1HY3A

Crystal structure of human estrogen sulfotransferase v269e mutant in the presence of paps
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
289
structure length
287
Chain Sequence
NSELDYYEKFEEVHGILMYKDFVKYWDNVEAFQARPDDLVIATYPKSGTTWVSEIVYMIYKEGDVEKCKEDVIFNRIPFLECRKENLMNGVKQLDEMNSPRIVKTHLPPELLPASFWEKDCKIIYLCRNAKDVAVSFYYFFLMVAGHPNPGSFPEFVEKFMQGQVPYGSWYKHVKSWWEKGKSPRVLFLFYEDLKEDIRKEVIKLIHFLERKPSEELVDRIIHHTSFQEMKNNPSTNYTTLPDEIMNQKPFMRKGITGDWKNHFTEALNEKFDKHYEQQMKESTLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ESTROGEN SULFOTRANSFERASE
publication title Crystal structure of the human estrogen sulfotransferase-PAPS complex: evidence for catalytic role of Ser137 in the sulfuryl transfer reaction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 109
structure length 287
sequence length 289
chains with identical sequence B
ec nomenclature ec 2.8.2.4: Estrone sulfotransferase.
pdb deposition date 2001-01-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00685 Sulfotransfer_1 Sulfotransferase domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1hy3A00
5ELXA 4OI2A 1G41A 1GNRA 1KMHA 4U5XA 1GAJA 4F4CA 1W4CA 1ZM3A 2H17A 3GLGB 2WIAA 2VEDA 2HLDD 4W5HA 1XBTA 1NVVR 3LX8A 2CK3A 4D4KA 4LYHA 3W34A 4HI0E 4LZZA 1Q57A 3QG1A 1FL9A 3H0KA 2EW1A 3KB2A 2F1IA 3VHXA 2ZSBA 1RJ9A 4IDNA 4WXRA 2FH5B 2VTKA 4KI0A 2W0MA 2GCNA 1B23P 4FMCF 4UJ5A 2D06A 1GKYA 4LHVA 4LYAA 1TF5A 3BH7A 3ZD7A 3AKCA 4OI1A 3LX5A 4GMDA 2H7VA 2QA5A 1T6NA 3THYA 3QOFA 3FHTA 2FZLA 3EC2A 2ZS9A 1KK0A 4QHSA 4PR0A 3VR2A 3THWB 1XX6A 1TU3A 1ZUIA 5LPNA 4DKXA 2ASEA 4PZYA 3P20A 3LNCA 4MGKR 1KSGA 2PBRA 4NP6A 3AUXA 4I4LA 3E70C 2G1JA 4ZI2A 3R8FA 1M8PA 4M53A 4MYTA 1ETUA 3CR8A 2KBFA 1PZNA 1ZRHA 2ODWA 2QAJA 1CR4A 2O8BA 2BC9A 2GXUA 4L8GA 2GK7A 2YC2C 4IVRA 4G5RA 1ZJ6A 4PQYA 4PANA 5J4HA 3EZFA 4LBYA 1IXRC 2ZJ2A 1MH1A 2CL0X 4YONB 1P5ZB 4OL0A 3RDPA 1TQ4A 3GD7A 1XTSA 5BN4A 3WBKA 2ORWA 2IWHA 4P32A 3RABA 3TSWA 4F91B 3U6KA 4NHOA 4NCKA 3Q72A 3PQCA 1U81A 4URWR 3GJ6A 3SR0A 4DDVA 5FUXA 3AF3A 1E9AA 3TQCA 1A5TA 2HUPA 4ZO4A 1XD2A 1Z0JA 4UQOA 1LB1B 4BRWA 2CBZA 1XEXA 5HKKD 3KJGA 5EJEA 1TPZA 1NKTA 1M7GA 4QBHA 4Q4HA 4BZXA 3W5IA 5SZIA 2ZXUA 1FW6A 3IEUA 3P1JA 4D4LA 3W5JA 2Q3FA 5DNYB 1NNEA 1KSHA 3EG5A 3BK7A 2FZ4A 2CHVA 4YXWA 2ZRPA 1OH5A 2VP0A 3K70B 2HJVA 2NO0A 2EQBA 2GXQA 3BXZA 3U5ZB 4CEIB 3IQWA 3P27A 2XAUA 1VCNA 4I1VA 1KO7A 1T91A 2ZRHA 3KZ1E 2QI9C 3D3QA 4ARZA 5JHGB 4Q00A 1KNQA 2GJSA 4G5SA 4LOAA 1AQYA 1C1YA 2VSXA 1J70A 4URVR 4EJSC 3AEZA 4C0HA 3TE6A 5IHPA 2KJQA 3LQQA 3K9NA 2B7BA 3PIRA 3R20A 1RPZA 2IYWA 4NL4H 1XTQA 1XDBA 1N5JA 2YNMA 4PAOA 4TYPA 2H8KA 2IYYA 1G5PA 1G64A 2C96A 4HEJA 4LV6A 5AUQA 1OXUA 3T34A 5TDHA 1K6MA 5G40A 1SXJC 3GLFB 4MITA 2ZRKA 2QEQA 1OYYA 2C8VA 5B58C 3MLEA 3ADKA 3UXMA 1Q1ZA 4JJKA 3CO5A 4TSFD 5C46F 3RS7A 1CULC 2BM0A 1IY1A 1LW7A 1GUAA 1SKQA 4RZUA 2OBLA 1N6OA 2XNDA 4M1WA 1S9HA 1G9XA 4PC7A 4C4PA 3BWDD 2OFOA 3RRZA 3GEHA 4Q4JA 3OFND 4B6FA 1AGPA 1X8LA 2FNAA 1LNZA 2IYRA 4FI3C 4IDPA 3A58B 3WRYC 3SEAA 3VR6A 3CH4B 4PQRA 3C4JA 1YQTA 4KFUA 5FI0B 1NIJA 1GNQA 1SVWA 3TSZA 1CJUC 4D0LB 4Q5IA 3ZVMA 1ZM4A 1WB9A 3NC0C 1EFCA 1XTRA 4B3DA 2D3WA 2ZRFA 4EFMA 4Q01A 1Z6AA 1P61B 4LRWA 3OAAD 5EUQB 4A82A 1LF0A 4KO8A 1ZU4A 2QMEA 4B6EA 2PMDA 2WMNB 5KNDA 2FEMA 2XTNA 1S9DA 4OHWA 4Y0VA 2VYFA 1DS6A 1W36B 2B92A 3Q7QA 3UANA 4BZQA 3QXHA 3NTUA 3ICQB 1GL6A 4V0KA 4YDHB 5EXPA 2W6ID 3BC1A 1KO4A 3HDTA 4QNRA 3V9PA 3U7HB 4XJXA 4TLEA 1XMIA 4PC1A 2QBYB 1BOFA 5EZ5A 2H16A 2IF0A 4BFSA 5FTJA 5JJIA 1AKYA 2IWRA 2QENA 3VKHA 3RLFA 5FBVB 5K8IA 1KYIA 1ZM2A 1Q20A 2J5XA 1GIAA 4IXMA 3U4QA 3AKEA 3PUXA 4TLDA 5DHAA 4RKFA 4D81A 1KI3A 2BIFA 4IVPA 1HA3A 2W2XA 2C2HA 5TB5A 4UNNA 1QVRA 3UPUA 1M74A 3OZXA 1ESNA 1RJ9B 4EJSA 2J1LA 3LLMA 1W44A 3AH8A 1IAQA 4NCIA 4TL6A 4K81B 1E79D 1E4VA 3THOA 2ATXA 2QAGC 3DKVA 2W58A 1Z0KA 3TK1A 1YZKA 4DZZA 1EK0A 1GDDA 4JJZA 1G6OA 3PFIA 2OLJA 4OBEA 4OQFA 4US2R 2IEZA 1SULA 2ZI7A 4ON9A 2JIZA 2YJTD 3G0HA 3Q5DA 4QJ4A 4V0MA 5DI3B 3TMKA 3AQ4A 1QHHA 4D4JA 1JI0A 3KDSE 3SQXA 1WE2A 4FW9A 4HB2A 4LJ9A 1IN8A 4TSFA 1E96A 4XTCS 3DPUA 5BN5A 1G20E 2ZU0C 3QIAA 4M1SA 4NMMA 4B3GA 2ZR7A 3HP1A 1LV7A 2QMHA 3IPYA 4Q9KA 2IF2A 3PG5A 4KVGA 1NL3A 3HR7A 3OFNA 4FMDB 3I4LA 4IFBA 1NLZA 4CEIA 3EA0A 1T8TA 1E2HA 4GOKA 1CJMA 3MAAC 2O52A 5FBWB 2RGDA 1DVRA 1HYQA 1J90A 1D9XA 3PR1A 4MRVA 1OKKA 3ZS9A 2QRNA 4DEYA 