 4H1VA 2UUBB 3KB2A 3R1IA 3AR6A 4EFKA 2IGBA 2JIZD 3Q3EA 5KVSA 4FFOA 1YRLA 2XKBA 4QZVA 1Q1GA 2DPLA 3VPCA 3L7LA 4D6YA 4MYRA 1VTKA 4IOMA 3V4FA 4UU7A 1SUSA 2O7SA 3SXJA 5P21A 2PS1A 3GA0A 3A6ZA 3DTVA 4PFJA 2NUAB 3OD1A 4LDPA 5D5QA 5H1YA 1R3UA 3L8GA 1GU0A 1ZL2A 2VSQA 5SZHB 1Q3KA 3R6LA 4UTNA 4MYHA 2X0FA 3GNTA 2CFOA 3JATB 3MTIA 1CB7A 1LVUA 1V2GA 3DV0A 4MIEA 4OHRA 3W5IA 2VK4A 3BCUA 4JJEA 1RWKA 1T3HA 3QYAA 3S0JA 2OO3A 1I4OA 2QW0X 1WX1A 4R2XA 3ZWVA 3I0ZA 4HAWA 3PWTA 4B7CA 3PTAA 4NOLA 1UBUS 4DLZA 1VLVA 4F3TA 1XTVA 3DD5A 3RSFA 4MR8B 2WUGA 4LF7B 4B8ZA 1G5PA 2VNIA 1G8FA 2XUIA 3NS7A 3PDHA 4B35A 2G72A 4V1CB 1XVAA 1YRHA 4V39A 3NBXX 5E4TA 1GXSB 1ZN2A 1J5EB 2QD1A 2Y1LA 2AE1A 2E85A 4H6XA 4PZEA 1NVDA 5BV7A 4LC1A 2ZSUA 3RC2A 3IGFA 3U49A 2H7CA 3AWDA 1X15A 3ILYA 4JI0B 1IPHA 4OSPA 3O1JC 4EDFA 1NVTA 2V8OA 4YT8A 4QUHA 5LNK1 3DMDA 1X1SA 5CDUA 4WK4B 1UZNA 3RTEA 2AOVA 3HQ4O 4L4RA 4J2HA 3HTXA 5KYGA 1TVMA 1WQ1R 2QX9A 2Z95A 3DMTC 5H3HA 2ZCJA 1S8FA 1O9BA 3W9BA 1M76A 1X1QA 1VE1A 4V0OA 5JZSA 3OIUA 2P41A 3G0OA 2A59A 1K8YB 1BOFA 3RYFB 2B9EA 4W9RA 4TKVA 2VQDA 4G0OA 3U6KA 1PZGA 3CIOA 4L5JA 2QRUA 5FNVB 1IEXA 2X0IA 3ANLA 2W83A 5J3JA 1PLKA 2DHRA 4JBXA 4PE5B 1T1IA 1XVUA 5D51S 5AIBA 5BMOA 2OV6A 2Z0MA 5KTSA 4LYAA 3ACDA 3SR4A 1DEAA 1DFHA 1G8SA 4PYMA 3UUEA 3L9XA 3P2YA 4RIHA 4XD2A 3TD2A 2Z5LA 3SEAA 5GGXA 2QT0A 3OWHA 2F6RA 5BMVA 1UBMS 2VOJA 2WF9A 1FFXB 2ZRNA 3GQBB 4AWXA 1C2YA 1K7CA 1NJ1A 1P1JA 5JAHA 1HV8A 1VOTA 4LYDA 3ZDYB 4YJKA 1MC8A 1HDEA 1Z56C 5EL0A 1XMQB 3NV7A 4C4RA 2Y71A 4AW9A 4RESA 1VCIA 2E6KA 2QJFA 3OZAA 1RAEA 3WV4A 4RTLA 3HZHA 4IFEA 1T4MA 2C7PA 3B3FA 5HSGA 1YS7A 1K75A 1IIRA 4JROA 1PR3A 3G9XA 4DR3B 2CF5A 1SQ5A 5LZ8A 3V6MA 1QK3A 1BWSA 3I6ZA 1CJUC 1RLUA 1Q0SA 2BW0A 3EW9A 3KLOA 3DDSA 3WY9A 2P9TA 1QPGA 1DWUA 4GMKA 4L51A 4MWZA 1WDMA 4M1MA 5LXTB 1NC1A 3SX0A 3TZHA 5C5IA 4IYRA 1S1MA 4RTJA 4HNGA 4PWZA 4R8LA 5H9WA 3CKMA 3PEWA 4HDKA 5JMOA 2XUJA 4FUQA 1X7WB 4W5NA 5C1OA 3BFVA 3G2QA 1UINA 3R9IA 4D82A 1EFPA 2J3IA 5CB4B 3GA7A 2J7PA 3ETLA 3QMPA 2Z4RA 4ZVOA 5C81A 4F1KA 4I55A 1SVIA 3JQQA 1QRAA 3LECA 1SUPA 3GLUA 4GT1A 4NU8X 2ODNA 2RE8A 1PG5A 1Z7GA 2GKGA 4JENA 5ESRA 4B9EA 3K6SA 2XRZA 3Q2OA 5C32A 1HEUA 1AZWA 1N9GB 2XB4A 4NPHA 4C4PA 3AFNA 4Z53A 1B43A 3PSHA 1HKUA 4ZD6A 3PUWA 3TI7A 2XWSA 4G97A 4D8TA 3D1VA 3KKKA 2BI8A 3DV0B 1JEEA 3HDTA 4A6XA 4FKZA 4TS1A 1ZGBA 4ATNA 5JJCA 4TLDA 1L4LA 1YRBA 2VVTA 3D6HA 4RVGA 3KKZA 5DXJA 3WBJA 3KJEA 4ND3A 1ODSA 1QYCA 5FPQA 3ETDA 3TJMA 4YT4A 3TSYA 4LX8A 2J3JA 1M72A 2ROQA 5CA0F 4ONEA 1Y7IA 3AKCA 2K7ZA 3OPVA 1W6UA 2TECE 4Q7JB 2A1TS 1TADA 3OQJA 3PNOA 2Y2VA 3AOEA 1VRWA 5U1PA 1U3UA 3RR2A 2QRGA 2B0CA 4PZLA 4NS1A 2GPYA 3TE7A 3LY8A 4C04A 2OLKA 5HR5A 1G7RA 1QIHA 1QX4A 2Q2OA 3JD1A 4KGDA 4M83A 4WLFA 2JK1A 2NZWA 2REOA 2VWPA 3LFHA 4IQGA 4ZV7A 3RS4A 1O97D 4ENTA 1ZH8A 2CLEB 4QSHA 1UUFA 2I2DA 4OAPA 2V1UA 1J2UA 1B00A 2OGUA 3L6OO 4R2IA 4RU1A 1P81A 4AYXA 1U28A 3C8MA 4QPDA 5KNDD 3HB1A 1MB4A 1GRQA 3TMKA 1FPQA 4JLOA 1VSTA 3G7UA 4LWQA 3MSCA 3NONA 5BN4B 3R5FA 4I55B 2FMTA 1O57A 2PUFA 5A4JA 3AJAA 4LQCA 3U3MA 2GF0A 3UANA 3IUEA 1NJ5A 5DDIP 5KQGA 4BRWA 5KVAA 1B6SA 1C7RA 1HDCA 1UT6A 2XRFA 3TN7A 5EIFA 5BN3B 5HKKA 4YUVA 2ZR8A 3SYLA 3ZHOA 4W9MC 4BPRA 4V0MA 2ETVA 3GFPA 4P54A 4CI0B 2CZCA 2K6GA 4XYGA 1K4MA 4H7KA 5ALDA 4JP3A 3PGXA 3SKVA 5DHQA 4JY7A 5AK4A 4JMPA 1X8XA 2TMGA 4KXUA 1P2VA 3GDGA 5TC4A 3VZBA 3MAAC 1X77A 3AHGA 3HGTA 2YZKA 1P1IA 3QPUA 4D80A 1EQUA 5BQOA 4ZI2A 2PUBA 3LHIA 5FPHA 1QIFA 