1HUQA

1.8a crystal structure of the monomeric gtpase rab5c (mouse)
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
164
structure length
164
Chain Sequence
ICQFKLVLLGESAVGKSSLVLRFVKGQFHEYQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNTDTFARAKNWVKELQRQASPNIVIALAGNKADLASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RAB5C
publication title Structural plasticity of an invariant hydrophobic triad in the switch regions of Rab GTPases is a determinant of effector recognition.
pubmed rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 55
structure length 164
sequence length 164
ec nomenclature
pdb deposition date 2001-01-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1huqA00
3LBNA 3MRSA 5C46F 5FUYA 1QHNA 2HJGA 2JLWA 1TU4A 2ORIA 3TW8B 2C04A 3SDZA 1QBKC 3ZVMA 4B3XA 1F60A 3AUYA 2C98A 3AVOA 1H8ED 3DKVA 1NJGA 3R9XA 3CNLA 4HAXA 5JFGA 3QPUA 2OAP1 4HAYA 1IN7A 3HYRA 4M1SA 4BEJA 2ZRJA 4XD7A 2BBTA 3RWMB 4D4JA 3E70C 2O8EA 3DHWC 4RD3A 2QA5A 2FSFA 3Q7PA 1GNRA 5HCNA 4OI0A 1R10A 3DPUA 4OQXA 3G0HA 1Z83A 5E7IA 2WWGA 1L2TA 2ZSDA 3DKPA 1QDEA 1W0JD 4P4UA 3GLFA 2QMHA 4DCVA 3K0FA 1JBKA 3BBPA 1CTQA 2IX3A 5C1BA 1AS0A 3NH9A 2FG5A 3CRQA 3RSLA 4Z1MD 1RRCA 4C2UA 3THXA 5IK2D 3Q5EA 2VP6A 4TZ6A 1XPOA 2CNWA 3NBYC 4U00A 3N5CA 5F2EA 1G7TA 2CK3D 3U61B 4Q9IA 4B35A 1ESNA 2FFHA 2RGDA 1R5NA 1WMSA 2HT6A 1XZQA 2WPDA 4OQNA 3F8TA 3BB1A 2OHFA 1GL6A 2ZRGA 5CITA 5L3SA 5L3QA 1OXXK 5JZVA 1T8UA 2BDTA 3UMSA 1FMLA 4H1UA 4Z54A 2REXB 4K8OA 2CXXA 4C30A 4O2RA 4W5WA 2OSBA 5KHOC 5DO9A 2H16A 4Y0AA 1D9XA 4HLQB 4NCHA 1LV7A 4DSNA 1R6BX 3SR0A 1T8TA 1HEIA 2UZIR 2J0UB 1UEIA 3U7FB 1FZQA 2UKDA 4URWR 4M1MA 2RHMA 1IN5A 2CE7A 5KNCA 2O8CA 2PT7A 5EE0A 1CIPA 4B3FX 3RS2A 3WYGA 1G19A 2R6AA 1DOAA 1UF9A 3K0AB 3LO5A 4LDJA 3EG5A 6Q21A 2JA1A 2HV8A 4DLYA 1J2JA 3PV0A 3RS5A 4BWYA 3LX8A 4LUCA 2QN6A 3QXHA 2W6JA 4G5OA 3ZLJA 5CM8B 2V3CC 1F2UA 1W48A 5J4VA 2IYXA 2PH1A 2R8RA 1KAOA 3W34A 4RD0A 2ZRBA 3ADCA 2CDNA 4KITB 2J9RA 1F3OA 2XZLA 2ZQ5A 3EPJA 5KNDA 2PLRA 4DZZA 2ZREA 3A4LA 4AKEA 3IO5A 3IQWA 1XCPA 3KUCA 4WZBE 5FUWA 3DOEA 3ICEA 4DVGA 1QHYA 1E2IA 1XFAA 1E94E 1TNDA 2R6GA 4PZLA 1FPMA 1E2LA 3L0SA 2QORA 4BECA 2UZ3A 3QXXA 1E4YA 1TL7C 1ZP6A 4GNKA 1JR3E 2PLFA 4KFTA 4JLOA 2RGNA 1T3LA 4PC7A 3ASYA 4FIDA 5EP2A 4B2IA 4EQ6A 5P21A 4LYHA 1N25A 3VKHA 5TXGA 4CEIA 3L2OB 1Z6YA 2EFCB 1HQYE 1PLLA 4HAWA 5FPYA 4LJ9A 3ZGXA 2JLRA 4LX0A 4C0LA 4Q21A 2ZJ2A 3KJIA 2ZJZA 1SVIA 3J81k 4TYNA 3C15C 3WMGA 1SKQA 4PHHA 2P6RA 2ZS7A 1JR3A 3RRNA 4D26A 5KTYA 4OQMA 3MGCA 3IIKA 1XMIA 2J46A 4PQYA 3LD9A 1Z28A 2EWWA 4PPQA 3LBIA 2ZI5A 4CT5A 1CEEA 3C5HA 1XPRA 1E9FA 1ZNZA 2ZRHA 4LGMA 3TMKA 421PA 2QGNA 5D3QA 4BRUA 2IS1A 2V7QD 3PUVA 1GWNA 2R44A 2WKPA 5F3WB 2OFXA 4JVNA 4Q1CA 3IHLA 3K9HA 4JZKA 4C2TA 3W3ZB 1FNMA 1BH2A 4MDFA 3EZ6A 3HR7A 4X8HA 1OHHA 1U90A 4R98A 3I92A 1Q1BA 3CX8A 4DEXA 4CGZA 4C0QC 3LRPA 3MUFA 1RRPA 1XD8A 2ONJA 4KBFA 4UXIA 1ZCBA 1MO4A 1D6JA 2AD5A 4O0MA 1XJ0A 4C9BA 2ZUBA 3CNNA 4M53A 1ZBDA 2GJ9A 3JVUA 3RHFA 5CM9C 3T1VA 1GP2A 3BAFA 4KFUA 4Q1AA 4Q4AA 3AKCA 1NRJB 1S9DA 1XEWX 5GJVC 3GCGA 4DUGA 4PSVA 5JSZA 2ZUCA 3KTAA 4KFRA 4OQFA 2GJ8A 1XP8A 2WSSD 4JKIA 3TH5A 4TQ9A 2QAGC 3TNFA 1U2RA 1ZD8A 4BLTA 1P61B 5FOSA 1D2NA 4UNSA 2ZU0C 5E7JA 3MFYA 3NWJA 2G6BA 3RANA 2VL7A 3AQ4A 1H8HD 4EFMA 3AF0A 1YU9A 2C99A 2A5JA 3FMFA 1WP9A 5SZIA 3LW7A 1YZTA 3QBTA 2JJ1A 4D0GA 2FF7A 2QT1A 4RSGA 5C4MA 4B6EA 2VO1A 5K8LA 3BFVA 1TUIA 4A92A 4EKDA 2R6DA 3K0CC 4KYUA 1ZW6A 3TGPA 3KXIA 3IEUA 2QSYA 2DWPA 4GPTA 2R6FA 3ZZTA 2OXCA 1OPXA 1ZNYA 3GJ6A 5JSZB 1UKEA 2ERXA 1H8HA 1OXUA 1KGDA 2QE7A 2BMJA 4KBGA 2YV5A 4CIDA 5CB8A 1SQ5A 2OBNA 4OKSA 4Q1BA 2HCBA 4RFSA 2HDNB 4MH0R 4QG7A 2ZJAA 4LHYA 4DLSA 3SE0A 2F1IA 3HJNA 1YZUA 3P20A 4Q9KA 4WZAE 3AP3A 3C41J 3NC1C 4LBWA 4YONB 121PA 1M7GA 1ZNWA 1KNQA 4G5SA 4A6XA 2XSZA 2JDIA 3OIWA 1RJ9B 2BEKA 3U5ZB 2F3RA 1GNPA 2WWXA 4A6PA 1J70A 4D25A 4LI0A 1GNQA 2G83A 2Z6VA 4O2LA 2HF8A 2WWIA 2ZE8A 2NMVA 1OF1A 1IQPA 3EXAA 4B3BA 3QKSB 2ZJYA 3SOPA 1E79A 5FOWA 1SKYB 2C9CA 1KHTA 2IS6A 3I1FA 1AS3A 2A5FA 2RH5A 1AKEA 2QBYA 4M8NE 3T34A 1EK0A 3PQCA 4V0OA 1DG3A 2ERYA 2W00A 4L9WA 4N3NA 4OI2A 4MRNA 2ATVA 2OFWA 2RGAA 1JB1A 5DISB 1T0JB 3CNOA 2NO1A 1U9IA 2AL7A 1OFIA 3NBZC 5JHHB 2IL1A 1Y3AA 3JZMA 3CRVA 1ZIPA 3K8YA 3C4JA 1MABA 1OIXA 1KSHA 2ZROA 3C5CA 3BB4A 3TUZC 4FCTA 2X1VA 4LCBA 4RKFA 3SEAA 3WHLA 3R20A 4B74A 5KO2A 3QPWA 1W36C 3U44B 1IY2A 4D4KA 4MA4A 4ZV4A 2O8BA 1GG2A 4PQFA 3H86A 3X1WA 2VIIA 3CF6R 2H57A 3P26A 2ANCA 4HZUB 1Z0JA 4NYIR 2F1HA 1P62B 1SVWA 1ZIOA 4GFDA 4OYHA 4OK5A 5HE8A 5C18A 3CPEA 1VG8A 2YWEA 1IJEA 3CWZA 2MMCA 2V54A 1S1CA 2AKYA 1TQDA 4HLUA 1AJEA 1CKEA 4QGFA 3GJ5A 2YOFA 1G7CA 4MGKR 4MKGA 1TF7A 4PO8A 4ZDWA 2OCYC 2P5TB 4LHXA 3THYB 2GKSA 2O8DB 3ND9A 1E2GA 5LB2A 4BASA 4OHVA 3ZZUA 3U3JA 4A0GA 2XXAB 4M9SA 1F2UB 1NLYA 4I99A 1UKZA 2RKOA 4XIGS 2HCJB 2KE5A 1LS6A 4NP6A 3GLFE 1XXHE 1JECA 4KODA 2IC5A 1R2QA 1EWRA 4Q7LA 3QVUA 1E0SA 3GJXC 2D7CA 2QGZA 3NHBA 5JMTA 1L7VC 4BUJA 1UEJA 3ZS9A 1E2DA 2FZ4A 4TYYA 4P0TA 1E9AA 5G40A 1J8YF 3P4XA 5JRZA 1FTNA 1E1RD 5JS7A 2GBLA 4NYMQ 1RW4A 1D5CA 1VYUA 2NPFA 5SZHB 2CJWA 2C78A 1ESMA 2AXNA 