4JLPA 4OHXA 1OPXA 1OFTA 1RZ3A 1KI9A 2H5EA 3A36A 4QBFA 4Q4AB 2ZROA 3SJBA 3GLHB 3CRQA 3KKQA 3OAAA 1QRAA 4PQFA 2J0VA 2QTVB 3EC1A 721PA 2NO7A 5H68A 3NBXX 2WWIA 2EWWA 1W2HA 1ZC3A 4CRWB 1HY3A 4P33A 3UWKA 1W5SA 2JEOA 5JEEA 2I3BA 3EIQA 5CB6A 5G3YA 1GOTA 4M2LA 1F5NA 2ODBA 4DXAA 2EFCB 2LWIA 1E2EA 1QHXA 3SNHA 5SZJA 1YZUA 2ONKA 1NJGA 4NONA 3A8TA 4HLUA 3B9QA 4MDEA 2ZSAA 2ZYWX 3WP1B 4XVQA 5J5CA 2WJIA 2ZEJA 5J4KA 2BM1A 1IONA 2YWFA 2JGNA 1XEWY 2YHSA 4JLDA 4Q21A 2VH5R 1X1RA 4ITRC 1Y63A 1Z0AA 1DO0A 2OCBA 4DDTA 1E99A 3CBQA 1A7JA 4EPWA 1HQYE 2YVUA 4TTPA 2QMOA 3C5CA 2ZUCA 1TQ6A 1R8SA 1E1QD 1IN6A 4DLVA 1NP6A 4G1UC 1JAHA 3JVUA 2ZYTX 5GJVC 1MT0A 5BYJA 1KDRA 3SYKA 1MO4A 1FQKA 4KFTA 2JLQA 3LQRA 4MGYR 4A8JB 2VQSA 4B2PA 3UK6A 2HXSA 1FP7A 3B1WA 1RC8A 1E79A 2QTFA 3KTAA 4WOPA 4Q1DA 1E2JA 1Q21A 2IHBA 4I1SA 4LYFA 1AQUA 2PCLA 5FUYA 3B2EA 2WJJA 3T1QA 4JLJA 1NLYA 2E9SA 2ERXA 4WIAA 4OQNA 2WVJA 1WRBA 5C4GB 3SQWA 2N1BA 1BS1A 3AKDA 3Q8XB 4JLOA 2FPMA 1TTTA 4RCZA 3AF2A 1AZSC 2AD1A 5HE9A 1S2MA 2QM8A 1TEXA 2QGZA 3K0CA 2PX3A 1GG2A 4MYCA 1MR3F 2BEKA 1G3RA 2ODNA 4MYHA 1FOEB 5H1YA 5L3QA 3QKRA 2PLRA 2OCAA 4JLVA 2WJVA 4DLTA 1OKKD 2GK6A 5EE1A 4XWOA 3U44A 1G291 1XU4A 1QHYA 2FV8A 3HR8A 1NN0A 3DOEA 3BH0A 3U7GA 1MO3A 2BKUA 3QI2A 4IJMA 4LC1A 2IS4A 2GEVA 1E2IA 3LVRE 1GKIA 3U7EB 3SFZA 4KBGA 3KQHA 1OV4A 1N0WA 3BRWD 4Q1CA 1DAFA 3TJZA 4A0HA 2PLFA 4DUGA 4CEJB 4I81A 5KDLA 4BECA 4DLXA 1W4RA 821PA 4EAQA 2CL6X 3LDAA 5FPHA 1WXQA 4TT3A 2QSYA 4YLGA 1QBKC 2QORA 3SZRA 2J7PA 3BIFA 5BW8A 2YV5A 4TYNA 3R9WA 4NDZA 4S35A 2JJ1D 3GJ4A 3TIFA 1OIWA 1AGRA 4GPTA 4L15A 1W0JA 4Q4JB 1II9A 3X1WA 2G77B 3I92A 4GOXA 5E7IA 1TX4B 1NBMA 3REGA 4H1VA 1KDPA 2ZJ5A 1D6JA 2CCJA 2HJGA 2BVNA 2EU8A 3THYB 4B74A 1C4OA 1IJFA 1XTIA 4HAZA 4TQAA 3R7WB 3T1VA 2XSZD 5CITA 5FBLB 4LV8B 3GLHE 4N3NA 4QG7A 3W90A 3QF7A 3ZLJA 5TV2A 2B8TA 1PV4A 2VP6A 2K5UA 2CHQA 2RH5A 1N6KA 4L5BA 2X2FA 4ZKEA 3SE0A 4Q1EA 4DLRA 4L16A 2GKSA 1N6PA 4B35A 1X8JA 1IBRA 2ZRNA 1R0WA 1ONBA 3B7GA 4C0SA 3W6PA 5DN6A 5KDDA 4UXJA 3QXJA 4LJ7A 5JFGA 3QEOA 2D7DA 1NVXQ 3QJYA 2P5SA 4LWZA 4AURA 1N5IA 2J0SA 1NF3A 3ZVNA 5JHHB 2ZITA 4PO9A 3QSYA 1A1VA 4F4JA 1YHNA 4B3CA 1AK2A 3JZMA 2Q3MA 2PZGA 1E9EA 1E9CA 2I4IA 2REOA 4B73A 3GJ3A 2FEOA 3DMNA 3KKMA 3D7MA 5EE5B 4ABYA 2GZDA 2GVDC 4YMVA 1Z2AA 5JCZA 2F6RA 4OYHA 3IBGA 1WBBA 2HXYA 2ZRDA 1VMAA 1Z5ZA 2AKYA 5BQ5A 5CK5A 4F92B 4MUAA 1VG1A 3B82A 4DC9A 1XEXB 5CM8B 4NCJA 1ZBDA 3BFVA 3W8RA 3CZQA 621PA 2EYUA 5GADl 3K09A 1JPJA 221PA 3CPEA 4OHVA 2IYUA 5HE8A 3DOFA 4AKHA 2QAGA 5EXTA 2NO9A 5KU1A 4D25A 3I3SR 4JSTA 3WHKA 1HE1C 4UJ3A 1UEJA 3QF4B 3ECCA 3ZVLA 3DM5A 4ZCLA 4B3FX 1BMFD 3EARA 3N5CA 5KSOA 4V0NA 3LW7A 2ECKA 4PSAA 1CRPA 4KITB 1OB5A 3GLGE 1HTWA 3A1SA 1J8MF 2Q9BA 2RGXA 3WP0A 2ZS8A 4WAUA 1R6BX 1FNNA 2OHFA 4CYMA 3W9YA 4LI0A 4OK3A 3AVYA 2PX0A 4OI0A 1S96A 2ZRLA 4DT1A 1WF3A 1E9FA 4JVSB 5L3RA 2Z4SA 1FFHA 3NH9A 4DSUA 2F1HA 5JWOA 4X8OA 2J7PD 5JWRA 2ZR0A 2XGJA 5JS8A 3ZGXA 5JJLA 3B13B 2BHRA 3MWYW 3SI7A 4R2IA 4B48A 1W49A 1NBMD 5FPKA 1R10A 4GT1A 4MRRA 1X3SA 4NYJR 2AL7A 3TR5A 2TMKA 3MFYA 5L3SB 4XSGA 1Z22A 1DADA 1EFUA 5ANRB 3ZD6A 2QP9X 4L4UA 3PEVA 4KJZA 3OE7A 3U44B 4HDOB 2X77A 4Q4HB 2NMVA 2X8AA 3A1UA 4EQ6A 4AYWA 4XD7A 3BB3A 1MABA 1CS4C 2E1RA 1U0LA 1X1SA 2ZSFA 5FI1B 3A1VA 3AVWA 1F2TA 2C9YA 3SFVA 2CLDX 5JSZA 1KDOA 1R8QA 2G83A 1OXSC 3K9HA 3SS8A 1JQLB 4ZIRB 1KMHB 3IGFA 3ADBA 2WWGA 4KV9A 4AKGA 2P2LA 3CZPA 1JXOA 5LB2A 3M0EA 3NDPA 1JBKA 4JSYA 4N0EA 4URYR 3RSOA 2W2VA 4KU4A 1EX6A 3LA6A 3FGNA 5KUTA 3KJIA 2REBA 2O0HA 2OXRA 2ZETA 1GITA 1NMXA 4GSYA 2G3YA 3T15A 2D7CA 1ZVQA 3D31A 2WJHA 3BERA 4MH0R 4LSGA 2FOLA 3AGQA 1R0YA 4NE2A 1RRFA 3QVVA 2IXGA 1U8ZA 3WNBA 4A0GA 2ZI5A 1OE0A 1OT3A 1UPTA 2HCJB 2A5DA 3W8NA 4AC9A 4JVNA 5FPSA 2FSHA 2GZAA 3DZDA 3AB3A 4HZUB 3BS4A 2ZYVX 2AHOA 3WYGA 2NQ2C 1XRJA 2DY1A 3C8UA 3PV0A 5K8UA 3Q5EA 1VPLA 2ZM5A 1Z2CA 1SXJA 2C78A 1N6RA 1OH6A 4LUCA 4JT4A 4JL6A 2BBWA 2F1RA 3ASZA 4Q7MB 3N70A 1NG9A 4E07A 3I62A 4U02A 1Q0UA 1O87A 1D8TA 1Z0FA 4ERNA 4NYMR 3HPQA 3LBIA 4DB4A 1E2GA 4US0R 1KSFX 2ZSEA 3PUYA 4PO8A 3A6PC 2CVHA 1WQ1R 1CJTC 2GJ9A 1N0UA 4M4SA 4NYMQ 1WA5A 3I5XA 2ZI6A 3ICEA 1WDTA 1XD9A 1YRAA 2WAXA 4MQBA 1OHHD 4FMBB 3T61A 4ZDIA 2JDID 3PUWA 2N46A 3OIUA 1R5NA 3SN6A 3O47A 4NCNA 3WBJA 5JWHA 1LTQA 2A30A 3LWNA 4BFTA 3ZYCA 1A82A 5A4JA 1IXZA 1NBME 1OFHA 4FN5A 4WZ6A 2DFTA 1OH7A 2QMUA 1S8FA 4GNKA 1E0SA 2G9NA 5SZKB 2AXNA 