3TBKA 1KI1A 3KKEA 1WVMA 3OFKA 2IIQA 2JFNA 3G5MA 3WGZA 2IUFA 1R37A 4XLZA 1Q7RA 1DT5A 1YR8A 4DCGA 2FWJA 4PG4A 3W2FA 3OCWA 5JS8A 1US8A 3RAJA 4L7VA 4ECAA 4YPVA 2JA1A 3DOOA 1W1IA 5ESWA 2C2YA 4CLRB 3YASA 2Q2VA 2DYKA 2I3ZA 1DG9A 1W8DA 3QKTA 1AUVA 2WIBA 3W3AA 4WE3A 4NJMB 4JX9A 1RP1A 2ZB7A 4N12A 5CT4A 4NESA 1AKQA 3BILA 3G49A 5ALWA 1WTCA 3ZX5A 3BORA 2XXJA 1IATA 2RK4A 3AV0B 4FIZA 1C7JA 3NT5A 4PLVA 2BFNA 5BYAA 1C80A 2P77A 3LO5A 4M1QA 2XYRA 4B6PA 4I3HA 4NY1A 4IRXA 4AYTA 4CL8A 3DBHA 2Z98A 1JA1A 4KWIA 4RKYA 4JOSA 4M9QA 3T3MB 1NYQA 4OUDB 3ZD9A 3L6DA 3E6AA 1NMXA 4LMPA 3R6DA 4JYCA 1TUEA 1MDFA 1XZPA 2R6DA 3DOHA 4DM4A 5AVVA 4BNMA 3IHTA 1YVRA 5JS2A 2HA2A 1Z35A 2KLBA 1TK3A 3Q88A 1CCWA 4CRWB 4D4HA 4DIBA 1TYBE 4NBLA 1AKVA 5EWLA 1R4NB 3EAQA 5KYUA 2C7BA 2BFPA 1Y8RB 4LTDA 4NF2A 5CYPA 5LLTA 5C0OE 3OLCX 1XCOA 1OASA 4WJZA 3BTUA 2Z4SA 2GXAA 1JVBA 1YI1A 2UKDA 1QV7A 2OCYC 4MITA 4DSNA 5FWAA 3C5EA 1F8XA 5EJFA 2HLDA 3GJQA 1DUSA 4FFPA 1C1DA 1Z5OA 5F1KA 2VLBA 5LL6P 4MINA 3GFFA 1WHSB 1PZNA 2IEIA 3P26A 4J1TC 4NMMA 1WDLA 2R8ZA 5B2ZA 4BLPA 1A27A 2PGNA 1MRSA 5B1EA 5JSHA 5KTYA 2GSDA 5EIEA 5L95A 5FPTA 3TCXB 1SBHA 2QRKA 3AHEA 3LCVB 1N3IA 5FEMA 4Q21A 2QR3A 4R98A 1UKBA 2IOFA 1E92A 1II9A 2V03A 2FQQA 3IT3A 4KFSA 4YECA 3I5YA 1B8UA 1G0OA 2OO5C 3ETGA 3EXFA 4MA4A 1TEXA 3BH7A 1P1CA 5FOWA 1JIKA 1L7DA 1HLPA 4AS1A 4PXYA 2VJQA 1B1AA 4FGLA 4KI0A 4BN0A 2WICA 3W9SA 3AWIA 3UWOA 2K5UA 4DMMA 3MMPA 4TTTS 2N1MA 4TXHA 2OB2A 1C3LA 1Q11A 2RHBA 5D7NA 2YV5A 3R76A 2RJ3A 4F60A 2FDXA 3IDSA 1IXRC 1T4GA 1ML4A 4PAQA 5CDHA 2I3BA 4REQA 5EINA 4PG8A 3N2IA 2I3GA 4HH3C 221PA 4QDKA 1Z2CA 4ZI5A 1TEZA 4C06A 5G3YA 1ZHOA 3COVA 2AG5A 1UZLA 1YDMA 4X90A 2EQBA 2AF4C 3FMIA 3STYA 3UGJA 2FMKA 1A2QA 1LRJA 4OHUA 3TM5A 3U26A 3WOHA 5JDCA 4ZQCB 4BBAA 2JG3A 3ZE8A 3GLRA 2XVZA 3SQXA 4DLKA 2H1WA 1BVUA 3N0VA 3LCJA 4F0JA 1WABA 2XZOA 1EJ2A 3OF3A 1V48A 2WVAA 2QROA 4TRNA 2NYVA 2ZJ7A 2QZ4A 1ZD1A 3NKVA 3T7CA 4DZRA 4XVCA 1OC4A 2ZAGA 2ZQZA 1ISJA 2JLRA 2ZBGA 2QVXX 3OEHD 5BQ3A 2ZE6A 4LJSA 1ZW1A 1XK6A 2QTVB 3D59A 4RQAA 3QTTA 1GYRA 1F3OA 5CIWA 4EYEA 1YCDA 1UT5A 3IH5A 2EBHX 3SVZA 1ZI6A 2X0KA 1N77A 3ELWA 3ZDXB 4Q34A 4DUYB 4YS6A 3U3OA 5D84A 4BNYA 2PGJA 3LPNA 5IM4A 3P96A 3UG7A 2ZUSA 3QX8A 1LDMA 4DL9A 4K9RA 4ENWA 4I50B 1VKOA 2JKYA 3F5DA 1GPNA 1EVLA 1Z4IA 4UUOA 3IBTA 2VI5A 2XJ9A 3IAUA 3RF6A 3ESQA 2K4MA 4YPOA 4HH1A 2EZTA 1JG6A 5DNYB 3UO8B 3SHOA 2RHOA 5BNIA 1C1XB 1K6IA 3OOWA 4IRUB 1NNSA 1MCZA 4J3FA 4UCWA 1YIDA 3S6JA 1KPIA 2R6FA 3PDWA 3TIGA 2ZKIA 2CXHA 3CLKA 3HFGA 4K81B 1UAAA 4O8CA 1MD9A 2D5CA 2GZHA 4G9EA 1D6SA 5DBFA 5HEKA 1VLZA 2YV4A 2YY6A 1QMGA 4WEQA 4ZC1A 3VQTA 5FTNA 5H0IA 1YC2A 2ZR9A 2ZR7A 4EA6A 1KSHA 1OPRA 5T4HA 3WRYC 4L9AA 2AT1A 4LCJA 4ZOLB 3WYNA 1G3RA 1MV5A 3OURA 1FL9A 4B3CA 3WK6A 2Q6KA 4OSEA 3OPNA 3GROA 4BFSA 2O8BA 2AUMA 4IICA 3K71B 4HQNA 1TB4A 1EVZA 2GM5A 1QH9A 4TT8A 4UBKA 1VGRA 5EIBC 2FP4B 4AJJA 3G2NA 1CUJA 2AV6A 3KU1A 2ZRJA 2HA3A 4RJIA 2XRMA 1JNXX 3FY4A 2CD9A 4C3VA 3WGLA 3NXSA 3WDSA 4OQMA 1DU4A 1QHFA 2J0UB 5JZMA 2GBCA 2R68A 2WMOB 4O4HB 2I99A 3AG5A 1UKZA 1XMPA 2IYTA 3ZJYA 4DR5B 1GTSA 4Q9LA 1IB6A 3P9IA 4E03A 5DGTA 2ZIXA 3MGKA 2X58A 4RD0A 3L3BA 2Q21A 3FNGA 2OUIA 4U63A 4ZCMA 5LOVF 1M7BA 3IAS1 2H54A 2RGBA 4IQ8A 4N5NA 5ALHA 1E9AA 3ZDZB 5K20A 2CJPA 4QA9A 1E5XA 4QUIA 4WBNF 3CLHA 1QTQA 1KJJA 1SB9A 1OGIA 1P7ZA 5FQOA 4N76A 4GZLA 3GJZA 1N57A 4R1TA 3C14C 5AKHA 1H6CA 3HH8A 1OU4A 4A2WA 3LC1O 5TE9A 2JIQA 1PT8A 4WDRA 5I45A 2NMVA 1W35A 1VB3A 1PT7A 