5AJXA 1KK1A 3PXGA 1CS4C 4A2QA 4D4MA 3HYTA 4ZDIA 2GEDA 2IXEA 5CIQA 4HUTA 1W0KD 4QOSA 3UMFA 2KJQA 1NVVQ 1FOEB 2ZE5A 3MJRA 5HKKA 4II7A 1N5JA 3AP1A 4RCZA 4FWTA 4BLRA 4HAUA 3UG6A 2C03A 4BQSA 2BKUA 5FOXA 5LPNA 1W5TA 2BV3A 4A82A 3VMFA 5BQ5A 1KI3A 2REOA 3B13B 4JIMA 3WP0A 4PHGA 2BVNA 2PZFA 2YVUA 3FPAA 1VHLA 4Q7MB 2ZJ8A 2VEDA 4PSKA 5JWHA 3IILA 3BOSA 1GRRA 5EUQB 4D0LB 1YQTA 2J0VA 3MWKA 5CLQA 1ZM3A 2PMDA 4ZIRA 1KK2A 4ARZA 1U8YA 4OHZA 1CJVC 1C1YA 1G9XA 4WZ6A 4IVPA 4BLPA 1VG0B 3L0OA 3BE4A 1OXSC 4LYFA 3I4LA 4QM6A 5L3RA 4X8MA 5H8WA 1JPJA 3SC3A 1PV4A 4RZXA 3NDBB 1JQJC 2EW1A 2G1JA 4PHTA 2CCGA 1KDPA 2ZI4A 5UKDA 4YQFA 5JEEA 2D62A 1LTQA 2ZS8A 3FMIA 2JJ1D 1ZC3A 4NCJA 2X19A 4TMZA 1XF9A 4DLVA 4Z1MA 1TF2A 3L0IB 4NHOA 4KO8A 5TARA 2ZTSA 5AJZA 1YZLA 2YWHA 1W0JA 3I3SR 4LOAA 5ELXA 1U0LA 2B92A 3GJ8A 3QKUA 4QHTA 4L4UA 4LK2A 3HP1A 4Z8YA 5E4FA 3OE7D 2CHQA 3SN6A 4BLQA 3ZD6A 5D3MB 5AJWA 1EGAA 2CNWD 2IF0A 1OW3B 2ZJOA 5JECA 1P2SA 4F92B 3THWB 1G3IA 2ODEA 3QY0A 4XSGA 1Z0DA 3IBYA 4NE2A 1E2KA 2GCNA 3MJHA 2C2HA 1N0UA 3OF5A 3SQWA 2EVWX 3WP1B 4Q1FA 4W5JA 4LHZA 4JJZA 1C4OA 1T4GA 4DSOA 1W4AA 3RNLA 1NMZA 2ZRIA 2PZGA 4BFUA 2QRZA 2H92A 2P3SA 3AKYA 2AK2A 1P60A 3TAUA 1W47A 4A9AA 1OIVA 2EFHB 2NQ2C 3TUIC 2MSCB 5DE3A 2GZDA 5KDLA 2B7CA 1COWD 1XD9A 3X1DA 3PCRB 2FSIA 3EIHA 2LCFA 3U6KA 1G291 4EPTA 1E9CA 5JWOA 1A82A 1J8MF 3W9YA 1PJRA 2PJZA 5FBQB 2ZRKA 1N6KA 5KDOA 3EX7C 1RYFA 1VCOA 3RABA 1CR1A 1GRNA 3PG5A 4QM7A 3MSXA 1IBRA 4I81A 4DIDA 3UK6A 3SJBA 3O8CA 4A0HA 4F4CA 1QHIA 3VX3A 4X8OA 3B6EA 3VX4A 2QTFA 1EFCA 1XTKA 4V0ME 1N2CE 4ZCIA 4LZZA 3AGPA 3GLIE 3DDCA 2VHQA 4LSGA 1XDBA 3NXSA 3X1YA 5FR1A 3Q8XB 2BMEA 4IDHA 4EPXA 3GEHA 4IXMA 3K70C 1KMHA 1ELOA 4RVCA 1JPNA 2RGBA 2NO6A 2VLIA 4F7WA 4JKYA 3VU9A 1SKYE 1EX6A 1K6MA 1Z08A 2QBYB 2OCAA 2Z5FA 4OHWA 1SXJE 5C2JB 1N5IA 1KO1A 4ZDJA 2YKGA 3T5DA 1KSJA 1TEVA 4UNNA 4XTCS 1R5OA 4QHSA 8OHMA 1RC8A 1FTSA 1Q0UA 1YR9A 4M9ZA 4Q03A 3TSOA 4TMXA 5K8UA 4V02A 1CP2A 1QHGA 2WMNB 2ZE7A 4PFSA 2R9VA 2ZRAA 3PR1A 5CLLA 5KSZA 2H8KA 4XWAA 3WBJA 1E9RA 1N3BA 1X1RA 1G17A 1K8RA 3T5GA 1W5SA 2ASEA 3ZH9B 4DCUA 4RFVA 5FH9A 1G8YA 521PA 4B3CA 2XJ9A 2W83A 2IYLD 4MITA 3T61A 1T6NA 4Q4LA 4ACAA 1SGWA 3R8CA 4A2PA 1YRBA 4TQUS 3PEWA 3FHOA 4Q02A 2P65A 3OEHA 1WRBA 1TTTA 1BS1A 1F2TA 1G21E 3AVVA 3AVQA 4MYHA 2F55A 1G5PA 2BBSA 5JJKA 4OJKA 1UJ2A 2QP9X 2VH5R 2ZITA 4JLNA 5G53C 3LXRA 5E7MA 3UWOA 5CDFA 3C16C 5FL7A 1CRPA 3GFTA 1WA5A 1XJCA 3I8SA 2DFKB 2BCGY 3CF2A 4QBHA 4L16A 1OXTA 2BKEA 2EFDB 1AZSC 4JLJA 2G0NA 2W6ID 1G4AE 3K09A 3GLHB 1JR6A 3CONA 1Q1ZA 1OYYA 5TVKA 2PCJA 4M1WA 3EZ7A 1NG1A 5FTMA 1KI7A 2XB2A 4JLVA 4KFSA 3MAAC 4Q48A 1FFHA 4A8JA 3QOFA 1VG9B 1YRAA 1RRFA 2YYZA 4V03A 3CZQA 5KPJA 3BFKA 4PO9A 3GFOA 5DGXA 2B6HA 3IPXA 4LWZA 3QXSA 4LBZA 1SVSA 2FNAA 2KSQA 3BH7A 4MRPA 4DSTA 5HR5A 2QEQA 1SULA 3SHWA 5AUQA 1E2QA 5B30A 5HE9A 2I3BA 1S3SA 2W6IA 5BYJA 3PEUA 2D3WA 3M1IA 2B7BA 1LFDB 1LS1A 1G8HA 3VHXA 1XNJA 2ZSAA 1KK3A 2D06A 1OJLA 4HZUA 2W0MA 2IYVA 1SHKA 2IYQA 4WAUA 1S96A 1TQ4A 5FOUA 2BHRA 1P2UA 2FMXA 3DL0A 2ODWA 1KTVA 1DADA 4YMWA 1ZM4A 4DKXA 1NSFA 1OFTA 3CPHA 5CK5A 1Z6AA 2IEZA 5JHGB 2QU8A 4ERNA 5FBVB 1G6OA 4TT3D 5HTKA 3BGWA 2HYDA 3T06B 1GDDA 2QM7A 1GVNB 3VKWA 3UXMA 1R0ZA 3GJ3A 4JT4A 1T5IA 2IYWA 2G88A 2REBA 2YOGA 1HUQA 4RCYA 4BZXA 1DPFA 1MT0A 4Q7JB 3GJ0A 5IDVA 3NH6A 3QUSA 2IHYA 3SJZA 4YMVA 1VYTA 3NTUA 3REGA 1G8FA 1NMYA 4F93B 4DLXA 5JCZA 3EA0A 5JS8A 3QNUA 5FL3A 4B73A 1SHZA 2VSXA 1Z0IA 2QTHA 1W7AA 4ZKEA 4TLBA 2FH5B 1B23P 4IVRA 4URVR 3SJCA 5M04A 1Q12A 5EUMA 2JLQA 1N0WA 3FOZA 2YINC 3B1VA 4DLZA 2OM2A 4QC2A 1HH4A 1JALA 1KO4A 4OK6A 5IT5A 3REFA 4B32A 3EPLA 1LY1A 1KI6A 1KMQA 3D8BA 1RVDA 2VF8A 3H4MA 5E95A 4LHWA 3MWJA 2XAUA 3W8RA 1WCV1 4AI6A 2WJHA 3DMDA 1I4LD 2QRNA 3AGQA 4G0NA 2RGEA 3OEEA 3FB4A 3AUXA 4LJ7A 3AF4A 3O8BA 4M9XA 4KJZA 4JLKA 4TLEA 5JCPA 5HPYB 2C5LA 4RY2A 4OI4A 4GSYA 2OT3B 2WWHA 3QIAA 4IOKA 3TVDA 5KSYA 1Z63A 5IK2A 2JIZD 2RGGA 5EXPA 3WNDA 3GLHA 4FN5A 4WVFA 1P5ZB 3SYLA 2ZXUA 3THWA 2V8OA 4BFVA 2R65A 1Z0AA 5FUVA 4GI7A 1E0AA 3EWSA 1XB2A 2QENA 1XCMA 2J7KA 3DM5A 2ANBA 4QJ5A 2AKAB 1V5WA 1BOFA 3LA6A 1OH5A 1A1VA 3FE2A 1E2FA 1ZU4A 3FDIA 3KXLA 2IUSA 4IRUB 2WSSA 1OXVA 1A2KC 1JEDA 4HB2A 4ZCMA 2WICA 2QUZA 2RHDA 4KI0A 4EPVA 4HEJA 3NEYA 5JLJA 4US2R 5DSZA 1E2NA 4IW3B 1NIJA 2IXFA 3CX7A 4Q4HB 4CRWB 2VPPA 5F9FA 621PA 1A7JA 5KYKA 1VHTA 1DVRA 1CJMA 2ZSEA 3D7MA 4PQRA 2FDCA 1RIFA 2OG2A 4RKEA 4QJ4A 4O3MA 4DLUA 5EE9A 3RAPR 1Y63A 4HDQB 2ZRCA 2QM8A 1ZNXA 1G64A 2KI5A 4B48A 4JL8A 4JVLA 1II0A 1P2VA 2N42A 2VRWA 4FWIB 3ZJYA 2HF9A 4XVUA 2GESA 2WAXA 5BYKA 4CEJB 3VNUA 4GZLA 1A2BA 1NLFA 3B9PA 2FFBA 3ZD7A 4Z51A 3QXJA 3TSWA 2VYFA 2WTUA 4NDZA 2OV2A 1NY5A 2N46A 2IBMA 4R9UC 3QF7A 1XWIA 2OBLA 5CJ2A 3VU9B 1IY1A 2Q9BA 1GRQA 1XTSA 1OLOA 2V7QA 1KMHB 2YC2C 1X3SA 2BOVA 2GVDC 3X1ZA 1SVKA 4LJ8A 1QHSA 3QEJA 2WZQA 1MR3F 3R9IA 1KJYA 2ZU6A 3CUEF 3FKQA 5EZ6B 3CZPA 2D2FA 1DEKA 3ONWA 4H9GA 4Q9LA 1ZUNB 3GJ4A 1VDZA 2F9LA 3OAAD 4FMCB 3EC1A 4DB2A 1NBMD 4YXWD 2A30A 1MH1A 1HY3A 1DAHA 3U3MA 4NBSA 1E2JA 5EE3A 2V4ZA 4GOJA 2F1JA 4HLUC 4LY6A 1S2MA 5B57C 4PC3A 2AWOA 1BMFA 1YR8A 4B47A 3BD9A 4XTRA 1DG1G 4QJ3A 2NZJA 