3PCRB 1KI6B 3OEEA 3ONWA 3VNUA 2C04A 4MRPA 4RJLA 3FVQA 3L0IB 2R2AA 1KI2A 1AZTA 1W47A 3B1YA 5JI2E 2PL3A 3BGWA 3GJ8A 1ODFA 1PLKA 1AIPA 3RWMB 4C7OB 1VHTA 4I99A 4RZXA 1T9HA 3K0AA 1AS0A 2VF8A 3KUDA 3OE7D 1FUKA 1NSTA 4KYIB 2C5LA 4QXAA 1IN5A 1S0UA 3GMTA 2GVZC 5F3WB 4LHWA 3B8HA 2B6HA 4TMWA 2C9OA 1U8AA 2GWHA 2LKDA 3MRSA 1ZW6A 2ZRCA 2WWHA 2FFQA 1Z07A 4Q7LA 2FFAA 2XZOA 3TVDA 3B85A 2VP4A 4HSEA 3TKLA 3VX3A 3EZ2A 4LGMA 1SGWA 2B8WA 3H4MA 3RS0A 4R9UC 1LFDB 3WMGA 1EFRA 1Z0DA 2YOGA 3KKNA 5GVRA 4CVNA 4DIEA 4C2UA 1ZU5A 2WJGA 1XCPA 2GA8A 4M1YA 2ZJZA 3UG6A 3TRFA 1Z47A 3KQLA 4NYIR 1SKYB 4BLOA 2ZRBA 4KCGA 4V0OA 5K8TA 1FX0A 3UKDA 4CF7A 4LHXA 2AX4A 1SXJE 5F9HA 4F93B 3EXAA 1YR8A 2WPDA 5FPTA 4KSBA 1UKYA 4LK2A 4BLSA 3X1ZA 1CR2A 2F1JA 1S1MA 4MRSA 1F48A 1T5LA 1XWIA 2H57A 4CDGA 3FKSD 4V02A 4GZMA 4GFDA 2RGNA 1MO6A 3CF2A 3I72A 4HLCA 3ZVRA 1A2BA 3E5HA 3GJXC 2QPAA 2DR3A 4EQ6B 1DG1G 1SXJD 5JRZA 1GL9B 3VKWA 2CEAA 2V54A 3ZIAA 3IO3A 1P4SA 2YZ2A 2FX3A 2GNOA 2NO6A 4BFZA 1UAAA 3IO5A 2PMKA 1LVGA 2G6BA 2QL6A 5KSZA 2ZAOA 2OM2A 1Z6YA 2AR7A 1TMKA 2IHYA 1XD2B 2CCGA 3FKQA 4AG6A 3ADDA 1E2MA 2DFKB 1XMVA 3FTQA 3K8YA 1E2QA 3QNUA 1KHTA 3TBKA 4JL8A 2QPTA 2ZVQX 5DLQC 1CIPA 4D0NA 1KKLA 1F6BA 3GLFE 1XMSA 3THXA 3MD0A 1G8HA 1IOZA 2OSBA 2ZSDA 2XOKA 1YZGA 3X1YA 2OEPA 2RGAA 3OEED 1XEFA 3LXXA 2GEUA 2WSSD 4KBFA 2GJKA 3R7WA 1UKEA 4ARZB 4B3XA 3O8CA 2ZJOA 4G5OA 1OW3B 5C4MA 3ZQ6A 2KWIA 1VG0B 3CIOA 1MABB 1AM4D 4ZDJA 5TMPA 1WP9A 1F3OA 4PC2A 3SOPA 3H86A 1TAGA 4XTRA 3VR3A 4UKDA 1DE0A 4FWIB 1M1YE 5EP1A 5KNBA 2ZUDA 3SBEA 4JLKA 1KJYA 5TY0A 2BMDA 2A5GA 4DCNA 1RRCA 2O8FA 1V43A 3CPJB 1FMLA 3MWLA 1KAOA 4Q1FA 3A37A 1G3IA 1GNPA 2DWPA 2QM7A 3S1AA 5CYOA 1FZQA 4S2EA 3FE2A 4WZBE 1EGAA 1JXMA 4EUNA 2EFEB 1G8YA 4DLYA 2CE2X 4GRAA 4P31A 1SHZA 3GJ5A 3IEVA 2JLYA 3BFXA 1PJRA 2J46A 2CNWA 3AGPA 3VQTA 3CNLA 3FMFA 5FFMA 1OIXA 1MKYA 3FPAA 2EFGA 4B71A 2JLWA 2VPPA 1ZYUA 2FGKA 2IS6A 2V4ZA 3LH5A 3QG5A 4F38A 5JLJA 1UADA 4B33A 4BGDA 4DCVA 3GLGA 2VP9A 4NU0A 4IDOA 1JPNA 5KTYA 3H84A 3QKSB 4DRZA 3CW2A 2PEYA 2GBLA 3OF5A 3DVLA 2LKCA 4TLBA 4R98A 2V7QD 3ASYA 6Q21A 5J47A 3L8ZA 1Q3TA 3Q9LA 4B47A 1EFTA 2A9KA 4RD0A 3VR1A 3NVAA 5LD2C 1UBGA 2HYIC 2CL7X 3K0FA 3IIMA 3T1TA 3LVQE 2VL7A 3BE4A 5E4FA 1KK2A 1E32A 2IUSA 3JVVA 1D2MA 5AWFC 3K0SA 2WKQA 3EW9A 3NC1C 5FUVA 4P4UA 1CBUA 2ZRJA 4BPBA 1QVAA 4P4SB 4I1UA 2GILA 2CCKA 3U7FB 2JLZA 4QNMA 4DBLC 1R0XA 1KO8A 4IKEA 2XOKD 4BFWA 4DJTA 1GRNA 3BD9A 4QGHA 1W46A 1U90A 2XZPA 2HLDA 2F55A 2X19A 3WRXC 1AS3A 2FA9A 2WZQA 2GJ8A 4GZLA 3R9XA 2ZPTX 5C18A 2UVQA 2CJWA 4UNQA 5HCIA 4D0GA 3HU2A 2G0NA 4CW7A 2FWRA 2IUUA 3KJEA 2XTMA 2EWVA 3IHLA 2BBTA 1NY5A 4TMVA 1Z29A 2WWFA 3SJZA 5UKDA 1ZNZA 5KNCA 3EAQA 1XMJA 2QZ4A 1Z06A 2HEIA 2P6UA 3LBNA 1COWA 1X8KA 3PITA 3BFKA 4JL5A 1ZM9A 4A6XA 4WZAE 3LO5A 1P75A 3RS2A 1VHLA 2B7CA 3LRPA 3I8SA 1VG8A 3C15C 4TZ6A 2CJWB 2XX3A 4JZKA 1HURA 4UNPA 3SHFA 3U2QA 4RKEA 5LB4A 2BMJA 2UKDA 2PJRA 1NN5A 3ND8A 2BCJQ 2C03A 2GBLC 4DB2A 4XOIA 4A9AA 5H8WA 1VCMA 1UDWA 1RIFA 1XTJA 4GDFA 4LPSA 1JECA 4V03A 2WV9A 2H18A 3NBFA 5DGXA 2NZ8A 4EIWA 2XITA 1DO2A 1F2UB 2P3SA 1N6HA 1N6LA 2JASA 3G82C 2KI5A 4JS0A 3EIHA 3L0OA 1G7RA 4M1KA 4ESHA 1QHGA 3W6OA 4DSTA 3VHLB 5M04A 2C9CA 5FTLA 1FTNA 1E1RD 4PC3A 1H8HA 3A1WA 4QFMA 4A15A 1KY2A 2D4HA 3V4FA 1GRRA 4DLZA 1ZIOA 3EPKA 4QC2A 4DHEA 3T06B 3UG7A 4JLNA 2IYZA 4Q7KA 3GP8A 4KXFB 2VP2A 2ZE8A 4Q18A 1HT1E 4JBYA 2KE5A 4URZR 4DLWA 4EPYA 2V7QA 4OJQA 2EFDB 4D6PA 2IXEA 4QBGB 1RRGA 5CM9C 1G7CA 1RKBA 2A3RA 2NZJA 1QG4A 4KLNA 4ZDKA 4TYWA 4N0DA 3VU9B 5DYGA 1VCOA 2ZAMA 5D3QA 4O25A 1DARA 1DEKA 1QF9A 1Z08A 2VSFA 4L9WA 3X1XA 2G1KA 2OAQ1 5FBQB 1Z0IA 2ZE6A 3WNDA 4YXWD 1A4RA 3RYTC 3IBYA 3IDQA 4HB0A 1R5OA 2WOOA 3SYNA 1XNJA 4A4DA 4W7SA 4ZI3A 4YC7A 1UKVY 4Q9IA 5CYPA 1XCMA 4TN1A 1II8A 3I73A 2VA8A 5CJPA 4G0NA 4QGGA 4QL3A 5CLLA 4IW3B 3WYFA 3P26A 3QQ5A 1XPRA 4MDFA 4RD6A 2FGJA 1Z28A 3KXIA 4HDCA 3LW8A 4AD8A 1CLUA 1CTQA 1HE8B 1VKJA 2BKEA 3LBHA 3LV8A 1SVMA 1M6NA 1W2GA 2W6JA 3JZAA 3L43A 4PAMA 5CIQA 3UWOA 1KJZA 5FOWA 1JJ7A 4MYUA 1EXMA 2YOHA 4DDWA 2F9MA 4JBWA 4NZYA 1CR0A 1ZAKA 2FG5A 4KLZA 4W5WA 4UXIA 2V3CC 1G5TA 4GP7A 2ZIAA 3AVUA 2O8BB 1QG2A 4D4MA 1COWD 1EFHA 3F3YA 2BBSA 4TTQA 3U6BA 2ZRGA 2R65A 4PHFA 4Z51A 1HUQA 4WW0A 4Q7JB 2YINC 2WM9B 2AFHE 2NG1A 5HZHA 4YMSA 3LAWA 4XWAA 1T4GA 2XNDD 3C41J 4U00A 2QAGB 4CGZA 5FOVA 3VFDA 2OO7A 2ZJAA 1H8ED 1HQCA 2QSZA 1F2TB 2CLSA 1G6HA 