3BGVA 2Z83A 3CEAA 1SJ9A 1EFKA 3IPYA 3LKBA 3OTWA 2HCJB 4MCIA 2F17A 3QVUA 4FHZA 5BYKA 4P81A 1OBHA 5HCNA 4FP9A 1RE0A 3ZIAA 3KFXA 1AKTA 3HXOA 2DFNA 1YA6A 3NHPA 5FFNA 2HU8A 1SXPA 3G2LA 1U8CB 3EZGA 1RBZA 1EUCA 5WRFA 4CIXA 4UTVA 2ODWA 1E7WA 1FDRA 1L1EA 1MTZA 5E6SB 1LW6E 5I9SA 3F3SA 2AOWA 1XDBA 3WIBA 3WOVA 2A3NA 1E2UA 3WGMA 1N9KA 3M6FA 5K8TA 3O2NA 3BJZA 1U2TA 1W0JD 4YAOA 1A7KA 1GKUB 1UK6A 4I5EA 2D8MA 4E5SA 2Z5FA 2ID7A 3MT7A 3KOYA 1KMHA 1PE0A 2H1IA 2VUUA 1KWGA 3G2PA 3U6BA 1X1RA 1VLHA 3CLRD 1LLCA 1SEPA 1N1MA 2NGRA 3QU2A 4FDVA 3EG9B 4D57A 1NSFA 3H5LA 4KXFB 3IRUA 1WUIS 3JWGA 3IIMA 4IV5A 5G2OA 4PGFA 1P0PA 1U3WA 5HYVA 4OFWA 1TT5B 3ZTTA 4B6SA 2XI4A 3OE1A 4TKMA 5TVKA 5CEFA 1NP7A 3NRJA 3EGDA 1FFWA 1SQ6A 2JGDB 3IAXA 3JSXA 3JZFA 4YB8A 4MGKR 2CLHB 1JI0A 3H65A 3M7IA 2D0IA 4BJHB 1Y5RA 1KI3A 3HB5X 4OXNA 2MSLA 2DFTA 5DSXA 3EY4A 1R9MA 3DYBA 4C43A 1QSGA 2CY0A 4JJGA 1TIBA 1GFZA 1TO1E 1VDMA 1XRJA 4IXNA 3IDZA 3LT0A 2JGKA 4EY5A 5JWHA 5CVJA 2OE2A 8MHTA 1CVIA 4NYJQ 5IAJA 2FR1A 5LBIA 2QWXA 5T67A 13PKA 1YQUA 5LB2A 2EG9A 4RCZA 3U1TA 3W3AD 3DUFB 5KIAA 4DY6A 4YAIA 2PIAA 1UF9A 4FINA 2C4MA 2GEFA 3ZCVA 3KS9A 4S24A 1P75A 2A35A 2WJAA 2QTMA 2NSYA 4K6MA 1YJ5A 1L4BA 2FN4A 2ENUA 2PAFA 2JANA 3E81A 4Y1FA 5A9TA 2ZM6B 1GD1O 2FLVA 4J0FA 1YDEA 4LJ9A 4MVJM 1TMKA 2WJ3A 3QKUA 4MAMA 4RTQA 2J3DA 1ZONA 1F4VA 2QVZX 4UJ3A 2IPXA 5TDHA 2C5AA 1P9WA 3G17A 4ZDJA 5IDVA 4OHMA 3TB4A 1RC8A 1X80A 3RIXA 5C7OO 2ZYIA 1Z8NA 1NTRA 2AR7A 3CCBA 1JDSA 2AD1A 4W7HA 3IESA 1J2YA 3D7RA 4ETMA 3GG9A 4DPMA 3L0CA 3RO7A 3W3ZB 4R51A 5IM4F 2PE5A 5IAGA 1CVLA 4IHAA 1OD6A 1H2YA 2ZRMA 1ESCA 5IASA 1TM5E 1TZ2A 5IVKA 1SU4A 1A7AA 1N92A 1XYVA 2FZWA 4PV7A 1G5IA 3TQSA 1W34A 4GPD1 2XTMA 2DXIA 4PM4A 2HWUA 1E0DA 1FMTA 2LKDA 4MW7A 4OMUA 3PPVA 4W1PA 2DCMA 4CBVA 1XRSB 2QPTA 5IEJA 1Y9ZA 4QLOA 3HKCA 4M4SA 4BFYA 4JI8B 4KQEA 4DJJA 4R0NA 1SVNA 2JHCA 2ZTMA 3OEYA 5LA6A 3ROPA 2I2CA 3BHNA 1YO6A 2AZMA 1Q84A 3G2IA 5CBKA 3CT4A 1OZ0A 1O9GA 4C0HA 1DEHA 3LPMA 4V03A 3BWXA 2BEUA 4HX2A 2POQX 1U2QA 3A70A 4IG4A 1OSNA 4L5BA 4ZK2A 1S6YA 4D3XA 2QV7A 2BKAA 2ECPA 1U7WA 1WZ2A 1CFJA 2L82A 1AE1A 3HA7A 4MO2A 4YLEA 1P7YA 1RAAA 3S8MA 1Q0RA 1U65A 5C8XA 2I91A 4G5SA 2E0IA 1HT3A 1Z06A 5AW6A 3DO8A 4U7JA 3C3MA 2PH5A 2EKQA 5CVEA 4JIMA 5HCUA 2QUZA 3QLUA 2VEDA 3L2OB 1I2DA 1JJ7A 2BHTA 2Z08A 4F3YA 2AG0A 1DWPA 2A4KA 2C54A 2C1XA 4CUKA 5I7FA 3AHCA 2GCGA 3GLHE 4HL6A 2P78A 4DQLA 5HP4A 1YUBA 3EVNA 1JHAA 3QJ5A 4TT3A 4AG6A 4ZU3A 3BUSA 3LDFA 4XQGA 4EG3A 4G0VA 1DQZA 1VKRA 3CZ9A 3U13A 5I9NA 5TF0A 5JMWA 2A1UB 3IAFA 4YAUA 3CJTA 1NQVA 4YH1A 5AUOB 2IHJA 2XF2A 2P90A 2ZAYA 4C14A 3NDBB 1E9RA 1ACJA 1DAHA 2WTEA 2XLCA 3F7NA 4H4CA 4OH7A 2UYHA 4WZAA 2AOTB 1ZYUA 1LI5A 4BNNA 1G3IA 1WZUA 2POCA 3HUDA 2IYSA 3ZU4A 3OEEA 4BC0A 2FE1A 2GO1A 1R0KA 3DDZX 5TMDA 1U2PA 3CN7A 3KYCB 3WQBA 4CMAA 6CHYA 1FPMA 3O2SB 5A9RA 2UYOA 1VJ1A 1RR6A 3RC9A 4C0KA 3AQ4A 2JVJA 1J2TA 4OK5A 3HKBA 3ITDA 1CYDA 3ICEA 1ICIA 1XMSA 2IZ6A 1Z7BA 3QLEA 2PD3A 1CEYA 3B1ZA 2XF8A 4YRBA 4JIGA 1LSOA 4TGLA 3I34X 5GWXA 3G85A 4GBMA 5EZ5A 4CUJA 1G5TA 3Q4GA 2ZZNA 4MW0A 4B34A 2VDRB 2ID9A 3HPRA 4RF2A 4MPTA 4R2LA 1JVNA 3NI2A 2XT6A 2CLCX 2QJTA 4H18A 4KO3S 1OFHA 1XTPA 4B4VA 4QDXA 4KNWA 3DHVA 4QBIA 3RU3A 4ZDWA 3FBGA 3PIIA 5AOAA 5JJBA 1JQ3A 4DSZA 3VR0A 5HZKA 4Z3OA 3TLYA 1O03A 1JB9A 1OIVA 1GUZA 2YN4A 4HZIA 5DI9A 4A1FA 2X5OA 3EGWA 3KZNA 3E23A 4KN6A 1J9GA 3PEVA 4BXOA 2BV3A 4MV9A 5DLYA 1GPBA 3ICOA 4J07A 3GLHB 1OJ7A 2Z1NA 4URWR 1KSGA 2OCIA 4Z7NB 