3H84A 1E2MA 2XNDD 2ZVQX 5G3ZA 3QVVA 3GLGB 1N6NA 3RS0A 4XJXA 1XD2B 5EE1A 1UBCA 1E3MA 2VP2A 4C0BA 1E96A 1TMKA 3RYTC 3W90A 2BIFA 1HA3A 2XXAA 3VQTA 3TR0A 2F43A 4EPRA 2EQBA 3CRMA 1HURA 4IDOA 4M9QA 3THYA 2HLDA 3R7WA 1PUJA 2F7SA 2J3EA 1UBEA 3KJHA 5IHPA 4LPKA 1XBTA 1L4YA 2XTNA 4EIWA 4GL2A 1M2OB 4OI1A 4BLOA 2P2LA 4IEEA 3NIBA 4URZR 1VYVA 3L8YA 2Z4RA 3HPQA 1VECA 4QL3A 1G8GA 3KX2A 2GWHA 3NBFA 4IXNA 4MYTA 2ZJBA 2CK3A 1E1RA 3B7GA 1XXHA 4BEBA 2AWNA 4KSCA 2DFNA 3B1WA 3LQQA 5FFMA 1E9EA 3FYHA 4MQBA 5J47A 3QI2A 2WWYA 2VTKA 4TZ0A 1WQ1R 4G01B 2A78A 4GOKA 4JLDA 4QGGA 5HCIA 3PUZA 1NN3A 1F2TB 1G41A 1GKUB 2DWQA 4PC6A 4YXWA 2DYKA 1X86B 2PZEA 4A0RA 3KQLA 1OH7A 1P75A 5EP1A 3PEVA 2YJTD 1AKYA 2GXUA 1U94A 3LH5A 1E99A 5FPTA 3IKJA 4LC1A 1U0JA 4WW0A 1ZM9A 4XWOA 4GMDA 2IS2A 2BEJA 1QZXA 4P31A 1X8LA 1Z47A 1W4RA 3K0CA 4ARZB 4QBIA 5H1YA 4IKEA 4P3YA 5FI1B 4HATA 3CX6A 3UIEA 4CEJA 1ZYUA 2KB0A 1NG9A 1EFRD 3PUWA 1T0HB 4AC9A 4EDHA 2RAPA 1UAAA 2GK6A 5G3YA 4TYWA 1FX0A 3KL4A 3KQHA 2CL7X 3RRYA 4LRWA 3LY5A 3PVSA 2X2EA 4Q9HA 5FTKA 5DH9A 1Q22A 4HAZA 4FINA 5JBQA 1E98A 1KYIA 2J1LA 1Z29A 1YZQA 1G1MA 4RD6A 5DI3B 2GRJA 2ZRMA 2QQ0A 2MMGA 2ZR7A 3SZRA 5IRCD 3QSYA 1S3GA 1Z07A 1KSFX 4GMXA 5FTLA 1OV4A 3TAHA 3B82A 3M4YA 5TY0A 1GL9B 4QRHA 3T12A 1UBGA 4IJMA 2ZYWX 1Z6TA 1QG2A 4HZIA 3EPHA 1QF9A 1XMJA 2ZRPA 4BPBA 1XEWY 2JGNA 4PTLA 5AUPB 3BJIC 4CF7A 4QBGB 4TL6A 4IFEA 2D7DA 1G3RA 2NG1A 3PUYA 4FXPA 4IVQA 4PHFA 2BCJQ 2QT0A 2JIZA 1BO6A 1J99A 2VP5A 1G3UA 4LHVA 4Q1DA 4D81A 2P6UA 3P1JA 1ZRHA 2QI9C 3W6OA 4F38A 1WBDA 2QSZA 4NCNA 2JLYA 4L15A 2VHTA 3QEOA 1SXJB 3W6NA 4NCIA 4POAA 1JJ7A 4O25A 4TYQA 3ND8A 4DBLC 1FUUA 1V43A 2ZI6A 3PITA 1RKBA 1KKLA 1DAGA 2LWIA 1JI0A 2CE2X 2J7PD 2OCBA 4G3XA 3WHKA 1EFHA 2H7VA 2FU5C 3LLUA 2AR7A 2ZI3A 3RS7A 2ZYTX 4M21A 3FWYA 3BWDD 2A5DA 4HUQA 4PPFA 4RD1A 3GLGA 2Q3FA 2IT1A 2JLUA 4IOJA 3K0AA 1DAKA 2DFTA 2XNSA 2XSZD 4TL8A 2EWVA 3TK1A 3UWKA 1NY6A 4TLDA 2WSMA 3W8NA 2VF7A 2FPMA 4FW9A 3DZ8A 4TL9A 5SZKB 4FI3C 2O8BB 3CRRA 1DS6A 2WJVA 1YZKA 3SJAA 1NL3A 1U98A 1CULC 2FE4A 2GZAA 3U3KA 2WWFA 1KO7A 1CU1A 2RGCA 3T1QA 1KI9A 4YLGA 4KYIB 3VFDA 1TU3A 1QHHB 1AN0A 3WBKA 4ACBA 1U8AA 2MSDB 2V9PA 5EP4A 4ILEA 1NBME 3OIYA 821PA 3BFXA 1QHXA 2GJSA 4PZZA 4R71A 5FTJA 3K9GA 2GEUA 2PX0A 3EWAA 2AD1A 4ASUA 4AYXA 1M7BA 1NVXQ 1XX6A 2ZYVX 3A8TA 5A0FA 3EIQA 1IOZA 2C77A 3FFAA 2GEVA 2CBZA 4JLMA 4TTPA 4BFXA 1Q44A 4TWZA 4Q1EA 3LVQE 4QXAA 3LLMA 3AF3A 4NYJR 2J5XA 3IBGA 4C0JA 2ZSFA 3NBXX 1IM2A 3KB2A 4HAVA 4ZKDA 1SVLA 4HSEA 2PL3A 2XZPA 5EE5B 3GLFB 2JLXA 3DMNA 3Q5DA 2DHRA 2R62A 1Q21A 5LB4A 1EESA 4KV9A 3TKLA 4Q9JA 2CLSA 2CLDX 2JJ8A 4ZPXA 1OYWA 1GAJA 2O8EB 1H65A 4M4SA 1JR3D 2D74A 1D2EA 3E1SA 4D82A 2ODNA 3MMPA 4EFLA 2QMOA 3U7GA 3U4QB 3V00A 5J40A 1HV8A 2AXPA 4RZUA 2DWOA 4MYUA 2GA8A 1OE0A 1FP7A 3HR8A 4H1VA 4CVNA 2VBCA 1IN4A 4YC7A 4MRSA 4B34A 5DN6D 3S1AA 1FMJA 2OFOA 3NDPA 1W1WA 2QPAA 3OHMA 3K1JA 3LXXA 1JAHA 2AX4A 4K81B 5KSOA 4A2WA 2JATA 2NGRA 5J4HA 2LKDA 2J45A 3D3QA 5JEDA 4KVAA 3I5XA 1IY0A 3Q85A 2JJ2A 3FKSA 1W36D 1LF0A 2OAQ1 5E3HA 1E6CA 3OEHD 4C0HA 1IN8A 3LVRE 2O8CB 2Q3HA 5GJWC 2HXSA 4JYCA 3SQXA 2D4HA 3IPYA 3LDAA 1GL7A 1KO5A 3KQNA 4GDFA 3FTQA 2P67A 4QNRA 3TE6A 1N0VC 1XPUA 4AG5A 4B44A 3KTAB 2H1LA 1S8FA 3IIJA 4JJKA 3Q9LA 4NMMA 5CIWA 4B3GA 2FGKA 1TADA 2G77B 4UNRA 4MUBA 2QE7D 3MG9A 2ZM5A 2IS4A 3IGFA 4LJ5A 1DELA 5G41A 5FBWB 4HB4A 2WKRA 1KDOA 2YC4C 1N6OA 2ORVA 3F5FA 3A6PC 1B0UA 1C9KA 2CHVA 3QG1A 2DB3A 3HU2A 3I62A 2BM1A 3BRWD 3AEZA 2VSOA 1OSNA 3T15A 2BM0A 3RC3A 2GXAA 4Q66C 1N6RA 2B8TA 5FR2A 4E09A 1W36B 2OLKA 3H2YA 2RGXA 3C8UA 3M6AA 4JVSB 3UKDA 2ORWA 2HLDD 1FNNA 1OH8A 3R8FA 3B5JA 4DXAA 2FPLA 2FSGA 2VSFA 4C3ZA 4QGAA 4ZI3A 2H18A 2TMKA 1W44A 1KZGB 4DB4A 4QBFA 3LWNA 3K9NA 1AIPA 3GPLA 4N0DA 3TQCA 4W9MC 5F98A 1I4TD 1J7KA 2O0HA 1DAEA 4V0KA 2XEXA 2YNMA 1M34E 2ECKA 2O52A 2ZETA 3AV0B 2ZRLA 5JI3E 1JAIA 1S9HA 4IHQA 1WBBA 4LBVA 2WHXA 1E32A 3KKPA 4M1KA 2ZSBA 3T35A 3B1XA 1HT2E 4PO1A 1XTRA 2CL0X 2IXGA 2PMKA 4E5UA 3U2QA 4RFSB 1NVWQ 1QG4A 3SHFA 4DLTA 2K5UA 1X1SA 3FVQA 1FL9A 3I8XA 3IEVA 1Z2CA 1GUAA 2V6IA 1UFQA 4US0R 2VHUA 2V1XA 1VCNA 1E69A 2PCLA 2WJIA 1IHUA 5L3VA 2NPIA 2WMOB 1BKDR 2YZ2A 4M22A 4TLCA 1D2MA 1W4BA 4PANA 1COWA 3BK7A 4URUR 4EUNA 3IQXA 2ODBA 3MCAA 4D80A 1ANKA 1OB5A 1OB2A 4BGDA 5AWFC 1FQJA 4HI0E 5FOTA 3O8DA 5DI9A 4TMKA 1NJFA 1GKYA 3BC1A 1E9BA 2GVZC 3THOA 2XTZA 4PPNA 5HZHA 1DBSA 5JJLA 1TQ6A 1NVVR 1X8KA 4PC1A 1G7RA 5EP3A 3L82B 2J0SA 1KI6B 4AYTA 1ZD9A 3I72A 1E4VA 4OJQA 4B75A 1NNEA 2ZS9A 5DIFA 2NO7A 3K0SA 1EX7A 2CVFA 3HWSA 2GDJA 3QF4A 2BC9A 2DY1A 4TMWA 4PAQA 2O8FA 2CCKA 4P32A 3U60B 2RMKA 2IYTA 5KOYA 2ZRFA 3N2IA 3BB3A 4UNPA 2V1UA 4TSFA 4L5BA 3SU8A 4C0SA 2XJ4A 1F5NA 5GJCA 1E2PA 3EARA 3WXMA 5K8TA 3I61A 1NN5A 4QHYA 1TAGA 1Z06A 4AIIA 2VQSA 4FCWA 1TEXA 3A4NA 4JLAA 1OKKD 5JWRA 2PJRA 1HT1E 1IJFA 1UM8A 1EFRA 1VCMA 1ZM2A 4DSUA 3QE0A 1E0KA 2ZPTX 2G0TA 3L0PA 4B3DA 4V0LA 5L3SB 3CRW1 4G1UC 4XH9B 4A8JC 4PSAA 4NZYA 4NYMR 4G5QA 3IO3A 5KNBA 1SVOA 3I73A 5FPKA 3QKSA 3KFVA 4IOLA 3OE7A 2A9KA 2PT5A 1XRJA 1UDXA 2BMFA 2FV8A 2YOHA 1P72A 2O5VA 1MKYA 4UXHA 3ASZA 3GLIA 1GM5A 3ECCA 4DCTA 3TRFA 1JQLB 4HYYA 1U99A 4V0MA 