5IF9A 2OILA 2YKGA 5KSYA 1KIMA 3RRNA 1G7SA 3QBTA 1ZCAA 5E7MA 1E9SA 2GF9A 2IYQA 2XJ9A 4X8HA 1BIFA 3A4LA 1ELOA 1US8B 2DBYA 3H1TA 4DWJA 3GJ0A 5AJWA 5LDDC 3N2IA 3IIJA 5G53C 1RW4A 1M7BA 3PENA 5EE3A 4A36A 2C77A 5HTKA 1E1RA 3TVTA 4C9BA 1FUUA 4Q4AA 4DT1B 2ZI9A 2AXPA 5E95A 3OIWA 3QPUA 2R6DA 3AUYA 1KAGA 1LS1A 2WAYA 1G3UA 4FCWA 4L9SA 3AF1A 4OQLA 3T5DA 1N6IA 1XP8A 1KI6A 2CVFA 3IHWA 2GDJA 1N25A 1CEEA 3C16C 3KFVA 1R5BA 1KKMA 3FMIA 5C2JB 5AUOB 2Z83A 3SC3A 4F7WA 2W6IA 2O8DA 3UMRA 3OESA 3T5GA 2GF0A 1G8PA 5EP2A 2DCUA 2LCFA 3ZQJA 2OLKA 1E2LA 1I2MA 4XVRA 3DEFA 4D80A 4TL8A 1GSIA 4C0BA 3B60A 2JJ8A 5AUNB 3CWQA 1QHNA 2FE4A 3EPJA 1RYHA 4TYQA 1G16A 2Z0MA 3CX8A 1GZSA 5FOSA 2RGBA 2GCOB 1I4TD 3ND9A 1U0JA 2G0TA 3PUVA 1CP2A 4Q66C 5IK2A 1F2UA 1ZUHA 1JAIA 4C0QC 3NBZC 3TR0A 1T5IA 1RVDA 3DL0A 4OHYA 3LXRA 3VKGA 2IK8A 4CT4B 5CJ2A 2XXAB 5BWMA 2CK3D 4AWXA 2REXB 1TF7A 1D9ZA 2VF7A 3QBVA 1BYIA 2XEXA 4IEEA 3RANA 1E3MA 4O3MA 5F2EA 2H92A 1S4QA 1VCIA 2FF7A 4IHQA 5A0FA 3KTAB 4IFEA 5TVKA 1RRPA 3W3AA 4IEIA 2H1LA 1VYTA 2JIZD 5EUMA 1P2VA 4HZUA 1KNXA 2IC5A 2VIIA 3A1TA 3BAFA 3PUZA 2ERYA 3NEYA 4TZ0A 1KI4A 1HT2E 4Z8XA 2BDTA 3TLXA 4G3XA 3K0AB 3VMFA 3WYAA 5GJBA 3M4YA 4IOLA 2IYSA 4ZCMA 2DYKA 2OG2A 2BMEA 4LC0A 4XIGS 4Z1MA 4TLAA 2BJVA 2JJ2A 1ANKA 5JI3E 1H8EA 5LD2B 1GL7A 2NGRA 1G7TA 3CRRA 3MCAA 3PXGA 4WBSA 1G1MA 4IDQA 4M22A 3TGPA 1SZPA 1PUIA 3NIBA 2FN4A 4C0KA 2RHDA 1BYUA 1KK3A 2A2ZA 4HYYA 5L3QB 4OQMA 2ZYUX 2QQEA 2OESA 1II0A 2Z43A 1XZQA 1FMJA 2OCYC 1IN4A 3LLUA 4RVCA 1DAMA 2GTPA 3L0SA 4QOSA 5DI9A 3W6NA 4RCYA 2WHXA 3NWJA 4JBXA 4AK9A 5EQTA 2ONJA 5FR2A 1YJ5A 3VX4A 4DCSA 4PHTA 4PC6A 4IXNA 4RD3A 5IDVA 1NI3A 4MUBA 2PZFA 2VBCA 3C7KA 1AS2A 2RGEA 4II7A 1NG1A 4PHHA 1NRJB 4BE7B 3U4QB 1KO5A 1RE0A 1NMYA 5EP3A 3THWA 4TTRA 5J4VA 3K0FB 1U9IA 1E2DA 3HPRA 1Z6XA 5HKKA 1KTVA 1Z8FA 4BWYA 3VNVA 2QT0A 2OT3B 2FU5C 1Q1BA 3PEYA 1OSNA 2XB4A 4LV5B 3KB1A 4Q1AA 2AN9A 3QKUA 3RVBA 3ZJYA 2YOFA 4Q02A 4C0LA 3FOZA 4PO1A 4PPGA 4BEBA 1KSJA 1ZP6A 2IBMA 4CEHB 2D2FA 4EFLA 5IK2D 4PSKA 4TMKA 2PT5A 1Z6TA 4LHZA 4RFSB 1QDEA 2VHJA 1W4AA 5B30A 1L4YA 3GJ7A 3SBDA 5EZ6B 2MSEB 2IXFA 2GAAA 4QHTA 2DB3A 4F4IA 3RAPR 3TSOA 4JKYA 2QPOA 3PVSA 4EDHA 4HAUA 3WY9A 5FOUA 2NTYC 1BH2A 2V55B 1DAKA 1W4BA 3GLIE 3EWSA 2ZJ8A 5KSPA 5JSZB 2Y8EA 2P0EA 5FH9A 4M1MA 1P7CA 2P6NA 3HYRA 1IJEA 3LFUA 4OI4A 4RZ3A 3CLVA 5IRCD 2PJZA 3EZ6A 3SYLA 1P6XA 4ZV4A 4HLDA 4M1TA 4EPXA 3N2EA 3IPXA 4HDQB 4AKIA 1LY1A 2QQ0A 2V6IA 2V9PA 3MUFA 2ZR9A 4M8NE 5AUPB 3C14C 4HAWA 1UEIA 4DVGA 2GRJA 5FL3A 1KK1A 1VIAA 4PPQA 2I1QA 3AVVA 3GLHA 3B9PA 3QVUA 1SVKA 3SJAA 1YE8A 1KJWA 4YDSA 5KHOC 1OF1A 4RSGA 1DPFA 4Z1MD 4EPVA 4WVFA 3REFA 1GRQA 2JJ2D 5FUWA 3DHWC 4Q9HA 2RCNA 3G5UA 1E9BA 3GPLA 1W36D 3CRVA 4LJYA 4M9QA 2ZE5A 5G41A 3FDIA 1AKEA 2IYTA 4G01B 1XD8A 3QY0A 3KQUA 3DZ8A 3K1JA 4DDUA 3EPHA 2DWQA 5AJZA 1R7RA 3KQNA 1UDXA 5EE9A 3SHWA 1IM2A 4PPNA 3FHCB 1U94A 3EIEA 1GILA 1ZD9A 1OJLA 1XPUA 2QY9A 4W5JA 2WIBA 3QPWA 4Q9LA 1KOFA 5JZVA 3MGCA 1JNYA 5BN3A 2AK3A 4LBVA 5JCPA 4LDJA 1CJVC 2PH1A 4OJKA 2RHMA 2XJ4A 3IQXA 3L2OB 4DUGD 4BFXA 2NPIA 1MRNA 3ETLA 4M21A 2J0UA 1W1WA 4TT3D 5FOXA 2CLCX 3DDCA 1MRSA 4LYJA 4HUQB 4W9MC 1CU1A 4M0LA 1UBEA 4A1FA 5BXQC 2IYLD 2JJ1A 2WWWA 4URXR 4H1UA 1NVWQ 2GETA 1E98A 3I5YA 1UFQA 4LJ6A 4M9ZA 4AYTA 1KZ7B 2CHGA 5TARA 1VTKA 2JLRA 2ZE7A 1N6NA 2WTUA 1KY3A 3FFBA 2GHIA 5JBQA 3ADCA 2V1XA 4UNRA 3NBYC 1M2OB 1L8QA 4Q47A 3H2YA 1G17A 2BV3A 5HR5A 4TLCA 3T12A 1KZGB 2DHRA 3RS3A 1TADA 1J2JA 5E3HA 1XXHB 1EWQA 2JCSA 1NJFA 3BB1A 3QE0A 2OAP1 4ZPXA 4A2PA 4X8MA 1XTKA 4XWKA 5CIWA 4AY2A 2OXCA 2HYDA 1J7KA 2OCPA 2VHTA 2FFBA 4QRHA 3O8RA 1FP6A 4FXPA 2ODEA 1D5CA 4US1R 4ASUD 2J0QA 1YZQA 1VG9B 1KO1A 1TF2A 3U60B 4QGAA 4HLQB 3RS5A 2DFLA 2QG6A 2DWOA 3FYHA 3GQBA 4C0JA 2FSGA 3E2IA 1U8YA 4FCTA 1XFAA 2ZTSA 3CPHA 2VHQA 5DHFA 3K09C 1XJQA 4V0LA 2IT1A 5AR1A 2GJAA 2YWHA 1R0ZA 1VYUA 2O8EA 2B21A 1J8YF 2PT7A 1RFLA 3FB4A 3WNCA 4BFYA 4TMZA 4OHZA 1NIPA 2DFNA 2OUKA 5JEDA 4BASA 3S1AB 1U0HC 2ZI4A 5AJXA 3O8DA 4A0RA 1ZNWA 1NVVQ 3WMFA 1KI1A 2R6CA 3I8XA 8OHMA 1L2TA 1N3BA 2J0UB 1YRBA 2RAPA 1NMZA 4TQUS 3CM0A 2DPXA 3A4NA 1BMFA 1XB2A 3QXXA 1E94E 2VRWA 4C0AC 2CDNA 4J0QA 4LX0A 4RD2A 1D2NA 4EFNA 1E2KA 1JQJC 3GFPA 4GP6A 3OHMA 1S1CA 2O8DB 1QHHB 1N2CE 1CKEA 4NKRA 2WMOB 3B1VA 2JAQA 2C99A 2QNRA 4HAVA 1G8FA 4C2TA 1QZXA 1JEDA 4DCTA 1P60A 1TUIA 2ZUBA 2WJYA 4E5UA 3A4MA 2IYVA 2ZVPX 2HF9A 4LJ5A 5KDOA 4HAXA 