5EMJA 4MEBA 5JNSA 4OXIA 2MMCA 3Q9LA 1IL0A 2PXHA 3R7WB 2C5LA 1R10A 1V2HE 1N5OX 2O9JA 1M5RA 4NG4A 5G53C 2HWWA 4JJ7A 3VR4D 1Y0BA 2IXTA 3K05A 2XX3A 3EWSA 3H04A 2ZJBA 1ZQ9A 4DCNA 4LHVA 4HBGA 4FZRA 3LZDA 2P7HA 2YXBA 4KP7A 3WK7A 4BAUA 4YCMA 4OBBA 3H8SA 3TLAA 3BAZA 4C1BA 2XE6A 4D8VA 4Q18A 1WZEA 1ONSA 4I3GA 3A4LA 4CR8A 1KQFA 1BE6A 4JELA 1AHPA 2HRQA 1CIJA 1HF3A 2NO5A 2Y1OA 3WJ1A 4ZYTA 1G3MA 3VPHA 3UXHA 3T15A 2XUKA 2JGRA 2PZLA 3L5KA 5CVVA 1GN9A 3VZQA 3ZWQA 2E6UX 2Q6VA 2Q6IA 3C1AA 3GT7A 5E7JA 4CMBA 3H5AA 5DX0A 4HBZA 4J90A 3OM9A 1KYIA 2BI4A 3N2ZB 5SY9A 4MV7A 3UEOA 1DB3A 4HCJA 1JG3A 3L7MA 3ORQA 3KHTA 3VHXA 4XVRA 2IV3A 2ORWA 1U0OC 4CLOB 4D9EA 2IF0A 1KC3A 4RY8A 2X14A 1IOZA 2PJZA 1ESMA 3TKLA 5D8DA 2HEIA 3ZXSA 1E1RA 1MV8A 2GJ8A 4CQMB 4LV8B 2IOYA 3MM4A 4H0NA 4KJXA 2I34A 5BT8A 5JCOA 1J1UA 3IO3A 4IMPA 4C05A 4KPUA 4RHYA 4EEZA 1TDJA 4B4UA 4YYZA 1KOJA 1QK4A 3HWX1 2N1BA 5GIOE 2ZIEA 1ZMRA 2HQSA 4UE3S 3IMFA 3KTFA 1MKYA 4CGYA 4YP6A 3RC8A 4JXZA 1JIJA 3NP7A 4BLVA 1SD1A 4MLDA 3R3ZA 3LQ2A 1LI4A 1WAMA 3SP1A 3TSCA 4B73A 1DZ3A 1S2GA 4C08A 4G0WA 2SECE 3DKKA 3VNQA 3DMPA 3HM9A 1A1SA 1IONA 3KYCA 1TZKA 3ESDA 4P98A 3JD2A 3HN7A 3LQKA 5A71A 5C4MA 2Y1CA 5J1TB 4EJMA 3OQOA 2QG6A 1T8PA 2ZYTX 2G25A 3UATA 1SKYE 2DPHA 2EHJA 4R01A 5CFPA 1PT5A 2QAGC 1QOZA 1I4DD 3UMYA 2G67A 1NG9A 1GTJ1 3FHLA 1SZCA 4QU0A 4MQEA 3UGTA 2Z2IA 5FOVA 1Q1ZA 4O59O 2CLKB 1CUFA 1LV8A 4TN1A 3DAFA 5A5EA 4EJSC 4LKRA 3EF1A 1NGSA 4KWHA 2XNKA 2JCBA 3EDYA 4JLMA 2XITA 4XWTA 4BQIA 1J5XA 2X3YA 1YR1A 4JT9A 4Q16A 3CRVA 5L51A 2YWXA 3QPAA 4WBSA 4NULA 2X15A 3F6BX 3OCZA 2FN8A 2AEJA 2YFKA 3P0EA 4YDSA 5FNZA 5GJCA 1R7RA 1Y3CE 2F7SA 3W9UA 1UWCA 2QLBA 3ZW9A 4AI6A 1QZ3A 1LDEA 5SY6A 2HJVA 3UJCA 3TB6A 2WILA 1Q15A 3BRCA 4B3IA 4PHGA 3ASZA 3SXUA 1HYEA 5IVPA 4IKOA 3AEQB 3Q15C 1UMBB 1FYFA 3DF7A 3SCZA 1FP4A 1DXHA 1OC2A 2RGGA 4TV8A 2CXRA 3UYLA 1F12A 2GYUA 4KN8A 4A8HA 3I9FA 3WJ7A 4NCHA 3ZC3A 3CG0A 4HUJA 1A76A 4XVUA 4ZCTA 5F5LA 4MUMA 1V47A 4QXAA 1V8FA 4G0ZA 3UWMA 3CHYA 4ML3A 1FFBA 3GT0A 3TLXA 4CDNA 5G02A 3O92A 2GRJA 3FOWA 1FRNA 2I78A 3OQIA 1OGJA 1RWOA 5CEEA 2WE7A 4NZNA 2Q9AA 4DSTA 2BWJA 2WKWA 1KBOA 1YZUA 3AVPA 1M5UA 1WVIA 2LR0A 2XUQA 3H4IA 3LUPA 4FI3C 1JU4A 2RMKA 2YWHA 1C9KA 3HY3A 2Q5FA 5F33A 3GPCA 2HDWA 5SYNA 4BNGA 4EPXA 3DOUA 1YAHA 3U9SA 2D6FA 3LCUA 2HMTA 1OAOA 4R84A 2Z8XA 3PC2A 1Q16A 4UUNA 4C6TB 2DECA 4MKFA 3MUOA 4QFMA 3OY2A 4L08A 3GJXC 4MP6A 3U39A 3H7IA 3ONEA 4ZEMA 2J9YB 4PQYA 3HXQA 4UTXA 1DJQA 5E9AA 5LZ9A 4N0MA 1PFYA 1U02A 3MRVA 3ZIUA 4KOEC 3ZN2A 5ER9A 2O06A 4LE1A 3UOWA 2W6QA 2WB2A 4CMEA 3TG8A 3S99A 4RGYA 2I7DA 2VF7A 3DW1X 4FJ0A 4D3YA 1AKNA 4WN3A 8AT1A 1B14A 3QKWA 4HLQB 5CPFA 4E70A 2XGGA 1Z0JA 2FZVA 2HK6A 3FDJA 3GGDA 4NL4H 5AK0A 1Q21A 2IHBA 2PY6A 2W2NA 1PWZA 1XRMA 4L0CA 2JBAB 4RZUA 4R1PA 1EWYA 4Z8YA 2HHJA 1Z7YA 2OV4A 1WPQA 5T4BA 3WWPA 1H8HD 3RHZA 4KQIA 3RTGA 1RBMA 1DRWA 2NUAA 3AONB 4J4BA 4F45A 2QXUA 3B36A 4INZA 3QKIA 3EPHA 4ARSA 5AW3A 1YQ9A 2ZETA 1L1FA 2CNKA 3IMCA 2ZYVX 1BHJA 3S29A 2RGWA 3FKJA 4ESVA 4JSTA 1ZISA 3HZRA 3UAGA 4JA2A 3AFOA 1XEXA 2CJYA 3BBLA 4KQGA 1HOXA 2P3LA 3IP9A 2I80A 4L3WA 1QR2A 4PSUA 4YQFA 5FWXB 5GJWC 1RJ9A 4FDUA 2A6PA 3TSAA 4R3WA 5KSYA 4QEZA 3RUCA 4MVJH 3DFMA 3DDWA 4FN5A 1RQ7A 3NBKA 4EABA 3L04A 1TYZA 4PLZA 1QQBA 2A7QA 4RMIA 2HQRA 3N58A 4KJZA 1E1KA 3G9UA 2XD9A 3FRHA 3HDHA 3HY4A 2YZGA 3JWPA 4HDAA 4WESB 5E2AA 4OQPA 4YUZA 3I2KA 4OQNA 1HE8B 3W8FA 3LT5A 3VVCA 4CM5A 4RVNA 4NBWA 5DF1A 3VX3A 1QLWA 5KOYA 5TPWB 