1ZINA 4AYWA 3DM9B 2O0KA 2QG6A 2WKQA 1NP6A 2GTPA 1YJ5A 2GF0A 4NPHA 2VP0A 5EXTA 1JXOA 3M0EA 2C96A 2FJUA 1YVDA 2ZE6A 1YR7A 5GVSA 2CEAA 3ZIAD 2G1KA 5BWMA 3QJYA 1VMAA 3QXCA 4Q7KA 4ZDKA 3IHWA 3KZ1E 3OFNA 4M1TA 3Q3JB 2NIPA 3ZVNA 3KFXA 5EXSA 2HXYA 1WE2A 2EYUA 2F1RA 1KO8A 2QNRA 4JL5A 4XOIA 1FUKA 3LV8A 4JS0A 4CEIB 4HB0A 4JBXA 2XOKD 4JSYA 2KBFA 2DFLA 1YZNA 3TSZA 4XVRA 4EQ6B 1NF3A 3SBDA 3QF4B 3O47A 4AWXA 2EYQA 2N1BA 2WJGA 4QGHA 4AG6A 4DCNA 4GP6A 2DBYA 3B8HA 3EZFA 2IUTA 4B43A 4WXRA 2BBWA 4N0EA 3MWYW 4FMCF 5DHAA 4FMBB 4EJSC 4JL6A 3FFBA 2VP4A 2HYIC 2OE2A 4LV5B 1CLUA 5BN4A 1UADA 1MV5A 5FOVA 2XGJA 2A7QA 3QENA 1RPZA 4HB3A 5TV2A 1XTQA 2JLSA 3CIOA 1PLKA 5FPHA 1I2DA 3R7WB 1Q57A 2GAOA 3L43A 2HT1A 4I4LA 4IDQA 2PEZA 2E87A 3D31A 3GD7A 2QAGA 2DR3A 1KZ7B 5DN6A 4W5HA 3OAAA 5CYOA 3TIFA 1XD2A 4JBYA 4IOMA 4OQLA 4F91B 3X1XA 4Q01A 3B85A 3FMPB 3B1YA 4D0NA 4DDUA 5J4LA 1DTSA 5TB5A 3MWLA 4MYCA 1G5TA 4CEHA 2WOOA 1CRQA 1R8QA 5CK4A 4NYJQ 4RD2A 3U44A 5FUXA 2J0UA 3AH8A 2AFIE 2JEOA 2BWJA 2ZAOA 4KLZA 4ITRC 1DO0A 2WOJA 4OK3A 1YZGA 4TLAA 1SXJD 2XZOA 2QROA 3BH0A 3AVXA 3FHCB 5A5GA 4A36A 4U02A 2J41A 2QP3A 4LYJA 1UKYA 2X2FA 2NO9A 5FPSA 4I1UA 3HU1A 5KDDA 4TN1A 1TX4B 2G9NA 4AD8A 5L3QB 3B9QA 3CR8A 2F6RA 5A4JA 1Z6XA 4AKHA 4QNMA 1KI4A 2GETA 3GLIB 1YR6A 3OZXA 3TLXA 4KXFB 1WDTA 2QTVB 1KNXA 1N5LA 3P32A 4PC2A 3SFZA 2ZR0A 4F4JA 3ZVRA 2FA9A 2OUKA 3WRYC 4XD7D 1E2HA 3FGNA 3WY9A 5TDHA 5FBRB 3THXB 1SZPA 1UKVY 4PPGA 3RVBA 3VR3A 4C0KA 3A36A 4A4DA 4DRZA 2GXSA 3V4RA 5H68A 1ZJ6A 1NMXA 1R0WA 2QMEA 4AKGA 1CF4A 3KQUA 4NKRA 4EFNA 4GBMA 5AUNB 4GZMA 4Q4HA 3A1WA 4B71A 4MGIR 4B2LA 3KDSE 4FD2A 2CMKA 1E1QA 1GITA 4UXJA 3BH6A 4LYAA 3BORA 3EZ2A 4YDHB 1KI1A 4HUQB 2AK3A 1LB1B 1EFUA 1GSIA 3AB3A 4PAOA 3WYFA 4F4IA 2QAGB 3N2EA 1R5BA 4NONA 3VTKA 2B21A 3F0TA 2X8AA 2IYUA 2ZJ5A 4NCKA 1E9SA 1T9HA 4P4SB 3WRXC 3EPKA 2WV9A 4DEYA 2R2AA 3WMEA 5GVRA 2GCPA 1KDTA 2QMUA 5F9HA 4XWKA 3CO5A 2HUPA 1NVUQ 2ZI7A 4MUAA 4C0AC 3T1TA 1P9NA 4Q4JB 2WVJA 4RZ2A 4DDVA 2Y8EA 3OIVA 2J7PA 1KKMA 1N6PA 1P9WA 2AHOA 5KPDA 3A37A 2O8DA 1R0XA 1NIPA 1II8A 3OEED 2XB4A 3AF2A 1QVAA 1VG1A 2Q9CA 4M1YA 4MRRA 3RDPA 5D3MA 1T3HA 1G20E 2RB4A 3HDTA 2VHJA 2IWHA 1CJUC 4CZ2A 4A1FA 1Q1QA 4YDSA 3RSOA 1KK0A 3WMFA 3KKNA 4M2LA 1W0KA 4C7OB 1EXMA 1N6IA 5EQTA 1GTVA 3LQRA 3W5IA 2W2VA 1XZPA 4WBSA 4DUGD 4NTZA 2A5YB 1G7SA 4K46A 5B2ZA 3B2EA 5ANRB 2O0JA 2Z83A 2ZIAA 2PX3A 2GXQA 4BRWA 4DC9A 3QBVA 4BE7B 3MLEA 1OHHD 4HLCA 1KY2A 1Q1EA 1Z3IX 1FP6A 2H17A 1LVGA 5KUTA 2GCOB 2NO0A 1O3YA 1YE8A 1F6BA 1MO3A 2ZVPX 4JVMA 1VTKA 3DEFA 4DLRA 1P9RA 1OFHA 3AKDA 3CH4B 1MRSA 3U7EB 1O87A 5GADl 1CR4A 2FOLA 1CR0A 3EAQA 4WOPA 3VR5A 4CT4B 1J90A 1K5DA 2QY9A 4TYPA 2W2TA 3FHTA 1UBFA 4OL0A 5DYIA 3AVUA 3U3OA 1MOZA 2JASA 1CXZA 3AVWA 4PX9A 1X6VA 2Q3MA 3X2SA 4X8LA 1AQUA 1ZUIA 1VIAA 4UJ5A 4N1AA 1OFUX 2H5EA 3BS4A 1RJ9A 2VHCA 1P73A 5KU1A 1XTJA 1Z2AA 5BN3A 2IW3A 3CH5A 1S4QA 2CJWB 3QG5A 2CLCX 4CYMA 1XXHB 3RWOA 3QKRB 3W3AA 4DT1B 2UVQA 2F3TA 4IDPA 3KKMA 3I5YA 1GZSA 1XU4A 1S1MA 3NC0C 2WJJA 3PFIA 3PENA 4C7OA 1MRNA 4MRVA 1Z22A 2IYYA 1KDRA 2JLVA 4DDWA 1QVRA 1OH6A 1EWQA 4DHEA 2YWGA 1X8JA 1S0UA 2GZHA 4BZQA 2A2ZA 1ETUA 3RRMA 3O8RA 4B76A 3CLVA 3AVPA 1GFIA 1IXZA 3SYNA 4XSHA 1T91A 4LV6A 3SS8A 1NKTA 3TJZA 3LNCA 4ABYA 3TUJC 4EJSA 5HKKD 1JJVA 4Q18A 1M1YE 3OIUA 3RRZA 4XVQA 1G16A 2RGNC 4FMDB 2Q9AA 3ZS8A 1NLZA 2YWFA 1TQ2A 3VHLB 1K5GA 2JCSA 1N6LA 4M0LA 2XTMA 2FFAA 3OESA 4Q19A 1HE8B 1Z6GA 3F3YA 3K0EA 3ZIAA 2B8WA 3ADBA 3A58B 1M7HA 4NH0A 4MGZR 1US8B 2XX3A 1ZD1A 4B6FA 4IFBA 3U4QA 1ZM7A 2MSEB 3CKLA 1CR2A 1XEXA 2HJVA 3PUXA 4AURA 3B78A 2FEMA 2NTYC 4GT1A 4EAQA 2XOKA 1KY3A 2I1VB 1PUIA 2BBOA 2QZ4A 2WJYA 2L0XA 1DARA 3OFND 4NU0A 3V9PA 2CL6X 1HTWA 3LBHA 2I4IA 4LJAA 5AUOB 2WIAA 2R6CA 4EPYA 1RYHA 5EXXA 5K8IA 2P0EA 2GK7A 2D2EA 2QPTA 5EJEA 3AF1A 2FFQA 1F48A 2WBLC 1W4CA 4HDCA 5DI3A 1FQKA 3RC8A 4TSFD 2CCJA 3UANA 5CYPA 4WA7A 4GP7A 5B64A 4TMVA 2G3YA 1GILA 4ZIRB 1BMFD 4KU4A 1JEEA 2WM9B 4G5GA 1DAFA 1VIYA 3N70A 2J87A 4UKDA 4LPSA 5DLQC 3JZAA 3A1TA 4MDEA 3K0FB 3SFVA 3ZYCA 1YHNA 5L8VA 4RD4A 2CHGA 3H0KA 3TQFA 3QPVA 3GFPA 2F9MA 1OKKA 2E9SA 3KKOA 2XNDA 1ZU5A 5C4GB 4DCSA 1T3SA 3C7KA 3SBEA 1QHHA 3UG7A 3H1TA 3W6PA 3WNCA 2YHSA 4UQOA 3TVTA 4OHYA 3CWQA 3CPJB 4BFTA 2IEYA 2X77A 3GJ7A 1I4DD 3QQ5A 2IK8A 2WPDD 3IIMA 1T5LA 4YMUA 3GEEA 4P33A 5CJPA 3IUYA 1KI8A 1N6HA 3RLFA 2C95A 2XITA 2FX3A 4LJYA 4JMPA 2FPKA 3GP8A 2JLZA 2P6NA 5LDDC 5JJIA 3I32A 5DHFA 4CEHB 5SZJA 2PEYA 4IDNA 4QFMA 5H70A 3K70D 4UNQA 5FI0B 3GEIA 5BXQC 4MKIA 3EA5A 4LV8B 2JAQA 4GRAA 4HDOB 4U7DA 1G3QA 1W46A 1G5RA 1TPZA 4US1R 4Q4JA 2Z4SA 1CJKC 1G18A 2SHKA 3NEJA 1AA9A 3UMRA 3VR2A 5EZ5A 1Z0FA 1CJTC 1IXSB 1WXQA 1CBUA 3Q72A 2ZUDA 1SXJC 3S1AB 4LC0A 1NN1A 2ZAMA 1HQCA 5IF9A 3EZ9A 3AVYA 2Q21A 4PXAA 3T1OA 1FW6A 4EJSB 3NHAA 3NVAA 1U0HC 2ZRDA 4ON9A 1II9A 4BFWA 3AVTA 2QP4A 3KUDA 1E79D 1XMVA 2OLJA 2F43B 4YMTA 221PA 4D2IA 1HE1C 1ZAKA 1R7RA 2OILA 5AJYA 3KKQA 3ZQ6A 4BZPA 2NZ8A 2Q0HA 2OZEA 3LFUA 1UPTA 3VR6A 4AKIA 5FTNA 2OCPA 1AGRA 1P7CA 4A0FA 1R0YA 4Q4AB 4S35A 1DAMA 3V4FA 3KQKA 3MD0A 1U8ZA 3SI7A 3C14C 5DNYB 3E5HA 4I1OA 1AGPA 3QKRA 4DT1A 2OXRA 4MKFA 2WIBA 4DDTA 4U5XA 