1DTSA 5HCNA 4MKHA 4AIIA 1DAHA 1OLOA 2WKPA 4NYJQ 4IOMA 4HZIA 3RHFA 3U3JA 1X86B 4Q48A 2O0JA 4DIDA 1A2KC 1BKDR 4C7OA 3FWYA 3MJRA 2R44A 4G5QA 4LBWA 4XD7D 1E9DA 1OH8A 1E1QA 3CF6R 3CNOA 3KFXA 3B1ZA 2HCBA 2ORIA 1JR3E 3SDZA 2X1VA 1OB2A 1P3JA 1JB1A 1G3QA 2R6GA 2NIPA 1T3HA 2YYZA 2J41A 2R6AA 2FSFA 4ASUA 1TEVA 3WMEA 3F8TA 2BJWA 4D2IA 2AD5A 1Z63A 3I61A 5JRJA 2GESA 4FMCB 4OK6A 4Q9JA 3DM9B 521PA 3KQKA 5AJVB 1E2PA 4M9XA 4DSNA 4NPHA 2GAOA 1M34E 3I1FA 1GKUB 3D6TB 2BBOA 5FTKA 4DLSA 4R71A 1YR7A 2PEZA 1L4UA 2W2TA 2ZRMA 1Q12A 5FTMA 1SVIA 4ZCIA 2OBNA 4TMXA 3U3MA 4A2QA 2QE7A 2CXXA 1Q22A 4R2HA 1E2NA 2MSCB 2XZLA 1E69A 1CF4A 2EFHB 1WBDA 5KPJA 3IIKA 4P0TA 4JLMA 4CIDA 4B34A 2XNSA 2F43B 1MOZA 3AP1A 4YMWA 3BJIC 3TH5A 4DCUA 2IA5A 3QENA 3QPVA 2AWNA 1XJ0A 3HU1A 3K0CC 4KYUA 4MRNA 3EX7C 1N0VC 4NH0A 1QHIA 4Z54A 5FTNA 1I4DD 1R2QA 3QXCA 2FPKA 2RGCA 1FQJA 4RD4A 1KI8A 5HPYB 3EA5A 1N5KA 2J87A 2JDIA 3V4RA 4QM7A 1SVLA 1W5TA 5GJCA 4YMUA 2RMKA 2KB0A 2GCPA 4DLUA 1DBSA 3WXMA 2D2EA 4IVQA 3GLIB 3P32A 4HLUC 3BORA 1ZD8A 4Z8YA 1AA9A 3CKLA 1K5GA 3P4XA 2QN6A 1W0JD 1G4UR 5CDFE 4CZ2A 1SVOA 2JA1A 4CEHA 1NN1A 5IT5A 1ZCBA 3MG9A 2IS2A 3U3KA 1DG3A 4KVAA 2ZANA 2Q9CA 2XSZA 2FSIA 2WBLC 1FPMA 2AWOA 1IHUA 1SVSA 3DMDA 4BFUA 2Z5FA 3AVXA 2J3EA 4QBIA 4JMPA 4E03A 1ZUNB 1P2SA 4AKEA 2HT6A 3FFAA 4JLBA 4KAXA 3R9IA 4XH9B 1KMQA 2OFWA 2MSDB 2ZU6A 3QEJA 3WHLA 3ZH9B 4Y0AA 4FWTA 4BLTA 4P4TA 3NHBA 5DN6D 1EFRD 2QTHA 3SJCA 2UZIR 5DE3A 3I32A 2BEJA 3VTKA 5G3ZA 4BLQA 2AKAB 2QP3A 1TU4A 2OFXA 2RKOA 3P4YA 4KHZA 4X8LA 1PLJA 4RFVA 3CRW1 4E09A 1TQ2A 2GXAA 2JLSA 2F43A 4LBZA 1CXZA 4PXAA 1YU9A 3AVTA 3CX6A 1HH4A 4RZ2A 1X6VA 1TQDA 1FNMA 1Z3IX 5FOTA 3U61B 2O8CA 3FKSA 1Z83A 2QROA 4MGIR 2QE7D 4MA4A 2P6RA 2J59A 3ZS8A 1GFIA 4BUJA 4PPFA 3AVQA 4ZDWA 3AV0B 2D74A 1O3YA 3OIVA 3T1OA 1YZLA 2ATVA 3QKTA 1KDTA 3OEHD 4LCBA 3TNFA 1ZNXA 3HJNA 3ZIAD 3KUCA 3AVOA 1XJCA 3QKSA 4PAQA 5CK4A 2EVWX 3M6AA 4QM6A 2ZJBA 3V00A 3GLIA 3L8YA 4B43A 4JYCA 4OQXA 4JVMA 3NDBB 4TWZA 2ZS7A 3L82B 2O8CB 1NSFA 2O8FB 3X1DA 2JLXA 1ESMA 2WOJA 4DEXA 1V5WA 3KXLA 2YWGA 4V0ME 5KO2A 4EKDA 3K0EA 3CRMA 4C3ZA 3KXKA 5GJWC 1DAGA 3C5HA 1JR6A 5H70A 1P72A 4HATA 5B2ZA 5EE0A 1T3SA 1YZTA 2X2EA 2BMFA 4POAA 4M1OA 4XSHA 3NKVA 2WSSA 2ORVA 1YR9A 4B32A 2IUTA 2PCJA 2O5VA 4HB3A 1G5RA 4MGZR 1U98A 2G88A 1EESA 3KX2A 2A7QA 1IY0A 2P5TB 2W83A 4BZPA 3MWKA 4WA7A 2JATA 2UZ3A 3AF4A 3CNNA 2WWYA 2VSOA 2QRZA 5SZHB 4TL7A 1XXHA 2ZREA 2Z4RA 3LD9A 2Q9AA 3AKYA 3ZZUA 1UJ2A 3K9LA 4IRUB 2QP4A 2OE2A 5CB8A 3O8BA 3CB4A 3KL4A 5J40A 1GTVA 1UBCA 2W0SA 1G19A 5TXGA 4A0FA 5HZKA 2J9RA 4QJ5A 2XB2A 3IKJA 3RSLA 4NCHA 3Q85A 4TYYA 3NXSA 1JEEA 4ESVA 2CNWD 4NBSA 1K5DA 1UM8A 4Q1BA 4IOJA 1P9NA 421PA 2WKRA 2R9VA 4P4SA 1W48A 1MO5A 1ZM7A 1I2DA 2A5YB 3Q3JB 3U3RA 2O8EB 2O0KA 2F9LA 2GXSA 1VIYA 3KJHA 1XEWX 4D82A 2SHKA 5KYKA 1T0JB 2Q6TA 4EPRA 1DAEA 4PHGA 5P21A 4GMXA 1VYVA 1HEIA 3MMPA 1IN7A 3GCGA 5E7JA 3SU8A 1OFUX 2MMCA 1IY2A 3OEHA 4LY6A 3L0PA 2QBYA 3OIYA 5EXXA 1LF5A 4ACAA 1K8RA 3U3OA 3K53A 1DAIA 2CMKA 2Q0HA 4FIDA 4A6PA 1JR3D 1Q1QA 1UBFA 3QF4A 3J81k 1F60A 3GEIA 2BOVA 2FJUA 2QUZA 3B6EA 1NKSA 3TAUA 1P9WA 1XXHE 2VO1A 4A8JC 5EXSA 3EWAA 3ZDQA 4BLPA 2KBEA 4I1OA 2JLUA 1ZIPA 3AM1A 1Z6GA 4PZZA 4BQSA 3TQFA 2YC4C 3MWJA 1E9RA 3NH6A 1EWRA 1FTSA 4HAYA 5FPYA 4MKGA 1OHHA 4PSVA 3TW8B 2NO1A 5JS7A 1EX7A 4CEJA 1CJKC 2V1UA 2R62A 4M9SA 1M7HA 1KGDA 4JLAA 5FR1A 2IYXA 1JJVA 4FINA 3B5JA 2FMXA 3CX7A 5B57C 4G5GA 4A8JA 1OFIA 3VR4A 3GEEA 2P65A 1GVNB 3EZ7A 2VHCA 2JLVA 2PZEA 2N42A 2OV2A 4D26A 2C98A 4BEJA 1JALA 3FHOA 4JT2A 1MV5A 1G3MA 1NN3A 4IOKA 3ZZ0A 4ZKDA 1L7VC 4QGFA 2A5FA 4LJ8A 2VHUA 4ACBA 5KOYA 1OXXK 3RNLA 2RGGA 1VDZA 3UATA 1EG7A 3T35A 1YKSA 5DISB 2E87A 5D3MA 3RWOA 3M1IA 1P2TA 4UXHA 3TUIC 2VLIA 5JECA 2IL1A 3CF0A 2OZEA 4H9GA 5LBIA 4FCVA 2HDNB 1Y3AA 2F3RA 1GM5A 1HV8A 1DOAA 4LPKA 4FMDF 3K70C 4JYBA 3DKPA 3VU9A 2QT1A 3EZ9A 5CLQA 4DSOA 4LHYA 2HV8A 3EPLA 1YVDA 4NYIQ 5J4YA 4GL2A 2NOAA 1YZNA 4PX9A 2J45A 1LS6A 1IQPA 4R7ZA 3VR5A 4EJSB 5A5GA 2A5JA 1P62B 1P9RA 4B2IA 2WPDD 2XTZA 2IEYA 3GFOA 1I4LD 3HWSA 3CH5A 1WMSA 3MJHA 3MSXA 5AK0A 4O0MA 4EPTA 4B44A 2WSMA 3NEJA 5L3SA 1US8A 1SQ5A 2XXAA 1OIVA 1H8HD 1SXJB 1NY6A 3B1XA 1OYWA 4GBMA 4K46A 4P3YA 2C95A 2J7KA 5K8LA 1BO6A 5JJKA 4HUQA 5DSZA 1SKYE 2F7SA 3BOSA 1NVUQ 4UNSA 2L0XA 1JR3A 2CE7A 3LY5A 4C30A 1GP2A 1ZMXA 3UMSA 1XZPA 3F0TA 4JVLA 4RY2A 3UMFA 4K8OA 1PLLA 3GLFA 3D8BA 5AJYA 5FBRB 