1SCAA 5JBQA 4A2QA 5AM5A 3I8OA 3Q2KA 2EWVA 3K0BA 2XTZA 2IWRA 5I4CA 2AQKA 2QUAA 1P1FA 3NW9A 3QQ5A 1UXHA 2HQOA 2XGMA 3NBYC 3AO0B 5CGQB 5HIMA 4DNXA 5CITA 1KZ1A 3B3AA 3Q7EA 1C14A 3H5OA 4I50F 1A2KC 2VYNA 2Y6UA 4M37A 4P53A 4XJVA 1UAYA 3AFMA 3TK1A 4B5LA 2CGEA 4RA9A 1TD1A 2IHTA 2NTVA 2RGXA 3MWLA 4BNTA 4F4FA 4R1OA 1XC7A 2UXCB 5AI5A 5JZBA 3ZV3A 3L40A 4KIWA 5JG7A 2XMRA 3F6PA 1NAHA 3QVWA 3S2YA 2E37A 2AJLI 1TTHA 3RFTA 4DJFC 1SCKA 4EELA 1IM8A 4UU1A 4JCCA 1J9ZA 2II6A 4CKYA 4TZ6A 2QBYB 1K0FA 1U2DA 2NUTB 1QGYA 3AESA 2P9QA 2OILA 5FX2A 1E7MA 1NUPA 4G5OA 1A4XA 4GEKA 2FK7A 1SEVA 1P0FA 2HXSA 5TS3A 3ZKWA 4JXJA 3UN1A 4EYSA 4C7OA 2CEKA 4RLFA 2OORA 2RCNA 2VATA 4JODA 3WB2A 1Q7TA 3BDAA 1XFAA 2FWBA 4PZCA 1ULUA 1SVMA 4YJ2B 3RU7A 5KO2A 4BZQA 2HXYA 1COZA 2O23A 1JZTA 3G2MA 3PNKA 3FCUB 3C24A 1M10A 3AMVA 2Q1YA 5AM4A 4Q1CA 2BVNA 4JI3B 4RHEA 4D9GA 4BRUA 3T61A 2OSBA 4YQZA 3OQHA 4MIKA 1JPJA 4YY3B 3U7GA 3JASB 2YNMD 2WT4A 4TS4A 4CDMA 3BJRA 3BMQA 4BNFA 4MJ3A 3PGA1 1Z4NA 4RBNA 1GITA 1RPAA 2GUGA 4C6SA 1Z0FA 2H5IA 2QVYX 4IIVA 1UP6A 2V9CA 4KXVA 4XJSA 5LBTA 4CQNA 4KO1S 2G9ZA 1JXOA 3MRSA 4E2ZA 3VSEA 5FKJA 3H5WA 4TMYA 3MWKA 3AR2A 2WDZA 2YYSA 1MX1A 2RK6A 3HBFA 3PNLA 4RDCA 3RJTA 5DIFA 4GPAA 4C0WA 5J2TB 1AJEA 1RRGA 4IVPA 5DSTA 1GQSA 5CFRA 4D0SA 3IP3A 1V39A 2XVAA 3KWJA 2BCEA 5L40A 4K9NA 5FA6A 3IUQA 2NO9A 1UMCB 2V0NA 3X1WA 1A71A 4D0LB 2FRVA 5AXBA 4GR5A 4BAGA 4S05A 2FGJA 1T0UA 2GOYA 4M1TA 4PSKA 2B37A 2CW5A 1E2HA 1M6HA 1MO2A 2ZBEA 4Q15A 1DVRA 1P17A 3PHIA 1EK0A 4EQ6B 4QVIA 4QT0A 3F46A 5K0ZA 1Z5PA 3R4CA 4LISA 5EP4A 4QYIA 1WMBA 3O7MA 3K2IA 1UPAA 5BVHB 1Q1QA 1UBOS 3VPDA 4JZKA 2OBBA 4MV3A 4QHSA 2E1PA 2L18A 4P38A 2ZWPA 5CIQA 1RU3A 1Z6ZA 2B8WA 4YIKA 4J7CA 3VKGA 1LNQA 1MO6A 3MG9A 1VGQA 5AUQA 4ZVPA 4A91A 2BM8A 3FBWA 4NNPA 4N18A 4BU0A 4P86A 2A9VA 4MQ5A 2IZ0A 1Q0ZA 2C5GA 5T57A 1JECA 3BE6A 2WB4A 1KU6A 2FZ4A 2VP9A 3EG5A 3H5NA 3RW9A 3T3GA 4YMUA 5KJFA 4ICIA 2YXDA 1J2JA 4IR7A 1EAMA 1BH6A 4BFTA 3KVRA 4HADA 4PW0A 3COSA 1NPDA 3WLEA 2WSSD 4DMUB 4N6GA 1WR8A 3DHWC 4MLZA 4HQFA 2VP4A 5AOVA 4RJ2A 4BO7A 3C7AA 3UFXB 4YR7A 3K9CA 3Q8WA 1W0KD 2CBGA 5K45A 1XJ5A 4K9LA 4UCFA 2XVYA 4NTZA 3EEBA 4MW6A 4RK0A 3I2YX 1TVCA 4REQB 4BE7B 4IUCS 2ZOSA 3BC1A 4BIIA 3ZBTA 1N6PA 3AUAA 1NVGA 2OORC 2OO5A 3GRRA 4HOYA 4DPLA 2NPFA 2Q62A 4CLEA 4LCBA 4AMBA 3ZWDA 3TRFA 4EPYA 2R8BA 1WMAA 5BWNA 4R83A 3ESRA 4GI2A 5B4UA 3RNOA 2ZJ2A 5FOUA 1K88A 2NZUG 2OXIA 4ERNA 1M8GA 1JFRA 3BXPA 3E0QA 4NONA 5B55A 1UXOA 3LDGA 1WMFA 1KDZA 4AJEA 1REQB 4LJYA 3LRPA 2PVPA 5AKKA 2KB0A 1OTHA 1THZA 1UOOA 4QIHA 2AHRA 3CH4B 3ZD8A 3CINA 4OYYA 1P19A 4BB5A 3DOJA 4K6GA 2BE9A 4RD4A 2Q99A 5HW0A 2OHVA 1MFPA 4HMQA 2ODTX 1PJ2A 3M3PA 2AOXA 5FIUA 4C4OA 5JBIA 1PGQA 1LEHA 3I83A 1EM8B 4I1VA 4O2AB 1NVAA 5BSKA 4IJUA 2H4XA 2IYYA 1D07A 3DDUA 3W90A 3OLQA 3WLFA 3X1JA 1P2FA 3ZG6A 1CV2A 3KXLA 2IHYA 2RB4A 4QYMA 3T7TA 4BNHA 3RWBA 2YCLA 2Y92A 3ZWBA 3N8KA 4B3FX 2EHDA 2RI6A 3V2GA 5GOTA 4G5GA 2YS7A 1QRRA 5FBRB 1JLRA 1WF6A 2JVKA 2OFPA 5AJTA 2BDTA 4DLXA 4N7RA 4FYIA 4QT4A 2E3JA 2WI8A 3EVZA 4J3JA 3WIVA 4BKPA 4DMKA 3N0RA 2NSHA 1D2EA 1L4YA 4LY9A 4DCUA 4F2WA 1ZNWA 2G9VA 2NVUB 4DPKA 2CBZA 3L4SO 2DUNA 4MV5A 4EM6A 2BMVA 5EZSA 3C4JA 4NCXA 5AW9A 1ZRNA 4UDNA 5K8UA 4M54A 1TIPA 1ZKDA 4ITVA 1DAKA 1JHQA 2HPAA 2WVJA 5BN3A 2E4XA 1ISPA 5JNLA 1F6WA 3AJEA 4HYTA 1IM2A 1G7CA 1F1BA 1TIKA 3L1JA 4GD3Q 4MKHA 4RQTA 4TVKA 1Q14A 2YC4C 2X76A 1V41E 1B6TA 1X0XA 1U99A 2B61A 4I4TB 2C31A 2QTTA 4WADA 3ZHCA 2GD2A 5DK6A 3R8CA 