4B33A 3E2IA 4DIEA 1PLJA 1MABB 1E9DA 2KWIA 2DCUA 2V6JA 2FEOA 4DWJA 3VKGA 2AN9A 2EFEB 1KOFA 1G6HA 1A4RA 721PA 3TBKA 2RCNA 3ZDQA 1AZTA 2BJVA 3EW9A 2Z43A 3UPUA 3Q7QA 1NSTA 4FCVA 1HYQA 2IHBA 3PIRA 1R4AA 2ZANA 1W2GA 2ONKA 3FMOB 3W5JA 2W2XA 4S2EA 1GIAA 1D8TA 1AM4D 4I1VA 2VA8A 5BN5A 4BFSA 1PZNA 1RFLA 2GBLC 2GCOA 3EIEA 3JVVA 4E03A 1I2MA 2J59A 2JJ2D 3FKSD 3VR4A 1PVOA 5CDFE 4NYIQ 5TMPA 3ADKA 3RS4A 1KAGA 3NG1A 1P2TA 1L4UA 3LW8A 1AK2A 4PAMA 3TW4A 5J4KA 2QAJA 1MO6A 1KSGA 2QQEA 1L8QA 2AFHE 5CB6A 3WYAA 4R2IA 4ESVA 1G3MA 4AK9A 4LBYA 2J0QA 5AR1A 3AM1A 3ZZ0A 3BERA 3K70B 4KCGA 4L9SA 2OEPA 4JYBA 1JXMA 1XEXB 1W49A 5AK0A 3A1UA 2HEIA 2C9YA 2WWWA 2FGJA 1P3JA 4PZYA 3PJRA 2DPXA 1II8B 4Q47A 4JBWA 3P27A 3G5UA 4UJ3A 3CBQA 3KXKA 4NL4H 1LF5A 3DO6A 1RRGA 1R8SA 1XEFA 2FZLA 3ETLA 3ICQB 3KB1A 4R2HA 3BIFA 4KLNA 4YMSA 1AQYA 2GHIA 2ZYUX 1NI3A 1ODFA 2OBMA 4BFYA 1ZUHA 1U81A 2OESA 4OBEA 4Q00A 1DE0A 4G5RA 2GILA 3IDQA 2ZR9A 5B58C 1SXJA 2PBRA 1BYIA 4URXR 4PR0A 2ZRNA 1KJZA 2IF2A 3KJEA 3NKVA 3U7HB 1G4UR 1ZVQA 4RJLA 5HZKA 1IAQA 4CDGA 1BIFA 2Q6TA 3G82C 2FN4A 4KHZA 2WAYA 4P4SA 4V0NA 1EG7A 4ZO4A 1WB9A 4JSTA 1MO5A 1N5KA 1RZ3A 4BLSA 3WNBA 2FWRA 2I1QA 3A1VA 1QRAA 4B2PA 4MGYR 3CF0A 1NN0A 4JT2A 2BMDA 3B60A 3CR7A 1H8EA 4QKQA 4HLDA 5FL7D 4TTRA 3PEYA 1Q3HA 4RZ3A 2EFGA 3ZQJA 2C8VA 3B1ZA 1XCGB 1Z0KA 1GOTA 1A5TA 1Z8FA 2GAAA 3EC2A 4WIAA 1P4SA 2E1RA 4KSBA 3AKEA 1YKSA 4TQAA 4R7ZA 3SYKA 1FX0B 1VPLA 2QL6A 4DLWA 2IYRA 4KVGA 1GKIA 3VNVA 5GJBA 1U9IC 3DZDA 3AP2A 1M74A 4ASUD 1Q20A 3GLHE 4ZI2A 1XTIA 4KAXA 1M6NA 1IONA 2EU8A 2W0SA 2GF9A 1ZC4A 2V55B 3VR1A 2VP9A 1XJQA 2IA5A 2A5GA 2IYSA 2NOAA 1EFTA 2W6JD 4TTQA 3ZVLA 2C9OA 5LD2B 5LD2C 4BFZA 1BYUA 1IXRC 2IUUA 1KI2A 1G8PA 4Q5IA 1P6XA 3K9LA 3LX5A 1E0JA 3P4YA 1TF5A 3DOFA 1W2HA 4ZCLA 5JI2E 4LJ4A 4LJ6A 1Q3TA 1RE0A 2GJKA 2FSHA 2IYZA 5DYGA 4I1SA 3D6TB 3RS3A 1ZMXA 4TL7A 1KIMA 1UDWA 4W7SA 5KSPA 4D4LA 2Z0MA 1US8A 2QPOA 5J5CA 2JDID 1NKSA 4E07A 1NBMA 3HU3A 2O8FB 1SVMA 5JRJA 1KJWA 1WF3A 3K09C 3A1SA 4FMDF 5J4YA 4DJTA 2GJAA 4EPWA 1OT3A 2W58A 1E2EA 2ZI9A 1OIWA 3KJGA 5BW8A 1VKJA 4A15A 2OO7A 4C4PA 3CM0A 3U3RA 1XMSA 4OHXA 1ZCAA 4P4TA 4URYR 1JNYA 4Y0VA 3K53A 3UATA 3HPRA 4D6PA 1DO2A 3CB4A 4TMTA 1E1QD 3GQBA 1VCIA 3QKTA 4GOXA 2ZEJA 2P5SA 4MKHA 3GMTA 2ATXA 2GNOA 1DAIA 5AJVB 1AS2A 4AY2A 4L8GA 3TR5A 3DVLA 5LBIA 4JLBA 4WXPA 3GLGE 3U6BA 4A8JB 1D9ZA 2A3RA 4E22A 1M8PA 3BXZA 1LNZA 5FBLB 3L8ZA 4IEIA 2KBEA 3LAWA 3CW2A 1IN6A 4TT3A 3A4MA 4CW7A 2LKCA 3ADDA 4ESHA 4J0QA 3VAAA 2BJWA 1LW7A 2CVHA 3SNHA 3R9WA 2IWRA 4M1OA 1Z5ZA 3EASA 4Z8XA 1ONBA 1TUEA 4JLPA
chains in the Genus database with same CATH superfamily
4ZQGA 3TQRA 4DY6A 5ULLA 1XL0A 1OD6A 2HJGA 4L27A 2JLWA 2E4ZA 2ORIA 5K6AC 2C04A 1USUA 2V0GA 3QVWA 3CLHA 4MAMA 1KARA 3ZVMA 1F60A 3V1MA 2I91A 5BY2A 1IN1A 2DR0A 2ZOSA 1EXDA 1ABFA 2W4MA 1PFWA 2FXVA 1SOMA 1VFNA 1NJGA 1OCEA 3DAYA 3DKVA 2HX1A 4MEJA 4MTLA 3KWMA 4YQZA 3CNLA 4HAXA 4CIXA 3C87A 4DDMA 3Q9UA 1Q0SA 4D7AA 4OLBA 4XD7A 1QO0A 1WWKA 3E70C 2OENG 1FYDA 4JP8A 4RD3A 1XVTA 2FSFA 3Q7PA 3R5SA 4KAAA 3F6EX 3MJ4A 1Z83A 4KEAA 2WWGA 1H1LB 1DNPA 3B52X 3NMUF 1QDEA 1W0JD 4F8YA 4LF8B 4DCVA 1JA0A 4QYMA 1ECCA 1WXEA 2O5CA 2HTEA 1VE1A 1Q17A 3E18A 2VTVA 3N0TA 2ODQA 3CRQA 3UJ7A 4Z1MD 4G5YA 4LXIA 3RSSA 3T3HA 1T43A 3B8EA 1O94D 4OB8A 4DM7A 3DBHB 5IK2D 1K0UA 1MJGM 3LECA 4TZ6A 4DW8A 5HJ7A 1A9TA 3ZW8A 3QUBA 2A7XA 3HDHA 1AUOA 4Q9IA 4B35A 1ESNA 5H3LA 2RGDA 3AW9A 1Y8RB 3LT1A 3JX9A 4G9BA 1WMSA 1Y98A 3UBMA 2HT6A 3VDRA 3R44A 1ID8A 3MMZA 3H4TA 2WPDA 1J7JA 4LVNA 4B1FA 3GT4A 1MIOB 5INTA 2ZRGA 1IRIA 5L3SA 3K05A 5AHXA 1I80A 4IQ0A 3PXCX 1W85A 2WIFA 5JZVA 1PQWA 1UJBA 4O2BF 4AJ9A 2VG8A 1LBTA 3E35A 4QTUB 1LLDA 3QE9Y 2VEOA 2A0KA 2CXXA 2Q7DA 1DU4A 3EAFA 4N3GA 1ODJA 2H16A 3DUWA 4IUYA 4QUKA 1LV7A 2ZIXB 3GZJA 1Z7EA 3JWPA 1KQGA 4Q37A 1PHPA 1UJCA 3HXOA 3SR0A 1W52X 4X7MA 4BKPA 2GAFA 4GYJA 3GVCA 4LHSA 1BEEA 2YR0A 3A28A 3KLPX 4F21A 1EJ2A 4N0EA 4URWR 4M1MA 3WGVA 3ND5A 1D1TA 2JGRA 3NJ8A 1O94C 4LJSA 4QQKA 4R1OA 2PT7A 3EN0A 2Q1YA 4C7VA 2D8AA 1H0SA 4FLFA 3WGHA 1VMEA 2E37A 4G24A 2B78A 4HAIA 3D8UA 3O91A 3VKFA 1LPNA 3D3EA 3HB7A 4H1HA 5BWBA 2QUHA 5C7LO 1QJCA 1YSCA 4J29A 2JA1A 4B8YA 3E3LA 1J2JA 3PV0A 1GPWB 4P38A 3CUVA 3JWHA 1IZ8A 2H7XA 3HP7A 3ONNA 4PHCA 3VR0A 3EF1A 3QXHA 5IHXA 4N4AA 1NDQA 5HKLA 5J4VA 1DX4A 2PH1A 1EB8A 3ML1A 1ESEA 4HH1A 4O4HB 3DR5A 2GOYA 2XUZA 4QA9A 5IMSA 4RXUA 1E0DA 3IPAA 5JSHA 1PL8A 4IDAA 4RTJA 3SLRA 5GWXA 4KITB 6LDHA 2EKLA 1HDGO 1HO3A 4W1RA 2ZQ5A 1GFZA 1N8KA 1T5OA 3GOHA 1C7ZA 1MBZA 3NEAA 4FGKA 1YJQA 2IHNA 2Q3CA 3DE0X 2JAXA 4LRTB 2NV0A 1I7DA 2BDUA 5FUWA 1FX1A 4HTAA 4MVJP 4WZBE 5PNTA 3RUDA 1XKLA 1QVVA 4OYLA 4XD2A 3ICEA 3CUWA 2FQXA 3LT4A 4P6VF 1E94E 3WJ1A 4NPAA 5ITZB 3KOZA 2ROQA 3H0CA 2HY7A 2QORA 3ENVA 1Y3DE 1VGVA 3QXXA 4HXYA 5CDHA 1TL7C 2JBAB 2PKEA 1SQGA 3DFKA 3K9CA 3SIPA 2QD4A 3OPYI 1T2NA 1Z33A 4HWPA 4JLOA 4JLWA 4PC7A 2ODPA 4X61A 2G40A 4Y6QA 1U3FA 2AXQA 4CQJA 2CKDA 4DLKA 5P21A 4LYHA 3EUEA 1NBEA 2XMGA 2CFSA 4CEIA 2VHEA 1F3LA 1I3MA 5I7VA 2DUMA 5F7OA 1FS5A 5KVCA 1MEJA 1G2OA 4IH4A 3INRA 3GY0A 3PXXA 2B25A 3O1JC 5TGZA 2IHKA 1QHEA 3NYRA 3ZGXA 2VYCA 4DZTA 1WP4A 3ZHCA 5JAHA 