4ZIRA 5L8VA 1AJEA 2OBMA 3K9GA 4B76A 4MKIA 3QKRB 4URUR 1AN0A 3PEUA 1G21E 5GVSA 2R6FA 3AP2A 4BRUA 3TAHA 3CR7A 2Z6VA 2ZJYA 3BB4A 2F3TA 3QUSA 4KFSA 3TW4A 1XPOA 1TNDA 3RC3A 1YR6A 1E4YA 1Q44A 1W0KD 1FX0B 2QGNA 5FL7A 5C1BA 2A78A 2BWJA 3RRMA 2AK2A 3TUJC 2GEDA 4AG5A 1CR1A 1XCGB 5B64A 3EASA 1T3LA 5DIFA 1E0KA 1ZNYA 1GWNA 3NG1A 3W3ZB 4BLRA 4A92A 4TMTA 2QU8A 1W36C 4NTZA 4Q19A 1CRQA 121PA 2Q21A 2GZHA 1E2FA 2V8OA 3IILA 4IDHA 1ZC4A 4LJAA 1KI7A 2W6JD 4KODA 1W7AA 4LJ4A 4N1AA 2FPLA 3R8CA 1E0AA 3AP3A 3FMPB 5DYIA 1TL7C 4AYXA 4GI7A 4PFSA 2W00A 3TUZC 3UIEA 1T8UA 1ZD1A 2ANCA 2ZRAA 3GFTA 3BH6A 2ANBA 3CONA 5DO9A 4OK5A 4U7DA 2AFIE 1UF9A 1SHKA 1N5LA 5F9FA 2R8RA 3RS4A 1U99A 2ZI3A 4KFRA 5DI3A 2HT1A 4GOJA 4BFVA 1R4AA 3VAAA 2MMGA 2EYQA 1D2EA 4A2WA 3FMOB 2ZQ5A 4AI6A 4WXPA 4JIMA 1XF9A 4QHYA 4OKSA 1U9IC 1E6CA 3CWZA 3THXB 4RD1A 2RGNC 4YMTA 4O2LA 4Q03A 3X2SA 2WICA 3NHAA 2RB4A 2GCOA 3KKPA 4PTLA 3BBPA 5L3VA 1QHSA 2FFHA 1PUJA 1WCV1 1Q3HA 3E1SA 3HYTA 4PZLA 4O2RA 4RFSA 1H65A 5F98A 1DELA 1OXVA 1RYFA 2VP5A 4E22A 1U2RA 4KSCA 4ILEA 3HU3A 3AVPA 3IUYA 4TL9A 3PJRA 1G8GA 1P73A 2NPFA 1TUEA 5D3MB 3PEWA 1VECA 1C9KA 2ZRIA 5BYKA 2V6JA 4YQFA 2Q3HA 2I1VB 1J99A 5KPDA 3K70D 5EP4A 5JMTA 4B2LA 2IX3A 3Q7PA 3QXSA 1G4AE 4B75A 4FD2A 4HB4A 5DH9A 5CDFA 2WWXA 1II8B 1S3GA 3RRYA 1PVOA 1NLFA 4HUTA 2IW3A 3RC8A 1B0UA 2HF8A 4MKFA 4B3BA 1G18A 2KSQA 1OXTA 1IXSB 2D62A 3F5FA 1T0HB 2BCGY 2YWEA 1P2UA 4Q4LA 1E0JA 4TQ9A 1UKZA 4XVUA 2P67A 1W0KA 3CUEF 4JKIA 4QKQA 1Q1EA 3DO6A 4QJ3A 4CT5A 5FL7D 2IS1A 3ZZTA 3KKOA 1ZINA 5J4LA 2FDCA 3AF0A 1S3SA 3B78A
chains in the Genus database with same CATH superfamily
2IZOA 5F4ZA 5JZSA 3PWTA 4OI2A 2Y66A 1GNRA 1KMHA 3P96A 4FBGA 2ZB2A 3FPCA 3FZQA 4JDUA 3UJ6A 3NVKI 1W4CA 4U0KA 3NEPX 3G8BA 4HXEB 5BP7A 1QC5B 4HPXB 3GGDA 5NULA 3W4JA 1QTRA 2YICA 3TNLA 4JLUA 3HBLA 1NQTA 4HI0E 4YIKA 1MPXA 1G6KA 3EVGA 4FQ7A 4LZZA 3ZCRA 1SD1A 1A2QA 1XCLA 1DUVG 4B82A 4BIMA 4EFKA 5JASA 4HEA1 2VF2A 4IDNA 1Y7HA 2GYVA 4GGOA 4QLOA 4WXRA 3H16A 3KPVA 3KFLA 4KI0A 1AO3A 1W1UA 2GCNA 2PKXA 3AM5A 3IFSA 3M2TA 4FKZA 4GMGA 4QASA 4UJ5A 5CM2Z 4Z9XA 1GKYA 3OICA 4LZAA 2AZMA 3IP8A 4LYAA 4Z7OB 1A04A 4GMDA 1T6NA 5ALEA 3QOFA 4JP8A 1DQYA 4X3OA 1FVHA 4TS3A 3SD7A 4E6PA 5MN6A 4R51A 1Z7GA 3VR2A 1PL0A 2I6GA 1N2SA 4LE2A 2DT5A 3R7FA 4XI9A 4YK7A 4E14A 3JVDA 1KVSA 1YL6A 2Q29A 4MTCA 1BRMA 4X63A 5MN5A 2X0FA 3MCWA 2EAUA 1KY5A 4PZPA 4RELA 3UFXA 3RYHA 2K2WA 3WGTA 4NP6A 4XGQA 4YJGA 4B3SB 3E70C 1Z13A 2G1JA 4INPA 1M8PA 2P1DA 3HZRA 3TZEA 2BGGA 1Y82A 3NGMA 3IV9A 1ZRHA 4JLSA 3ETJA 1V3TA 2YS7A 4OYRA 5CVVA 4KMMA 4L8GA 4YUXA 4BNTA 3FRJA 1VXRA 4MV9A 4JI5B 2JKZA 2OO5A 2C4NA 2RBEA 1SA0B 4LBYA 3R7LA 3RVKA 1MH1A 4ZARA 4YONB 5DU2A 5A03A 4XOUA 1TQ4A 2PRKA 4XLLA 1QP8A 3DZGA 3KEGA 1OGJA 2QSUA 2IWHA 2OD2A 2G63A 1VPEA 4II2A 1GARA 3Q7IA 1BD4A 3EVNA 1T43A 2P2GA 1K4KA 5JY1A 4DNXA 3JQ7A 1IBMB 5F4BA 1RLOA 3TQCA 3NPAA 4EL0A 3KXDA 1PR4A 1EB9A 4LKOA 5AM4A 3L7NA 2CXTA 5AOVA 1UZMA 4GYJA 3SPXA 3JAWB 1QUEA 2CBZA 3N76A 3TLGA 3D3NA 1UC5B 5HKKD 2YWBA 3OU2A 4OB8A 4I2NA 2ZR8A 2FG7C 1RBQA 3D4LA 3W5IA 1N77A 4ZANA 4A26A 3P1JA 3VU1A 3F6SA 5CDTA 2GRAA 4NEGA 4D4LA 3ND6A 4P2BA 4YECA 2Z2IA 1JHOA 2VUUA 3M4JA 1DCFA 4G25A 4QWMA 3TTWA 1KSHA 4NNPA 2M6SA 2CHVA 2GB4A 2R8YA 3OMLA 3P9QA 4YXWA 5ED0A 2DX7A 4IZHA 4REOA 3RARA 1Q6YA 3RUPA 4A8PA 2C8JA 5KTNA 1BXRA 3RVPA 2XEDA 2GXQA 3IQWA 4UMEA 2ZQYA 2XAUA 2GI4A 4XFDA 1KO7A 4KIJA 3AUUA 2Q2WA 4FZJA 4R0MA 1Y4AE 2W5UA 5HA5A 4Q00A 3NW9A 2G09A 5JHGB 4UVHA 2JAOA 4G5SA 5I4BA 1JTEA 1C1YA 3E03A 1BXGA 5EQDA 4AJLA 4EJSC 1QDUA 1GTG1 4Z53A 1KR5A 3TE6A 1WETA 3NM5A 1QRSA 1YCFA 2B7BA 3PIRA 3K7EA 4RSRA 3GVIA 5KNCH 2CXRA 3IEMA 4MHOA 1XDBA 4AP9A 1UKBA 1DO8A 2YNMA 2IYYA 3BMXA 4RMIA 4HDRA 4HEJA 3HY6A 4W1PA 2YS6A 2GM9A 3DZBA 5AHXA 2JJQA 4ZAXA 3T34A 1LNSA 5G40A 4Y2PA 3CVUA 2QUKA 2QEQA 4AN0A 2XQJA 1VGVA 4KR0A 3GWZA 3G2PA 3FF1A 4TKUB 2HEGA 2YHIA 1MX3A 1IN1A 1GGEA 4IH1A 4KAFA 4FBMA 3S40A 3CO5A 4TSFD 2FWAA 3TPCA 2JH3A 1G2PA 1IY1A 3HCRA 1SKQA 2ZIXB 5K0ZA 4TZKA 4IRMA 4B8YA 1NDQA 2ZXEA 3EH2A 1T10A 1I5EA 2OFOA 3GEHA 4Q4JA 3LY7A 4WCVA 1SHLA 4EY3A 4B6FA 1AGPA 1WLSA 2VNSA 2IYRA 3E8SA 2GD1O 3N2YA 4IDPA 1U04A 2VCHA 5FUBA 2A0UA 2C31A 5SY6A 4DOMA 4PQRA 1ADJA 3C4JA 3M6MD 4URFA 1U31A 1MX1A 2NVOA 1BE6A 4L3VA 1SVWA 3PFKA 3N2KB 3Q40A 1UKCA 4K9RA 1EFCA 3WJAA 2D2XA 1H2XA 3GHHA 3GH1A 4LMBA 1P45A 3OAAD 5ALQA 5B5SA 1GAXA 1M9NA 1D5WA 1FFEA 