5BN5A 4RF3A 3T5MA 4FFMA 4M9RA 1FK8A 4Z4QA 5LMZA 4DR1B 3FTEA 5D3MA 1CWUA 3RYIA 1BDIA 4DLRA 2BRUC 3C3AA 3F5MA 1EFCA 2R4UA 3ETJA 4EY7A 2TRSB 1R0WA 1A82A 1CS0B 3KO8A 3I2JA 3P19A 4MX8A 4DZTA 2VS1A 3X1DA 2B2XA 1OAKA 3RFCA 3OHPA 1CSEE 1NY5A 3BIOA 2R25B 2A5FA 2Z56A 4OMFG 4RK4A 3RB8A 3H42B 1K7YA 1ZM9A 1YQTA 2FOIA 4Q3CA 5B1DA 3KUXA 4Q82A 3SQMA 1CXZA 2BFFB 3CW2A 4HLDA 1LW7A 2ZSDA 1ODTC 3EUEA 2RKBA 5J59A 4CIAA 5LZ2A 1PK8A 2DERA 3ND8A 4GP9A 5D86A 3C8UA 5ALEA 3TLJA 4AROA 1MQ9A 3EDCA 3KZOA 2FLWA 2C7RA 1J0DA 1JB1A 4X1KA 5J2TF 5K0FA 5B58C 4O1MA 3CWZA 1U7XA 1GJRA 3UT0A 1D4OA 4R68A 1AY0A 1H2XA 4KXWA 3D54D 2CHFA 2HD4A 2QD4A 4NC9A 3TXYA 3K20A 4Y3UA 4C2BA 5HTOA 3AM3A 4DMFA 4GM1A 1FP7A 1PQ4A 2DY0A 4FNAA 4F97A 4AJIA 2COUA 4GX2A 3ZLVA 3MCVA 3LQQA 2C3MA 3WMWA 1H2EA 4I5IA 4BNJA 2DHDA 3B78A 2BEWB 2G83A 2QP3A 3V5NA 2XT0A 4G86A 3SZLA 1U31A 3MS2A 3UMCA 2DPMA 4I5DA 4EGJA 3LBYA 1RACA 4MUIA 1VMIA 1P74A 2O57A 3FYDA 3LWDA 3OZTA 3QLVA 4Q4AB 4BB6A 4DREA 5MGBA 4R05A 2VZ9A 1FZQA 1N5IA 1W87A 2OL4A 4KAXA 1JQLB 2C5FA 1KDTA 4L4XA 4F85A 5ALUA 3EPRA 2NZJA 4EUKA 1OLSA 4GBED 5AJYA 3PC7A 4JB3A 5IC6A 1S9HA 3K0SA 1RMYA 2IXDA 4IWYA 3DFIA 3IT2A 4ZO4A 1KVSA 1MDBA 2BFEB 1AS3A 4Q4AA 3U7QB 3ZWMA 4YRKA 1P7WA 1J8QA 5H81A 2IYFA 3HN6A 5F9MA 4ZVKA 1COWD 1OGYA 4BUJA 2CN1A 1UDAA 1U0FA 1FFSA 2QD5A 3ZDDA 5JE8A 3MHPA 2GK6A 3IXQA 3EX7C 4JL5A 1LCIA 1L4FA 1PQUA 2EAUA 3JQCA 3DZBA 4Z9FA 3S1AA 5EWJA 2G63A 3LZCA 4HAXA 3V1YA 1O0SA 4TWJA 2ZIUB 4C7BA 1N9GA 5JIBA 5KYYB 1J70A 2O3QA 2PD4A 3G0BA 2N75A 5AIAA 5I48A 1YS2X 2YFQA 5F7JA 4OAOA 1ZM2A 1ZNXA 3KJHA 4U2CA 1QAMA 1U9ZA 1JALA 1ZUNB 3H86A 2Y9MB 4JVOA 3TR5A 2YBEA 1GPYA 3PPIA 5H3CA 1WTAA 5I7EA 4EY4A 1E1QD 2RHTA 1WCIB 2GX6A 1FSFA 2FSHA 2QRQA 2VZ0A 3EA4A 3IEXA 4I66A 4Y9TA 4CQMA 4F3KA 4PQFA 5M34A 2IYXA 1LX7A 3HUTA 4K9KA 4FHFA 3FNEA 3OJFA 4UU8A 5FH9A 1IHUA 1TTTA 1GLGA 4UFPA 1CQPA 1P31A 4YMIA 4W6ZA 2ZSJA 3IP8A 4RABA 1FYXA 1LXCA 5CT5A 2PRKA 1FTWA 2F2TA 2YINC 2M6RA 3TUZC 3T3PB 5ENZA 1V5GA 2BGKA 4V3CA 4G8JA 2VA9A 1RWPA 4O02B 2Z2ZA 3FTDA 4DGSA 2CDCA 3L7YA 5CDGA 3BHJA 2YX1A 2B4RO 3RRNA 2UXBB 3LE8A 4GSYA 3UHOA 2M6KA 5AW8A 3PNMA 1TKAA 3WLTA 2O7VA 1Y9AA 2KJQA 3JD3A 4HDCA 3S70A 3WWDA 5IZ4A 5JCOC 2XDAA 2WHQA 1H65A 2NACA 1NOJA 3BWDD 3UW1A 3MILA 2ZIFA 4KSYA 2R1VB 5K8CA 4RO0A 1FX0A 3D5QA 1NDHA 2IV7A 2A84A 4TYQA 4CTKA 2FUEA 1Z3CA 3EHEA 3D3NA 2FWNA 1Z25A 2XMQA 3IKLA 3QVMA 3V4OA 2QQ0A 1H22A 1KP3A 3U60B 1O1YA 2Y4OA 3AY0A 1XNGA 3I1JA 3CJRA 3N8HA 1GPLA 4U2FA 2YTZA 1FFHA 1DV2A 1LI7A 4MR9B 2C99A 4FONA 5GZ6A 2PWZA 3JATA 3QOWA 4H35A 5IBRA 2H2WA 4P8RA 5CJPA 3CYFA 1L3BA 1N2ZA 3OKAA 4XTCS 3GPDG 4WX2B 3AH8A 4NIMA 5K7SA 2O5RA 1Y4ZA 4TKVB 4XM2A 1F06A 3WBFA 1Y4AE 1DIRA 4MP8A 1ADGA 2AR0A 1JFVA 5ESXA 1C2TA 3CEHA 4RVSA 3UGKA 3KETA 1YGPA 5JI3E 3M49A 3QHPA 3CZCA 4YRTA 5E4FA 3RROA 4FC6A 5EZYF 2WK1A 1RCUA 4HGQA 5AHKA 1SPXA 2ZSEA 2FMHA 5JYEA 2UUAB 4I1SA 1AGXA 1I9GA 4RGBA 3E0XA 1Y8ZA 5I7HA 1QMPA 1XWIA 3LYLA 2PCLA 4HRAA 1AV6A 1M54A 4XSHA 3UBMA 3C4VA 2A86A 2X9GA 4UM8B 2Q4EA 4XCVA 5EA2A 3RFVA 1E1MA 3WSTA 3QLUC 1QDLB 1E4EA 1MH1A 1VL8A 1GL6A 1R5OA 3HEAA 3LY7A 4WPGA 5EJ8A 2IIPA 1FLVA 2DFKB 1QXSA 4A16A 3MFYA 1Q74A 1TW3A 1QWSA 1XZIA 4UDYX 3WVNA 1R8YA 2O3UA 3I6QA 4TTPA 1KH3A 2J4DA 2OFOA 4HZGA 4HX9A 1ILWA 2QUIA 3EVBA 4ZPJA 4AQYB 2V54A 1JNYA 2ZWMA 3K0KA 1R5NA 1TZBA 3L06A 4D0RA 2E21A 3B1WA 3GRCA 3W4JA 4AT1A 1UXIA 3EFOB 4IVRA 1RI3A 1KEKA 4F12A 2W6PA 6ADHA 4XIFA 1H5UA 2DPYA 3U4AA 4BYGA 4B3SB 2FFHA 