3KVYA 4Y9DA 1QLWA 3JD4A 1SVIA 4MVJM 4BMYA 3C15C 3GLSA 1DTWB 1IQ0A 1I10A 1NVTA 1XYVA 3H1PA 1L5OA 4D26A 2FWAA 4IXTA 3BCRA 3H0EA 3IIKA 2QIOA 1B8VA 1MFPA 2IU3A 4J4HA 4YCMA 1P4HA 1Z28A 1UBJS 3RRXA 4XM2A 2O7RA 3EZGA 2BUAA 2NU8B 2CJYA 3ZTTA 2NTJA 4J1SA 5H9WA 4KQ9A 3IR7A 4BRUA 1JSCA 4LRYA 2Q07A 4ZT3A 2R44A 4UBLA 4EB6A 5L4LA 4QWMA 3UMMA 4ZWNA 5JCOA 5F3WB 1EB9A 5JT1A 5JE8A 3FR8A 1XLVA 4I5DA 5KX5F 4C2TA 1FNMA 1BH2A 3ZUGA 1E3SA 5I9IA 3ZDCA 1XZHA 2YFYA 4OFXA 5HMLA 2PKWA 3P0HA 3I92A 3B51X 2I6UA 3M1AA 2BUBA 3LRPA 4X41A 3CZMA 4QFDA 3CUTA 5JDIC 4TUYF 3ITNA 1A4IA 4S1OA 2H00A 4KBFA 4YQYA 8LDHA 1EAMA 1D6JA 2AD5A 2UUOA 3UB4A 4YAEA 3UXEA 4C9BA 3PC8A 3DB2A 3CNNA 4CF6A 2MYPA 2RBEA 4HOYA 5G2OA 5D1NA 2GJ9A 3W2TA 3LQ4A 4GC5A 1T9GR 2GR9A 3AKCA 1NRJB 4KN6A 1XEWX 1FP2A 3GCGA 1FPQA 1I3OA 4H0CA 2VDPB 4U6SA 4PSVA 3ZQ4A 3QPBA 4IICA 5JSZA 2BFMA 3FLEA 5D5PA 5JTTA 3SDSA 4GZ5A 4XI9A 3LSTA 1TXGA 3KCNA 1HLFA 4HF7A 4EJFA 1AV6A 4Y30A 3MB5A 2NZVG 1OGIA 3A06A 3IOCA 1UFVA 4PSCA 1NJ2A 5LZ4A 4BLTA 1P61B 1EI9A 3UJ3X 2XKJE 1FNSA 1D2NA 4UNSA 3S68A 5E7JA 4FQ8A 3FIUA 4AROA 2FEAA 2G6BA 1CUBA 2V7PA 1ZFNA 2ZVJA 4RIIA 2B0CA 3GB9A 2VAVA 1OBHA 1Z17A 4BBPA 2FOXA 1BSVA 1RQNA 2A5JA 3MWEA 1I94B 5BV1A 1DJMA 1YZTA 4Z3OA 3MVEA 1QOZA 1UBMS 2FF7A 2QT1A 2GPAA 3T5MA 3PSHA 5C4MA 4KKVA 4EKDA 4N6GA 1PGNA 4M89A 3ZDAA 4N12A 4KW7A 3TGPA 4N40A 4FHZA 4QO8A 4IMRA 2O2ZA 3EVNA 3EISA 3GRKA 1VQ1A 3THSA 1PQPA 2PYZA 1XNHA 2JHFA 3V1TC 3WK6A 1UXJA 4JMLA 1XKXA 3KEOA 3ZZTA 4DR4B 4L0MA 5JSZB 3GAAA 4MR7B 5HUQA 1EFDN 1L7QA 3PGVA 3GARA 4L3OA 3UXHA 2FW8A 3CUUA 1SG6A 1WV0A 5E9QA 4OMCA 5CB8A 1MA0A 1NVBA 4RFSA 4ZCTA 2HCBA 1SQ0A 2HDNB 2ZTVA 3QELA 4J8PA 4MH0R 3WFZA 4BQFA 2ZJAA 5B6PA 5E1MA 4DLSA 1RCTE 2XQFA 3GBVA 4ZCSA 4WZAE 1YZUA 2NLOA 3G7SA 3SE0A 3KSAC 1XTUA 4HVTA 4YONB 4MVJA 1XQWA 4NXMB 2RIPA 2YXBA 1M7GA 4I3HA 5LP6C 1ECJA 2HK7A 3W7VA 2JDIA 3HHPA 4XIFA 3JSAA 1LSOA 2XT9A 3CEPB 1GNPA 2WWXA 4WH0A 5JNRA 4K3UA 4OXNA 1F4PA 5PGMA 4A6PA 5BMVB 1A4XA 5JZMA 4D25A 4HX5A 1V9LA 3R77A 4IIHA 4UTPA 2HF8A 3EXEB 2NMVA 1DBIA 4AY3A 2J31A 2ZTMA 3EXAA 5AW8A 5DGHA 3SOPA 2RG1A 4FWBA 4KQGA 1W34A 5L53A 2HK6A 2X8JB 3DE3X 3I1FA 5E1OA 2WM8A 3MGBA 3B7PA 2E4AA 4M8NE 2C2KA 1PNTA 1EK0A 3SXPA 3AR4A 2NYRA 3U48A 4OI2A 4P4NA 1B7GO 1K89A 2OFWA 4REQA 3FYUC 3PFCA 1WZUA 2PSSA 1IOVA 1IEXA 2YFQA 3KSRA 2C0PA 3FX2A 3JYPA 3IEKA 1OFIA 1DT3A 3RASA 5JHHB 3JZMA 2WKSA 1ONOA 1ZIPA 4REOA 4B80A 1KSHA 2ODAA 3C5CA 1MDBA 2W71A 4KR3A 3TUZC 4V0SA 4LCBA 4ALLA 4LZNA 5KO2A 4S24A 3UJAA 3CJTA 1FFXB 1Z68A 4D4KA 1RQGA 4ZV4A 2GUWA 1TW3A 3PPXA 4X44A 2SKDA 5IH7A 4R0MA 1FS4A 2NT4A 3H2ZA 1XDSA 1H2FA 3OE5A 1JSZA 3TD9A 3C1OA 5CLFA 1VP9A 2VS1A 5C35A 1Z0JA 3SYMA 3WLKX 5ITVA 4K26A 4X66B 1SVWA 4UUMA 4YUZA 5KVSA 2G0AA 3UMYA 1GU7A 4OK5A 2DM6A 1BDBA 1BU5A 3CPEA 4RBNA 3Q87B 3ZCUA 4CMGA 1ZPDA 1XMPA 2MMCA 2V54A 3O4GA 4ZK2A 2XRYA 1TQDA 5CT6A 2NP6A 5I4BA 2FZWA 1D2CA 4F86A 4MKGA 4FZJA 4ZDWA 2OCYC 2L17A 2P5TB 1SU4A 1NLUA 3N74A 1RHKA 3PHBE 4YJ3B 3V2GA 2MJLA 1YI0A 3ND9A 4QPCA 5IUJC 5K0SA 4OHVA 2OKCA 1VL6A 4A0GA 2X0NA 1JMKC 4PPYA 2XXAB 3RUCA 1ICEA 3NT5A 1KJ9A 5CBPA 1UQTA 1I2BA 3GBPA 4I99A 4LNAA 2RKOA 5K03A 4YRGA 6GPBA 4J1NA 4NBLA 2HCJB 1U0RA 2GBPA 2KE5A 1RI4A 2PX4A 3HS3A 2P9JA 5DLEA 5DB4A 3H2BA 1PQ4A 1R2QA 3QQPA 1ONPA 3MINA 4P7JA 4Q7LA 3WLIA 1B2LA 1E0SA 5JMTA 3ESBA 2YY6A 1L7VC 2RAVA 2ZYAA 4FFNA 4IUDS 1E2DA 2FZ4A 3H1EA 4P0TA 3JYHA 1E9AA 2QWXA 5E6SA 3VMMA 4TYYA 4G0WA 1WY7A 1UT8A 5JRZA 4BKQA 3CN9A 1E1RD 4N8SA 2FP4A 4NYMQ 4QOHA 3ETCA 5DLDA 2NPFA 1JKJB 4ROSA 3HI6A 1WZNA 2CJWA 2C78A 2J32A 4KIGA 2WABA 4F3NA 1BCSB 1IULA 3HNRA 3NV9A 2OO5A 3EVAA 4A2QA 3DMPA 3LZ6A 5AKKA 4D4MA 4ZV9A 4EI2A 5KNCD 1B41A 5CIQA 3EHEA 4NBRA 1NNUA 1V71A 2KJQA 1FOEB 3RV3A 1XHEA 4R1LA 3ZPXA 3LUCA 5AO9A 5U4XA 2ZE5A 1KAEA 4ENQA 4ZJZA 2SNIE 1ZWKA 3FYUB 2I6TA 3AP1A 5MGNA 1T3GA 3DD1A 4YRNA 3ST7A 1J09A 2BKUA 2ADOA 4FZ5A 4MCHA 4N18A 1W5TA 2BV3A 1R4NB 4A82A 3VMFA 2DLCX 1WSWA 3CXRA 2GYWA 2PZFA 2H2AA 3DPSA 3R24A 5B7GA 2RHBA 3P9CA 1JAZA 5JWHA 3I45A 3IILA 5CVVA 4K6KA 2W6CX 2G08A 5DHRA 1JZTA 1JDVA 4L4RA 3GNTA 4L57A 3GYBA 4ZIRA 4MR8B 1U8YA 4W8HA 5JQGF 3KP1A 5DNCA 2LTAA 2H0QA 4HC4A 2PV0A 4HQ6A 4ZC1A 5B37A 1FTWA 1OXSC 5LZ7A 3STHA 1XZGA 1SB8A 3Q9SA 3OU2A 4LYFA 3VTZA 1KU6A 3T3MB 4BP9A 3BMNB 4QM6A 1Z82A 2AQ8A 4FOLA 4X8MA 4M86A 5CX1A 4ZVPA 1WS6A 1K7FB 1UWCA 3FJ1A 3NDBB 1ECBA 1SBYA 2P6MA 4YT5A 3M89A 5E6UB 3VYSB 4R2MA 2ZI4A 5UKDA 2HPZA 3IVCA 2Z2YA 2JJ1D 3FMIA 4LYEA 4KAJA 3WFJA 2PRKA 4UTZA 5JSKA 2D4AA 1ADCA 4G37A 1BW9B 3VKUA 1DI0A 2YWHA 4R4JA 1IVSA 3WR5A 2BGNA 1TVKA 3GJ8A 3IOYA 4BXOA 3QKUA 4E14A 4U0KA 1E6EA 4R2LA 4TPKA 1SBNE 3TLMA 2IXTA 3HP1A 1CX9B 3X1JA 4YYEA 3TLBA 1GDTA 3OE7D 1QMGA 1YQGA 2OWDA 1QRUA 1BGWA 1R3DA 1AKVA 5D3MB 5ITZA 5A6SA 2VJAA 1C1XA 1YMUA 4PGMA 4RF2A 1N8NA 4H27A 1FDSA 1A8PA 3FWKA 4F92B 3VYTB 2IEIA 4YHBA 2E6UX 3V4PB 3E9CA 3IBYA 3AI7A 2VAPA 4NE2A 1Y6JA 2IRWA 3GMSA 3FUCA 2GCNA 3OCWA 5AXBA 3VZDA 3C8HA 4H3KB 4X0EA 4CN8A 4QXPA 2X5OA 4Q1FA 3M4XA 2YIJA 4LHZA 3VM6A 3WG9A 5HIMA 2E4UA 3I2JA 1T4GA 4MKRA 5IYZF 1M9NA 3RNLA 1CF9A 3CINA 1JT2A 16PKA 1YAJA 1BVUA 4G97A 3LQFA 3WQSB 4BNVA 2P3SA 5DU2A 2AK2A 