1NF9A 4H7DA 3INTA 1LF0A 1HLFA 4B6EA 4DQ0A 1W85A 2XE4A 5C51B 3WLQA 2FEMA 3CVWA 3DCJA 3K16A 1DWPA 3BG5A 5BN1A 5AK6A 4NHEA 1Q2XA 1QNLA 2B92A 4K05A 1AH2A 4BZQA 3VYVA 2QG9A 2BUAA 4L5YA 3ZGZA 1LW6E 1TKCA 2K4MA 5EXPA 5JLAA 3BC1A 1KO4A 5TGDA 3HDTA 1NX9A 4AJKA 4ZYLA 1UP4A 1WIWA 3V9PA 3QMVA 1G8JA 3OJXA 2KS6A 1QIMA 3ZZNA 1BOFA 4IH9A 3TNDA 1J1ZA 4Y1EA 4I55F 4YJHA 3TRDA 4TKVA 4UPDA 3AY6A 4BFSA 3L4SO 3D1LA 1RLTA 1X7DA 1M1NB 2E4UA 4MR7B 5FTJA 4LF7B 3TDNA 1LC3A 1JQAA 3WZ2A 3TLCA 2VTVA 5K8IA 2FUG6 2GD6A 4KNWA 4CMBA 4QPNA 1LPAB 3M1AA 4LW8A 5L7WA 1GIAA 4WOCA 2VPYA 4XWWA 2RHTA 3U4QA 5LQJA 4HRYA 2COKA 2XDQB 1M1UA 1TVKB 2C29D 4LJRA 4UMDA 3MC1A 3O92A 4D81A 1KI3A 3WIOA 1HA3A 2EBFX 2C2HA 4G0OA 4X1YA 4C1NA 5JRDS 3HXMA 1BW9B 1QVRA 3QU9A 3TD2A 4D8XA 4FXOA 1LVUA 4V0RA 1DXOA 3M1LA 2BP7B 3R5TA 4AZ0B 1V2HE 4YXFA 2VYCA 3VZQA 5FWNA 2PJDA 3AH8A 1AKTA 2Z2XA 3OE5A 4B80A 3E9QA 3HKCA 4BN0A 4TL6A 4K81B 1E79D 1E4VA 2AVNA 3R77A 3EF3A 3CMCO 1W9MA 2G67A 4JK3A 1JTFA 3DKVA 2W58A 2SCUA 3RRJA 2VRCA 3G2MA 3GARA 4CLRB 1KJ9A 1ZJWA 4JJZA 2FLKA 1SIBE 3HH8A 4WBNA 3NHWA 1CUBA 2YJTD 3AHIA 3KD3A 3H3FA 4LGVA 4CKCA 4EJMA 3G0HA 4D4JA 3DZFA 3UA3A 1QHHA 2CZQA 5ICSA 1WE2A 4HB2A 2AOUA 3RU3A 4MQ4A 3UF0A 3VOTA 3H0EA 3O9VA 4IH4A 4UNIA 3PZBA 2PUWA 4M7PA 2EHDA 4HFMA 3QIAA 4ZK2A 4GZ5A 4M1SA 5JS6A 4C6HA 1RIIA 1U5CA 2ZR7A 4X5OA 4GDMA 4Q9KA 2R2GA 2IF2A 4EI2A 4EQZA 4CQNA 4KVGA 2FZ5A 1FUYB 1NL3A 2O2EA 3OFNA 4LVNA 4AECA 4YPVA 4AU1A 1M10A 5AFSA 2C97A 3UXYA 4CLRA 1C7JA 2E82A 4F4IA 3W5SA 3TTUA 1CJMA 1C4WA 1JPVA 4ZJUA 1DVRA 3N86A 1G5FA 1VDMA 1HYQA 1J90A 1D9XA 2AMLA 2DHQA 3FUTA 3KJFA 4RSMA 3ZLUA 4Z9AA 4JLPA 3UW1A 4D9NA 2PY6A 4OHXA 4WXEA 5IBRA 4AZVA 3LX6A 1GD1O 4N8DA 3DWGA 1WMEA 2AN4A 4Q4AB 4W1QA 1H1DA 1YTUA 3GLHB 4ZHSA 4FYJA 3T7TA 1VBKA 1Y6QA 1ZONA 2GCIA 4XM2A 3HCDA 1FYEA 4QATA 4QPPA 5H68A 3QLUC 4I4NA 5HRUA 1A4UA 1SUBA 3KQVA 3NBXX 1J22A 1XNGA 5CAEB 1ZC3A 4YNBA 3T9AA 5MDHA 1JDSA 5IH7A 1D2GA 2VYQA 4WNYA 3ZW8A 3QE3A 3DLPX 2CDBA 2JK0A 3EIQA 5CB6A 1RXSA 1GOTA 3VC1A 2PMFA 3Q7TA 4GO1A 2ODBA 2E4VA 4KQKA 2EFCB 2RGRA 1FYDA 4PYOA 3GVHA 3GPDG 4NULA 3WIDA 3TNJA 4ZHQA 1U5BB 4OLHA 7YASA 2I2WA 3P9SA 1HFKA 1D8AA 4F8JA 5IDWA 1GLGA 4R1PA 3C48A 1WBJB 3BTVA 2AYZA 3O4VA 2YWCA 3FYDA 5EYPA 3Q7EA 2O1EA 4Q3LA 2WJIA 5CT6A 5J4KA 1YB5A 3UJ7A 2VC2B 4WN9A 2UUAB 2YHSA 1NUPA 3MGKA 3TEFA 1PGPA 3HLYA 5K6RA 3STWA 1TA0A 1X1RA 4OHMA 4D97A 3TFOA 1Z0AA 2PT6A 3WMGA 4GPD1 2JHGA 1P8AA 4X61A 3SP1A 4C4YA 3G9QA 4HL6A 1M2VB 2QMOA 4ICIA 4IDAA 3C5CA 4OY3A 2OKGA 1JKXA 3NC4A 2NW6A 3AL0C 1KEEB 2FRDA 2YY7A 2YIDA 3SWWA 5BYJA 4LRYA 2V7WA 4KFTA 4I9FA 2PUCA 1OTHA 4KX5A 3JYNA 4A8JB 3OZ7A 4R9RA 4B2PA 4ETWA 5SICE 3DS8A 3NV7A 2QTFA 3FOFC 3VC3A 2RHWA 2WVHA 1VE1A 1E6MA 1Q21A 5JE8A 4I1SA 2BD0A 1MTZA 2P9FA 1TYDE 2PCLA 3NIFB 1LSUA 5FUYA 3B2EA 3VR4H 4J0KA 1Y3IA 4JLJA 3TWOA 4JY7A 2QU7A 1ILWA 4IDDA 1A7AA 4D8WA 4O4LA 5HBRA 2ERXA 2E9SA 3K05A 4WIAA 1IVNA 4ZPJA 2WVJA 1GQ2A 1WXGA 3L7MA 1QV9A 3Q8XB 1R0CA 1P4GA 1HEYA 1H2WA 3IP7A 4BJ6A 1S2MA 5ALIA 2JEZA 4L72A 5BVHA 4CI0B 1PZHA 2QW0X 2QM8A 2NU8B 1JHMA 4ALIA 3N8DA 3HP7A 1EZZA 3FCUB 3N0RA 1P91A 3WLHA 4DG5A 1KYQA 2B69A 1MR3F 1KE1A 2ODNA 1Q14A 1WPQA 3I28A 2R48A 1RXCA 1ISJA 4MYHA 5CT4A 2UYQA 5E4TA 5GOTA 4D9MA 5HRCA 3AHDA 4EHKA 3LDGA 4C5AA 5EE1A 2GO1A 4HRAA 2DKNA 4BMOB 1OAAA 3DWIA 2YRXA 3C3JA 2FV8A 2FR8C 2AUMA 1NN0A 1EG2A 1XQYA 4YEDA 2ZJ0A 2J0EA 4OXXA 4IV0A 5A71A 4IBOA 1U2GC 2I7XA 1WHSB 5KI6A 2HNAA 1GKIA 1EI9A 2GX6A 3G68A 2EIHA 2OQIA 1J5PA 3S8EA 3B5IA 3ZGNA 4OP3A 4RMHA 1DAFA 3TJZA 4A0HA 3R7BA 1PEYA 3HHEA 4DUGA 5KDLA 4EAQA 3RYIB 1Q77A 4TT3A 1ABEA 3UFBA 2DUUA 3ERCA 1QBKC 1TM7E 2JGDB 5BW8A 4TYNA 3HJUA 4NDZA 4S35A 2WHQA 1C2YA 3ROEA 4AFNA 1AGRA 2YYYA 4L15A 2W11A 2WAAA 2G77B 4GOXA 2CYAA 4MCHA 3X1WA 2H1WA 3QJ5A 4H1VA 3ZHSA 4Q05A 2HJGA 4U7HA 3FI0A 4L4XA 4Y6LA 5DTRA 3DD1A 3THYB 1ZOLA 4B74A 1QF6A 1E2UA 4LOKA 1IJFA 1XTIA 2VPXA 4NFSA 4TQAA 1J7JA 2HTEA 4JB8A 4CQMA 1VE5A 5EHNA 4IVNA 1I7NA 3IRUA 5FNVB 3GLHE 1TJNA 2R0QC 4B3RB 2DTXA 1JIKA 3WG9A 3W90A 3QF7A 4EECA 4Q9DA 3PQ6A 5GONA 1PV4A 4FDMA 5IT4A 3TNYA 1M34A 4QUKA 4H3SA 4S1NA 3TBHA 3TRIA 3WOHA 13PKA 2QV7A 4EGFA 4L5BA 4YT4A 3WLMA 1TVCA 2XLBA 3HCPA 4KGDA 4CE6A 2HD4A 4H6VA 3RPEA 4GKVA 1YRHA 2GKSA 2IEAA 4LGCA 5LXTA 1KZHA 1DKNA 1JKJA 2PV7A 3OKAA 1L8OA 3B7GA 3W6PA 2GDZA 2NAPA 3OPYB 3QXJA 4U2EA 5DN6A 3IKTA 1NLUA 1NVXQ 1WDKA 3QYPA 2H3HA 4PFQA 4AURA 