4U2GA 1VFPA 5IJ9B 1EQAA 3ZOZA 2RKWA 4WY8A 3AP2A 1G7SA 5JRZA 2VO1A 4U6NA 5COAA 2JLSA 1IVYA 1S0UA 1WOMA 1VI6A 1MGPA 1B1CA 5TB5A 4ZRNA 1APBA 2Q0SA 1UBTS 3QNWA 3DB1A 4NU0A 4XIGS 1FJGB 4QXMA 3LM8A 3ZWOA 1J07A 3LWBA 3QF4A 4TSRA 4XX0B 2FEPA 1F38A 5CG1A 1XZBA 3AEUA 3V32A 4C30A 5KX5A 4CL3A 4BLSA 4TKUB 4EJ6A 5BUSA 3JQBC 4ZREA 3UG6A 3AG6A 2DWQA 2FPLA 4CCAA 3NU1A 2JJ1A 5E2BA 3UA4A 1OH7A 2GPJA 1RXWA 3GLGB 1H69A 5HXAA 2BCJQ 5CT9A 2C9OA 1EKXA 5ESDA 3TFQA 4F4UA 1DC6A 5K6AC 2GN6A 3B60A 2HU5A 3E4DA 1YTUA 1E5DA 3KM0A 4BHTA 2GARA 1BU8A 3ZWPA 3HDGA 1A04A 2DFPA 2IPLA 2P1RA 4L0MA 4Q3BA 1GPH1 2K2WA 1GV0A 1YQEA 3EXEB 3GBSA 3VR3A 4LBVA 2QU8A 3NYIA 4US1R 1HZZA 2Z2XA 2R6GA 3DC2A 4R69A 2HZBA 2AJDA 1EFVA 4YDHB 2OBLA 4LFCB 3A2KA 1W46A 3PENA 1NY6A 4MLCA 1FXUA 3PD1A 4Q4LA 1G8YA 2XQVA 3HNPA 3FYTA 1H5QA 2BM0A 5FA5A 3TTYA 5KOJA 1UDBA 3K0FA 1W88B 4PZAA 1BW9A 2QJOA 3RUAA 1CR2A 2XMSA 3R5JA 4Y2XA 4AKTA 5LMUB 2QHXA 1ZUHA 3Q0IA 2CNNA 3PZBA 2RI0A 4JJFA 4KX3A 1L5MA 1EB9A 1BMQA 4D9BA 4BNDA 1H8EA 2IY8A 2WJHA 3WAJA 1R15A 2W8BB 4IV0A 4L4UA 3HSSA 5AM3A 3ONNA 2ZYDA 5KVCA 2GTIA 2D74A 3OPYB 3K9HA 2BTEA 1IXKA 4Q12A 1VSUA 2B9VA 3EGCA 2AZ4A 3FZEA 4AQDA 2XPCA 2F8SA 2WUEA 4A8JC 3WDKA 1KTIA 2QVBA 1GDTA 1UDRA 4MRNA 3EXG2 1SCBA 2RBKA 2ZFUA 1ORHA 2JATA 2QPOA 1A96A 1TZCA 3MJVA 2WYUA 4AJLA 3IA2A 5B3JC 2RHLA 1HMYA 1DAMA 2WD7A 4G81A 521PA 2O8FA 5KTRA 2AEFA 4Q03A 4FCWA 1KA9H 2BKXA 4K1LA 4BO9A 5K8JB 5H4GA 2DB3A 5CM9C 4P58A 3DOFA 4RIEA 4A0RA 5JO0A 3H75A 4ZHSA 5ALZA 1BYUA 2Q5LA 4O2LA 2ETXA 3ERCA 3FR7A 4JWTA 1Z22A 2Y1KA 2C9DA 3QE4A 2REXB 1VHQA 2I0FA 1BFUA 3JQGA 3V7NA 2W2XA 3O8RA 1OBOA 1TM7E 1VDZA 2C7GA 2HPHA 1ZIOA 5GQSA 3VI3B 2K2QB 2NO7A 1RRPA 1FUYB 4UFNA 2NTEA 1DCMA 4L4SA 3RQIA 3AZPA 1I14A 3JXEA 3SQLA 1IWOA 1CQJA 2YWEA 3R09A 4B7ZA 2V65A 4UBIA 3HDQA 1YOBA 2W6OA 3MT0A 1Q7EA 1BGVA 1X86B 1YIAA 3BXZA 2R8PA 2NPIA 3FVWA 4X1IA 3U5TA 1UMKA 4OFBA 2G3YA 2GAOA 1CUAA 3D6UA 2QSUA 1C3OA 1QGZA 3OECA 3I2GA 3PFKA 4FS3A 2P2LA 2WSIA 1CP3A 1BGWA 4FYKA 2BZ0A 4PC2A 3HXLA 4Q1EA 1AKYA 1UC8A 3A9TA 5DP1A 3B82A 3SKYA 4I6JA 4Z0NA 1TQHA 1DFIA 2GJKA 3LPLA 3G79A 3NTUA 5G1OA 3UPTA 4BB9A 2YR0A 5K2OA 2OSVA 3ICWA 2V6GA 4H16A 1XV5A 4OJMX 4CQLA 1RHKA 2NU6A 2YY5A 4RVUA 5JO9A 3LLMA 4AJ9A 1SG0A 5EHGA 4G41A 3D2CA 1UFQA 2BHNA 3FIUA 4R8SA 5ITVA 4BDTA 2J46A 3S1SA 1FSPA 1JDJA 3HVUA 4RHTA 3FDXA 4KQXA 1ISFA 1IN5A 5BT9A 1EJBA 4HFMA 2BFEA 1RWQA 1I10A 5TF4A 4LMBA 5EPOA 3GLIA 1K2VN 2VCHA 1VA4A 1MFZA 3AVQA 1T1GA 3DO6A 4O25A 1L6RA 2X9QA 3DLAA 1CRWG 3L8CA 4ZOCA 5IKOA 1ATZA 4E2YA 1PSWA 2DBZA 3DT9A 3QI2A 2DETA 2GFHA 4KXYA 4WRRA 4E7PA 3NKFA 2GYVA 3LX8A 2GYYA 2HWKA 3HFJA 3VI4B 2YOGA 1EX7A 4C22A 3KVOA 1QQ7A 2YS6A 3EBLA 5LA6F 3ZI0A 1AMOA 5A0TA 2LWIA 5EMLA 1FQJA 1SCUA 2QT1A 4QREA 1D2CA 1SGWA 2QEQA 1MAVA 3KEGA 3P2EA 5JEDA 4U8GA 1UM9A 3CIFA 5DGHA 1PJTA 2CVQA 1PJCA 3DLPX 3MWYW 2WMYA 3N0XA 5B7PA 2HA6A 2R1ZA 1RM5A 3KYJB 2QZ9A 4X71A 1KI4A 1T9ZA 3TH5A 1HDXA 1YCFA 2CMHA 3OIWA 1DBRA 3IVCA 3WTCA 3K72B 1HY3A 1OYVA 1YE3A 4MWCA 1FDTA 3PVSA 4IJ6A 4QQRA 3N2GA 3G82C 4JH0A 3H9UA 1M3SA 2FSVA 5FNVA 4ZTBA 4YRGA 5C7YA 4C03A 2YWDA 3BF7A 2X1VA 3RADC 1I0ZA 2AH5A 1QM5A 4H7DA 1U5BB 1JYFA 1QWOA 5CMLA 1WF3A 2RARA 3PI6A 4G1CA 3EOBI 5M5BA 1WA5A 1KAHA 2D3WA 2JI8A 2J5RA 2WWGA 4JL8A 1CRZA 4MW4A 1E61A 1XDZA 2MDTA 3EH1A 2BSQA 4G5RA 3L6UA 4OH1A 2DKFA 1YCGA 2IL1A 2IXAA 4RL4A 2F3RA 4A0HA 1KJWA 1PNVA 2OYRA 4NRDA 4XI9A 1CJMA 5EMNA 5K0GA 5DH9A 3DKIA 4GVXA 2ZITA 2W70A 3ENWA 1XEXB 