1P60A 4Z5XA 1HNWB 1OIVA 1YK0A 4C05A 2MSCB 2IDZA 1MO2A 2GZDA 1PWYE 3BMOA 3EBPA 1COWD 4QYIB 4WDRA 2L18A 4YGYA 3ZV7A 3OF2A 3PCRB 2FR1A 2FSIA 2LCFA 1PKEA 2ZSHA 3K5PA 4MJLA 3ZWPA 4EB8A 3U6KA 2VDVE 3HCRA 3W9SA 1CZLA 4MGHA 1J8MF 1A82A 1ZN9A 5JWOA 4FOPA 5FWAA 3W9YA 3M49A 1DBPA 1R16A 4GPD1 4ZP1A 1RLJA 1QGOA 2OB2A 1FXUA 3HCPA 1BEZA 2WTMA 2ZRKA 2P75A 4K88A 3R7FA 4DA0A 5I7UA 1CUAA 5T3UA 4D46A 1QGUB 1EGHA 2HJ9A 3HJHA 3LF2A 3EG9B 1J0BA 2JD0A 1QLHA 3AFGA 3PUIA 1GXSA 4I81A 3H11B 3SJBA 2X14A 5LLTA 2YMLA 4OGWA 1ST3A 3F71A 3C0KA 2NZUG 1QYIA 3VX3A 4HPJB 2GZ3A 3N8GA 3Q3GE 1U8EA 3K9FC 2C5AA 4RLFA 4V0ME 1CT9A 1N2CE 3DNMA 5KWIA 3ZDZB 2CF6A 3WICA 4AW9A 1PSWA 2VHQA 5DEIA 4Z7NB 1XDBA 1ISSA 2COKA 2VT3A 4RHEA 4X63A 5FR1A 1DOZA 3W2FA 4CM1A 2AMJA 1CRZA 1W4ZA 4EPXA 1L1RA 4UDYX 1D1QA 4F45A 4J7CA 4PXSA 2HF7A 4R3NA 5JS6A 2NU6A 1OBCA 2NO6A 3JQBA 3RT9A 2Q1WA 5EA2A 1K6MA 2VPYA 1L9XA 1YMVA 4V1CI 4R1MA 1PNOA 5IUKC 3PR2B 4ZDJA 4JY7A 1XI2A 2X4GA 4AMBA 1P8JA 1NRXA 3DT6A 2DHDA 2IPXA 3EMDA 1AK9A 1R5OA 2JVKA 4KMMA 4QHSA 3RVDA 2E3JA 3JASA 4DCPA 4OLAA 3TJRA 1VRVA 1PZGA 3C7DB 2XBUA 2B20A 5FNZA 2TRSB 3F8SA 4BO7A 2MSWA 1IZYA 2WMNB 2ZE7A 3KQPA 4PFSA 2WQ6A 5IAOA 4F5WA 2NX2A 2HL6A 5CLLA 2VYND 1X1RA 3VNAA 3OWHA 3BRWA 4CV1A 3AFMA 1KQNA 2Q5LA 2XODA 1SXQA 3WJ2A 3D2LA 4R8RA 1J5EB 4B3CA 2W83A 2HQ1A 2IYLD 3LOQA 3EQ6A 2ENWA 4MITA 4UUNA 2XWSA 2HCRA 3TO5A 5LMCA 1DFGA 4Q4LA 5H02A 4YAOA 3RROA 3R8CA 3TCXB 2XYRA 4YV2A 3SX4A 5B1DA 3C7TA 4MR9B 4QZVA 2WNIA 3BRSA 1TK3A 4UDXX 4HDKA 5BSMA 2AG0A 2P5YA 3O92A 4ZC8A 3IULA 5ALUA 5I9SA 3P0RA 3BICA 4JFAA 4JFRA 2V5UA 4OJKA 4QYTA 2QP9X 5JBNA 4FNGA 5G02A 5G53C 1K06A 1N7GA 3CBGA 3UWOA 4DM3A 4EMUA 1CRPA 3GFTA 4I3FA 1ULAA 4PZ9A 4HH0A 1XJCA 2R47A 2DFKB 2I54A 3PDCA 5IVIA 3CF2A 4N6OA 4QBHA 3VJLA 4L16A 2QSJA 3O4RA 2BFAA 4BWFB 4M60A 2P4EA 2WA1A 3D2CA 3IKLA 4TM8A 5FWYB 4JLJA 2ORYA 2C54A 5KNLA 1O8BA 2CVOA 3LP8A 4KIFA 1D04A 2ECFA 5TVKA 3DCIA 5LQCA 5ENZA 4M1WA 1P1FA 4MI6A 5FNVA 2HFKA 3QVJA 3IDFA 3ZDDA 3EX7C 5EWMA 1VZ3A 4JOSA 3VHRA 3BHJA 5L7TA 3QOFA 1VG9B 4Y1GA 1RRFA 2YYZA 5HIIA 1PVVA 1B74A 3ZE6A 4D8TA 3QXSA 1CNMA 1ZSNA 2YV1A 2OQVA 1NQAO 2FNAA 3PCXA 4MRPA 1EXNA 4DSTA 4MWBA 4OBBA 1R6XA 5HR5A 1JR2A 1L8XA 2VP3A 3GOQA 5F2OA 4DEVA 4DYDA 4X24A 4K9DA 4U4AA 3F6PA 3D5QA 3M70A 5FO1A 3SHWA 3DVAB 2I3BA 4FHFA 2Q6IA 1V6CA 2WDPA 1XZLA 1ORIA 3EVBA 2D3WA 4RHTA 4X9XA 4YT8A 2B7BA 2Z3VA 2JAWA 2QYTA 3NJ4A 4RVSA 2QK4A 3HN7A 2EQ5A 4QXMA 5EVJA 1JIQA 1K4MA 1SUSA 3R1IA 3ER6A 1XAIA 1E5LA 1XNJA 2M98A 4DNFA 4DMUB 2ZSAA 1I5EA 3BBLA 5FULA 1EP3B 2IYVA 1I6MA 2BR5A 3CUKA 4NXNB 1SHKA 3OD5A 4E15A 2XUIA 1U5AA 1CJSA 4E5MA 1S96A 2Y2UA 2FW6A 1HYGA 1P2UA 3KK0A 3LA8A 5K4HA 5K4GA 5AKXA 2BF4A 3LK6A 4GE3A 2VSNA 2YH2A 1SZCA 4YMWA 3IQGX 5FPQA 3VYVA 1OFTA 5ICMA 2IYPA 1NJ5A 4ID3A 4TGLA 1I5OA 1GGEA 2FK8A 3FNEA 4FE7A 5BW6B 5JH7F 4B31A 1G6OA 5FBVB 4Y7CA 1K8YB 3WOHA 3Q11A 3WJ7A 3BGWA 3T06B 1V3QE 1Q1GA 1ZVMA 2GASA 2FN7A 3EZLA 3M4NA 3OT5A 1KJIA 4RHYA 5KYUA 2HREA 3UXMA 3VKWA 1XZJA 3GJ3A 2XVAA 4I4TB 4NCAA 2ZP1A 3NX4A 1V26A 2C4WA 2AOTB 4K03A 1VXRA 3C1AA 1H5UA 3OZRA 3PNYA 5LNK1 4RCYA 5C8XA 1TUBA 1PL6A 2OAEA 4DRXA 3HYCA 3S29A 4YMVA 1VYTA 1FNDA 2B83A 1G8FA 1NMYA 2NVOA 3FDXA 4DDKA 5HG0A 2POCA 3R5KA 2C4TA 3FUUA 5L7YA 1O5IA 3QW4B 1W6RA 3NOVA 3EVDA 4N5NA 2OZPA 2GI4A 2WJZB 2EBUA 3LPAA 1ADJA 1R6VA 4TLBA 3IQFA 5EKXA 2E82A 1O96B 1KYZA 3AR6A 4H15A 1S4MA 1PUXA 1IWPB 4PS1A 3WK8A 3R0JA 4DLZA 3T4XA 2OM2A 4RPKA 1X7YA 5KYTA 3PTZA 1HH4A 1KO4A 2V0CA 1ZVKA 5DM0A 2Q5OA 4I1RA 4R6WA 1VJDA 3REFA 4B32A 4LF9B 4MV0A 1RLIA 3N6RA 4QTZA 5SY9A 1VFPA 1REQA 4CCWA 3A7DA 2XMDA 1YCFA 2HA4A 6PFKA 2XCIA 4JX9A 5EESA 1VMIA 4X6UA 1FIUA 1W5BA 1EZ1A 1YE5A 3MWJA 3QOWA 5C7YA 2XAUA 2VSQA 3ZWWA 2WJHA 2X8LA 2NNLD 3WFIA 4XR4A 3Q6MA 3OFVA 4YACA 5A7HA 2RGEA 4P83A 3DTVA 2JKZA 3T4UA 1QQTA 1FVFA 3AZOA 2GVNA 2GPYA 2H9YA 1KVUA 3L79A 4MUNA 4B6PA 4C7JA 3AF4A 5JG7A 1MQ8B 3TMYA 2PR7A 4O4HA 4TLEA 2VHWA 5HPYB 1MX9A 3TDMA 2HMUA 2C5LA 2HMYB 1MDFA 3GIDA 4OA5A 5KSYA 4IM7A 4R40A 1RZRD 5EXPA 1YTUA 1TJPB 1YCDA 4O33A 5TF0A 4WCFA 1E6WA 3GLHA 2NU9A 1J2RA 4WVFA 1P5ZB 5JDCA 2ZXUA 4CIYA 4BFVA 3THWA 1IHPA 3RT1A 4A5OA 2DQZA 1Z0AA 4YX9A 1OZHA 4RIFA 3DHEA 4X00A 3UWMA 3I04M 2I4RA 1XCMA 2J7KA 3IX7A 3O1LA 1RU3A 2AKAB 1BOFA 2J9XB 2V9CA 5A3RA 5HJEA 1JWAB 1OH5A 3GEGA 1FRZA 3KXLA 2IUSA 1IIRA 4GZ3A 2WSSA 4EUHA 5K0TA 4CG3A 4C6HA 3TLJA 2WICA 2VDWB 2BFPA 3K30A 2QUZA 4R3WA 4JODA 1NAIA 4EPVA 4HEJA 3H1FA 1HSZA 4M0KA 3NEYA 2BEVA 3QE4A 1GAQA 3IPRA 4B3JA 3VGPA 4JSRA 1R6TA 1KYWA 1NIJA 2ZIEA 3QX7A 4DIBA 3PHJA 4HNAB 5M3BA 3SZLA 5IAGA 5HM6A 5KC9A 5KQMA 1RM5A 5KYKA 2RE8A 1FRVA 3VU8A 1O6FA 1IVYA 1R5JA 4NS4A 4RDHA 4Z9AA 1Y5IA 3RRFA 3H87A 4FS3A 2CNDA 3FCOA 1SXIA 2PGXA 1Y63A 2O4UX 3STVA 4E6PA 3L04A 4CIWA 5CURA 1WMEA 4GKBA 4LA4A 4DR7B 3E3AA 2JVIA 3EAGA 5AP9A 2VQEB 1V3VA 2VUIB 4D9HA 5EJ9A 4IXWA 1BE6A 2WAXA 5BYKA 2WHRA 1CY4A 3SJAA 2FPPB 1A2BA 2WJPA 4MW6A 5COQA 2Q28A 3EZNA 1XA4A 1YHYA 2FFBA 3OCXA 4U9IS 3ZD7A 3BREA 3TSWA 4QECA 4QQFA 2WTUA 4NDZA 1XZEA 1JQKA 2OV2A 3C98A 2N46A 4JA2A 1C4XA 1I01A 3QF7A 2OBLA 2GRAA 3DDSA 3SJ7A 3VU9B 2B9VA 4LNUA 5JDCC 3VXKA 3GVHA 4URHA 2V65A 1OLOA 5KNDD 1OX4A 1P0PA 4WECA 4B3HA 1OC4A 3X1ZA 3MIIA 2NUAB 1T9ZA 4FR0A 1R27A 4CM7A 1C3VA 4BBJA 4CQMA 4YAJA 3FKQA 5FLXA 5HA5A 1QH9A 2D2FA 2H08A 3ABOB 3M3PA 3ONWA 1XNQB 5DTRA 4MVWA 3BE6A 1EGMB 3FPEA 2F9LA 2FSSA 3B3JA 2PZKA 1SBIA 1ATIA 1TM2A 3KQOA 1HY3A 1T9CA 5EGNA 3P2JA 2P4UA 3K1YA 4NBSA 3N2LA 3VHXB 4XAQA 3GMIA 4HLUC 1T2CA 2FYTA 4TKUB 3HZOA 3LYHA 3QWIA 2ZLBA 1BMFA 1FFGA 2H54A 3K0KA 3BD9A 1Q7RA 1QH0A 3H65A 3ICPA 3JZDA 4JXKA 3RJTA 2DULA 5G3ZA 1RVV1 5I5EA 2VLBA 1N6NA 2Q8PA 3PFHA 3NONA 1XD2B 2NW6A 3JXEA 4NJMB 1JLLB 4OYYA 5ALMA 5TC4A 5U4QA 4BKOA 5CCXA 2WB4A 4I19A 2BHLA 2BIFA 2FRDC 4P92A 4YRJA 3TR0A 3VQTA 4EPRA 5I8PA 3EDRA 5JZOA 4F5YA 4RJIA 1V6SA 2R4QA 1DEAA 3KJZA 2HLDA 1EHIA 2RIRA 3R7WA 2SECE 4TVKA 1G9SA 5BUSA 4OHOA 5IT4A 2J3EA 3WDSA 2IITA 2PBLA 5TSDA 1GTZA 4EIWA 4GL2A 4C2AA 5BUCA 2VJLA 3USES 3EGVA 3H1BA 5KYXA 5EY5B 3E9DA 4IEEA 3LM8A 3PQ5A 2PH3A 2HJRA 4BJHB 3TEFA 1XLUA 1YV9A 1Q6ZA 4FFOA 4YPVA 5KQGA 1QV9A 2YJ5A 2GWHA 3A9WA 3KX2A 4MYTA 5I9NA 2ZJBA 2CK3A 1Z4QA 4ZTUB 1HZZC 1XXHA 4FYYA 5CEJA 1LA2A 2DFNA 4YRKA 3L1UA 1DOHA 1VYHA 1TKAA 4IJUA 4XSVA 3U7IA 4AMYA 4DNXA 2V74B 4TZ0A 4QOIA 4ZVTA 4BO5A 2E4XA 1U4SA 3KKZA 3L4SO 1KGSA 3L7KA 4QGGA 4F4UA 2QTWB 3U4IA 5BMOA 5I51A 3I76A 4HNRA 3OH8A 4IV8A 1HE5A 4WZZA 3NALA 4PC6A 5CXUA 3DHYA 1CK4A 1AHIA 3LOPA 3AV3A 3GJRA 4EO7A 1PZMA 3W4IA 4LQ4A 3GZ4A 3ZHBA 2D1YA 3OZUA 3ONVA 3PEVA 4G84A 3SEQA 1XROA 1U94A 4FEGA 3WWDA 1CZOA 2Y67A 1K5HA 3D4OA 3L6EA 4YP1A 5JNLA 1U0JA 2HHHB 4MS4B 2RGYA 1CDEA 2GCIA 3AF6A 5BSVA 4XWOA 4TKLA 1QZXA 1ZOLA 1PSDA 1Z47A 4P31A 1U9ZA 4QULA 3W5AA 4QBIA 4J2TA 3X2FA 2Z04A 4HATA 3CX6A 5FI1B 4YAUA 1ZYUA 4B4VA 1EFRD 3ZWOA 1VKZA 1GZ7A 1ZK3A 2GK6A 1TKBA 4INJA 4KB5A 4LVUA 5G3YA 4L4ZA 2Z1NA 2YZ7A 5TGDA 3RRZA 3PVSA 4Q9HA 3F9CA 2I71A 5JBQA 1YL7A 1E98A 3RHTA 5BV7A 4UAJA 2JZNA 1M6HA 2HSEA 2EG5A 4B6JA 2ZB7A 2GRJA 3TEMA 2F59A 2ZR7A 1C9YA 2HSJA 1Q83A 2L19A 4G1CA 2BFDA 5CCBA 1KEEA 4II3A 4ZYZA 2VBIA 4EB0A 2NT3A 2QW1A 3TAHA 4AQ7A 5TY0A 4ZJUA 1A0OA 2GEFA 4L85A 3NORA 1UWVA 2ZYWX 2G25A 1QG2A 4TRNA 2ONCA 4P80A 3AU9A 5G0WA 1A9YA 3BA1A 1D4OA 3F6YA 3MCTA 3ZN2A 4BIIA 1QZTA 4OXQA 2HA6A 2PFSA 3IDZA 5JCJA 4M8LA 1K5PA 2PH7A 1UOEA 1QGUA 3D02A 1JSXA 4KXQA 4QBGB 5K05A 4FONA 3F97A 1MIHA 4P3PA 4FXPA 2NSJA 2CDBA 1N9ZA 2PD6A 3KB6A 3L4BA 4LHVA 3LKBA 3G9XA 2CFIA 4D81A 2JFXA 4EJ2A 4G4IA 4BUCA 2H7CA 3W6OA 4F38A 1DBQA 2C88A 2X41A 4NCNA 1JX6A 1MB0A 2X4DA 3UYKA 5KZMB 3QEOA 5MDHA 2E89A 3AFIA 3IH5A 2AYYA 2A9FA 2JZOA 3M6LA 4DBLC 5KWEA 3ND8A 2CT8A 1HDEA 4TS4A 4D5GA 3ZDFA 4FCCA 3BQNB 3EGXA 4UHJA 2W37A 2H4WA 4RF5A 1ZK4A 1GPNA 2LWIA 2ZWIA 4G3XA 4LDPA 1EFHA 4B6OA 2YIMA 3LLUA 3WSTA 4M21A 3RVOA 1TCAA 5EIBD 4N65A 2VK2A 4EHDA 2UZ1A 4EX7A 3U16A 1PG2A 2QUAA 4OLFA 3RUPA 1PGPA 3IMEA 3I37X 2JLUA 3GBSA 4U8HA 5CGQB 3I23A 1UOPA 1TJNA 4I5IA 2DFTA 3VZSA 2XSZD 1RWBA 2EWVA 2NUTB 2WSMA 3GVPA 2VF7A 4TL9A 5SZKB 3RKRA 4RGQA 4FI3C 4CM4A 4IKPA 3KQQA 2LVBA 3OTHA 2WJVA 3CY6A 3CZ4A 1T5HX 3OZCA 4EM6A 2Z08A 1AVTA 2OC9A 2WWFA 4G07A 1N9KA 4BLUA 5ER9A 2E48A 2D0DA 1KO7A 2CL5A 1D6NA 2PD3A 2FCRA 2EX1A 4YLGA 1UR5A 2AJCA 1U2DC 1TU3A 3JCZA 1QHHB 4ACBA 4ZGGA 4M54A 3T6KA 3JYQA 1U8AA 3HGTA 5EP4A 2XGGA 1NBME 3OIYA 2AFHB 1XA0A 4URFA 3G89A 3QYFA 4ANFA 1Y7TA 2OFFA 4TKMA 3EWAA 3H4IA 3C6BA 4RULA 2ZXEA 2KM1A 3KSUA 1V7ZA 3TWOA 2QL7A 1XX6A 4UBOA 3Q7EA 2CEKA 4W6QA 1VLZA 5F2KA 1C14A 1FDUA 5GGYA 2C77A 4MRMB 1SUWA 4UDNA 2OP0A 2IELA 3SX0A 1ES9A 4BFXA 4YHHB 4JOBA 3LIPA 3GR6A 3EGEA 3E7XA 4QXAA 2WT4A 3LLMA 5F12A 1R88A 4HD8A 2J5XA 3JVDA 4HDNB 4C0JA 5IJAA 1HMYA 3OSUA 4HZGA 4JH0A 1EVEA 1JNXX 1CEQA 1ICIA 5FLKA 4ED9A 4HAVA 1EZZA 2M1ZA 3LRTA 1Y1RA 2PL3A 1TVCA 4JR0A 4WD3A 5EE5B 4KOEC 3TTSA 5JAZA 4RMGA 2WMDA 3N7TA 1KZ9A 2P9BA 3ZW7A 4BL5A 1N2ZA 3OG9A 3PGA1 3AU8A 3TKLA 2QTBA 3HUDA 2V7WA 4ZPXA 1TFUA 1RWWA 4CM6A 4UPVA 2WJAA 3KZCA 1OYWA 4OB6A 4EY5A 2O8EB 4E32A 2PS3A 4UAVA 1VL8A 2HEGA 5I5GA 2YFHA 3E1SA 1D2EA 1O6CA 1IK6A 1A95A 3PQDA 2IYFA 4K6MA 3MMPA 2XPCA 4EFLA 5LQJA 1FJHA 5EJFA 3LHSA 3CE9A 4NEGA 2WC1A 3AZQA 5J40A 4A10A 3JRXA 1AE1A 5E0OA 4IJVA 2W70A 4PEVA 4Z53A 4KAFA 4B3MB 3LG2A 4L5CA 4MYUA 4ZI7A 5BOSB 2GA8A 4OF4A 1IWBB 1DBWA 2XWQA 2SCUB 5GQSA 3G2MA 2AW5A 5IAKA 4CTKA 4AJKA 3ZY5A 4YMGA 3A3OA 5BVHA 4EG1A 4H7IA 3BMCA 2W4QA 1N2CA 1XHFA 2YJZA 3G1UA 1DKNA 1UBKS 4HN4B 4YC7A 3F2IA 5G1OA 1EEXB 1MEOA 2IW1A 2QR2A 3KHKA 3MPOA 4UHHA 3TOZA 3ZWMA 6NULA 1D6SA 3O1IC 4P7FA 2H1OA 2QRVB 3INYA 1NW8A 2X9VA 1XZKA 3OHMA 4I8IA 3K20A 4OYRA 4LJLA 4N5IX 5IJWA 2GGSA 3M1LA 1FU7A 3GG9A 5TPZA 2C4VA 1JLRA 2RFLA 4YRFA 4G2TA 3FMGA 4PFKA 3C39A 4W7IA 4IDBA 4AM8A 4EELA 1PKXA 2FWMX 1DLIA 5EJGA 3DAGA 3SR4A 5E3HA 3HJFA 4D45A 3OEHD 1OI2A 4RS4A 4BO1A 2Q3HA 1YJCA 4BCCA 4AO8A 1OILA 5C37A 2QVGA 4GDFA 1GL7A 4B9AA 3LO8A 4BXOB 4K6FA 4YTEA 5AKIA 3DJFA 5ALDA 1J6UA 3STXA 3R0ZA 3CF4A 1F6WA 2H1LA 4NY1A 2YS7A 1YZYA 2D1QA 1FXSA 1U2GC 4ENPA 1K88A 5LQUA 5KWJA 3JR7A 5CYFA 1F06A 3R5FA 2IDMA 1F1BA 1MXHA 3V4SA 2ORVA 3DD5A 5ALWA 4MPPA 1B0UA 4AJIA 3KSBC 3T7KA 2Q8NA 5CA0A 3X2EA 3QG1A 2FZVA 3JD0A 2BM1A 3TLCA 3AEZA 5AVZA 4P4GA 1JIXA 1APBA 4ERXA 1B0AA 4A26A 3ZYZA 3PE4A 2G9ZA 1W36B 2MT9A 4KL8S 4MCIA 1CZRA