2IXBA 1DO2A 1Q0UA 4AN4A 5JISA 1PSDA 3TM4A 4WXRA 4HDOB 4B8YA 4DQXA 4E5UA 3AI2A 1I24A 3I8XA 1XHFA 1ND6A 5K8IA 3O4FA 5ECWA 1J8VA 3BZBA 2HH9A 3FFXA 2O2IA 5KTKA 1X38A 4R0VA 3S3TA 1HE2A 4UAUA 4V38A 3NASA 3ER9A 2GFIA 2E5LB 4F46A 1X1BA 3L7JA 4GO1A 4LFAB 3T9AA 3E9CA 4IL5A 4L07A 1JTFA 4IEEA 3ZX4A 1B0UA 5EXPA 4OQQA 3K2EA 5LLDA 2CVPA 1QQAA 4GI7A 2ZS8A 1EG2A 3D7LA 1FTYA 1UC4B 2J5BA 1T1JA 5B1IA 3OZCA 2HL6A 1EDEA 1TM4E 1M34A 5AKJA 3WWYA 1U9IC 2BY4A 4X64B 2GPNA 4HLUC 3MQ2A 4EVSA 1ZCJA 2GGSA 4DT1A 1P3JA 2FXVA 3ND5A 1UANA 5FO0A 4RULA 1ID1A 3RIMA 4R5MA 1NHGA 1J00A 3ADKA 2FRDA 1ZPDA 4IY1A 4YJHB 3E9NA 4M2LA 2HSJA 3ZE2B 5HZMA 2YIMA 1W25A 3BMOB 3ELDA 3ZK8A 3UMBA 4Y30A 3GWZA 1K7EB 4C78A 1WBBA 3U17A 4D4KA 2HCTA 4BWFB 5HX7A 5AVWA 4LE2A 4XR4A 1RQNA 4KRYA 4FQ8A 4MMZB 4J03A 3RVRA 3VHLB 2QSYA 3ZQ6A 4AL4A 2MSNA 4B7UA 3O5AA 1TAUA 4RMJA 2GN9A 2ERCA 2P5UA 1WD7A 2AIRA 1DJPA 3QVGB 4TMXA 3GYGA 1EE1A 3AEKB 1SUAA 3JQ7B 4HEA6 1JWAB 2UZ1A 1U0GA 4FYWA 3RI3A 1QJ4A 1XRRA 4AMYA 4TROA 1Y9JA 1U28C 1CDDA 5HIAA 3QMWA 5E1DA 5KTPA 2WAAA 5BQ5A 4CMGA 1C1HA 4MVYA 2O3SA 3OICA 3EYAA 4D9IA 4M1YA 4XUGB 4TL7A 1J99A 2B4AA 1R8QA 5JVDF 3Q41A 4FFLA 1O6GA 3HXPA 4PPQA 3S2GA 2HFJA 1M5TA 2VAVA 4YCDA 4F21A 1JMYA 2CUTA 4Q9DA 1B42A 3VNAA 3S8YA 1Z45A 3PXAA 1DPGA 5FV4A 2ZRBA 1XCMA 3OIGA 3PGLA 4G5HA 1DKMA 3HYCA 4FD3A 4GVLA 3Q0EA 2GCNA 4CJXA 3LS2A 3HJFA 4MUEA 1OZAA 4DS3A 1IMJA 4G0YA 1ODKA 2OG1A 1M1YE 2CKMA 3AL2A 5AI0A 4JVMA 5IXSA 1JILA 4YRFA 3T95A 3AF6A 2TSYB 3ED5A 3I9MA 4CLOA 3F9RA 1ZVKA 3NC4A 4KTTE 3QPWA 4OI2A 2P9GA 3U7QA 2XWBF 1LK7A 4C7KA 2AGVA 2YHSA 2MWMA 4ZYXA 1ZVJA 3R0XA 1XPOA 4X60A 3MJRA 1NUTA 4LY6A 4B6QA 2X41A 4WKCA 2AVNA 3B1FA 4OV6B 5EMMA 3UY4A 1DX4A 5FDFA 2AI3A 3RS0A 5A9SA 2RBGA 4IDAA 4YRMA 1DX6A 1JDPA 1SQSA 1UJCA 4GWGA 5CP8A 1SELA 5KVQA 5A3RA 2OZEA 2HIHA 4TQAA 3PFWO 2YQ5A 4HQ6A 2ZE7A 5J23A 1T6BY 3KOWA 2D5BA 1WXFA 4G8BA 3CKKA 4CT4B 2VEOA 4NV1A 2DQZA 1AX9A 1Y5NA 5COQA 1D8AA 1TCBA 2OZVA 3DBHB 3KZ1E 4WKPA 4YMLA 3AFGA 4EGAA 1UPTA 2BL4A 4Z7OB 2WWYA 5LQSA 1JLSA 1KIAA 1F5SA 4I19A 3KJQA 2Q6OA 2V7QD 3E7WA 3LA8A 1NVBA 3LP6A 4GOMD 4J7XA 3Q7PA 4XFDA 3GJ8A 5J63A 3TVTA 1S9DA 5K4HA 5IUJC 4JV5B 3QUTA 2W58A 3KKLA 2VT6A 2A9RA 1F20A 1NI4B 3I5MA 3LRTA 2CXXA 1C4OA 2HA0A 4ZQBA 4V0ME 4ARZA 1AG9A 4CM8B 4GR4A 2ES4A 4CLRA 3AYZB 2GD6A 3AUUA 4KGXA 4KQ1A 1WMSA 3QUCA 1DTEA 4WFKA 1ZOPA 1YZLA 4BTVA 1V0JA 1W5AA 3PF9A 1XU4A 4KITB 3FUXA 1GADO 2I87A 3RG8A 4PLGA 2C2KA 2P2CA 3CUVA 4HWGA 5FF9A 1U3CA 1VIMA 3DH0A 3N5CA 1X70A 3P5SA 3RJ5A 3LSTA 4N0DA 4KAAA 1TU4A 3NBQA 4QOEA 1I1QB 2AVDA 3LQRA 4GGPA 1BGXT 1EH5A 4Q1AA 4QBHA 4WLVA 2HSEA 4Y9UA 3TDNA 3TNLA 1OH5A 3E2PA 4YNBA 4FHGA 2VT7A 3IIKA 1K7SN 4X91A 1ZEMA 1DI0A 1XDUA 4EKYA 1FLDA 3LCCA 1M0WA 1ZU4A 4Q0MA 2JLVA 3OE7D 3EPJA 2R1TA 2ORIA 2VK2A 3AW8A 3CVJA 4HZUA 3UHFA 4PCUA 3O9MA 4YXWD 2VKTA 1JHPA 1M8FA 2FPSA 3BQMB 4BFXA 3KQMA 1PJ3A 2GN8A 2YHAA 3A37A 3DL7A 4HC4A 4U2EA 3UTDA 4ITUA 4BLUA 4MQBA 1IOWA 5IKPA 2LZ0A 5CURA 3ZE1B 1UOEA 3MTBA 5I9BA 2GVNA 4H7EA 5EXXA 2V74B 2E18A 2YWGA 3HHPA 3M1IA 1TW2A 3NGMA 1O96A 2ZRIA 1FNMA 3PUKA 2XUDA 4O3MA 1J97A 1TUBB 1NQXA 1ZBDA 2B5WA 2CMFA 2PKRA 2B5OA 4JBNA 1Y37A 4KRGA 5AHXA 5G0VA 3ZTYA 5IC4A 1YU9A 2GBPA 4I6EA 4LXUA 4MVCA 1EXVA 3L49A 1D1TA 1DQRA 2HSZA 4H1UA 5IN5A 2YXPX 3OM1A 3CUEF 4TTAA 4PAMA 4J91A 4CLXA 5IYZB 3MCTA 5TQ0B 3KUCA 3E18A 5KNBD 1LK0A 3KCQA 4I2NA 4YAEA 1XYGA 2VJOA 1W49A 2YXNA 2WPNA 2C2HA 3N75A 3SF8B 2DTXA 4BWVA 4DQVA 2WTUA 1ODCA 2D2FA 5BNZA