1N5IA 5GZ3A 4FHEA 1KAQA 4JHLA 4X7PA 3OPYI 4IYJA 4QO8A 4C6RA 3FPGA 3BTOA 1DJLA 1R0RE 3WMXA 4INZA 1X74A 2O8NA 4R1TA 1M1XB 3JZMA 1FY2A 1F1JA 4OSEA 3RT1A 1DRJA 1NR5A 1VBFA 2REOA 3EFEA 3KVOA 1NW9B 1QFYA 3C39A 4Q15A 4DQDA 5HQTA 3DMNA 3KCNA 5EE5B 1RAEA 5FKJA 3UBMA 2GZDA 4ABYA 5JD5A 4M83A 2WQ7A 3OIGA 1RCUA 4GI2A 2F6RA 4OYHA 5BSKA 1XA0A 3EDYA 3CJRA 3DAFA 1FVXA 2QX4A 5HKAA 5JXWA 2I2FA 3PHJA 4MUAA 3ZNOA 3B82A 4YJ3F 5JAZA 5CM8B 3C6YA 3QPBA 4NCJA 1XOIA 3BFVA 3C4VA 1RWPA 3T5BA 1IG3A 2W2NA 3CZQA 5AW0A 4HN4B 5LL6P 221PA 1UJ6A 1G2OA 4JJ4A 5EXTA 5J2UA 5KU1A 1E6LA 4D25A 3I3SR 4QREA 4JSTA 3ZW7A 2XRFA 3RQSA 4UJ3A 1B8OA 1UEJA 1TYCA 3ZVLA 3L4KA 4B3FX 4PXYA 3SFTA 4NPAA 1NVBA 2WHEA 2ZCVA 1O57A 5KSOA 3TBFA 2BFDB 1BX1A 1OB5A 1HTWA 2I4MA 3WP0A 2IELA 3DULA 2Q4EA 1LDNA 1Q74A 1AQLA 4WXHA 1L4HA 1XRQA 3W9YA 3IRVA 2CGEA 3RV3A 1HE2A 4MEBA 4O4IF 4V1CA 4DTCA 5JSQA 3OLZA 4X9XA 3A1DA 5EPOA 4G8BA 3J7TA 1E9FA 1GKKA 2WKWA 2P4EA 2YMPA 3FTDA 4ZAVA 3S7ZA 4DSUA 5JWOA 1CUXA 2F1HA 1ZIXA 2XGJA 2DFVA 4M8KA 2ZR0A 2D5LA 1T9GR 3MWYW 5C3UA 4C76A 3UAGA 3Q3HA 1U2DA 2MSKA 1W49A 2J6IA 1NBMD 4ZGWA 4MRRA 5KCMA 4JROA 3MINA 1FQWA 2HQ1A 3TR5A 2HK9A 2TMKA 3EWNA 3KB8A 3ZBPA 2FPIB 3COZA 4XSGA 1Z22A 2OHVA 5L3SB 4KXVA 4E6EA 1EFUA 3ZCVA 5ANRB 2IPLA 2I8LA 1B6GA 1YB1A 2QDXA 2QP9X 3DMFA 2R3SA 4DWWA 1XQ6A 3FWNA 4JEMA 3U44B 1TM3E 5ES3A 1EWTA 5DLDA 3HSSA 1P9LA 2X8AA 4FNOA 2GGSA 4EQ6A 2XBMA 4AYWA 3BXOA 5KREA 1MABA 3WV5A 1ZD4A 3L6RA 4X1OA 3S2YA 2E1RA 3PD0A 1U0LA 1X1SA 3WK7A 4YCSA 3O2SB 4C7VA 3OKCA 2BAGA 2QMZA 3A1VA 4MKRA 5FI1B 4C3UA 4AUEA 3T9FA 1XA3A 4TTVA 1F2TA 5C5EA 3TYXA 3LTNC 5JSZA 1R8QA 4L4SA 4BUCA 1N1MA 3HVUA 3OIFA 1JQLB 1ZNQO 1RI2A 3QU2A 4IJKA 2Q7DA 3SS8A 4DJFC 3FDZB 4RQTA 3AEUA 3FZYA 1WKCA 3GN1A 3ORRA 4N0EA 1JBKA 4URYR 4Y2UA 2DFPA 2CUZA 3S2GA 2Q1TA 3JSAA 4KU4A 3LA6A 4JN6B 4N0PA 1UH5A 3UWSA 1GPAA 1M0SA 1YAHA 3KJIA 4WKOA 2FVXA 4B7CA 1GITA 1NMXA 1O5IA 1FP1D 2PSFA 3D31A 4U9HS 3A0UA 3S8YA 4MH0R 2FOLA 4M0KA 4BCDA 1K7CA 5T8KC 1U8ZA 2CNNA 3HADA 4Y2YA 3WNBA 3JAMA 2H1IA 2HOQA 2ZI5A 4XSVA 2I87A 3ND5A 2JCXA 5KWVA 1OT3A 1O94D 2HCJB 4UD2A 4BC0A 2WKSA 3AIMA 3RAJA 3BL6A 3PXAA 5FWDA 4HZUB 4MQMA 3LCJA 4ME6A 3CCFA 1XU7A 4QJBA 3G79A 1X7GA 2XDWA 4BV3A 2MR6A 3HO1A 3GT3A 2Z30A 1OH6A 1REQB 3DE2X 3NHPA 3AXTA 3CSUA 4Q7MB 3DF7A 1L5VA 1UXOA 1SOWA 2D1FA 3N70A 3QTBA 4KQMA 1ISPA 3PR2B 4BNZA 1EDOA 2G06A 9MHTA 4RTRA 2PD3A 2X6TA 5ECWA 2G0AA 1LTHR 1KGSA 2Q5FA 1MGOA 5ELLA 3WGVA 5FDFA 1X8XA 3PNKA 1CJTC 4NZZA 1W5AA 2QJRA 2W90A 1FX1A 1O94C 2HRQA 4Z86A 1HI9A 1RWXA 5IWAB 4HPJB 1DZ3A 4JBNA 5TEWA 4KUEA 4MQBA 2O2DA 2WAXA 1D07A 2YTZA 3LZCA 1E8NA 3SDSA 4PZUA 5B3LA 4DA9A 1GPWB 3I3OA 3OIUA 3WBJA 3O47A 2YYAA 2WYHA 5JWHA 3CW9A 1BX0A 3ANNA 3D7SA 3W7VA 3AYXB 3ZYCA 1A82A 1SUWA 4KG7A 1NBME 2XNJA 3B12A 4M38A 5D1HA 4Q12A 4RQAA 2VBGA 3VRHA 4K0RA 1OH7A 1YB4A 3USCS 1L7DA 4GNKA 1E0SA 2R84A 4OXYA 3MTEA 1VL1A 2RI6A 1VMEA 3ONWA 5JSUA 3RGGA 4EGJA 1MH9A 4RJLA 3FVQA 1H3FA 1Y1KE 1V8OA 1VE6A 1ZSVA 3EG9A 3K0BA 4ARUA 3BGWA 4E2ZA 1QO7A 1PLKA 1AIPA 3RWMB 1VHTA 3WGGA 4RZXA 1T9HA 4RTNA 1AS0A 1CY7A 4XIIA 3C6ZA 4TTSA 2VYNA 2X8WA 3LX4A 1L5HA 1FMTA 2FZVA 4LHWA 4U0JA 3ZOKA 1TGVA 4AULA 1F9AA 2PGAA 3KKZA 5AOCA 5IZ4A 4BMYA 2JRCA 2GWHA 3MRSA 4KLAA 1NTOA 2ZRCA 1H6CA 4Q7LA 1Z07A 4Y9DA 2FFAA 3H9QA 4CM8A 2EATA 5MFZA 1PNTA 4OM7A 4WHMA 5JV5A 2FZEA 5L45A 5I4CA 1JEQB 3H4MA 2B8WA 4ND1A 2C3YA 3G0CA 1LFDB 4R9UC 5CEFA 2YOGA 1DQSA 3KKNA 3T3NA 1F8YA 1HL7A 4I4TF 4HQFA 2GA8A 3E15A 2ONCA 2R4UA 2ZJZA 4KQFA 5CHEA 4ZZ2A 2GVNA 2I3AA 2QN2A 1Z47A 4AROA 4RF4A 4TV9F 2QJWA 1TIPA 2VTDA 1BWQA 3B6IA 3GBPA 1C3OB 1KQNA 3TJMA 2I2XB 3WIEA 3ZKWB 5K8TA 1IUPA 2RKBA 2XHEA 3IIEA 3PCXA 3PBKA 1SXJE 1T2EA 1ULHA 1V9LA 3EXAA 4FHGA 4G1VA 5JMOA 2FPOA 3BGDA 4KW7A 4MB2A 4KSBA 1LPBB 1WVMA 4LK2A 4RVSA 4TLLB 3X1ZA 4BLSA 3UAXA 1GYQA 1JAYA 1OLSA 1PZFA 4IQ4A 4N01A 4N0QA 3W2HA 5I7VA 4FCCA 4X62B 1F48A 1YS2X 5G02A 1HLGA 2Q6VA 4V02A 4GZMA 4ZQHA 5TQ0B 2EIXA 2RGNA 3TZ6A 3WWDA 3V1UA 5CNKA 3AG5A 1F0YA 2ZQZA 2F17A 1SXJD 2QLFA 5JRZA 1GL9B 2AG1A 2CEAA 5EHGA 3AFHA 2E5WA 5K51A 1P4SA 4P3KA 2FX3A 1ZX1A 4QFCA 2NO6A 1C8KA 3TOZA 3ZTWA 2PKQO 4WZBB 3HRIA 3JD4A 4Q3KA 3ZHXA 3W5AA 3O95A 5IJZA 4BQPA 3O8OB 2JANA 1MHTA 3QX7A 1V8PA 1MO2A 1OYOA 3D6MA 1C7ZA 3T95A 5G0WA 4ZAYA 1TMKA 4ZVSA 1YBFA 2QN1A 1XD2B 4D9EA 3A4IA 3FKQA 4AG6A 4RVUA 1E2MA 1C9JA 1XMVA 4PONA 2EZUA 2LNDA 5ILOA 3X1JA 4RETA 1KHTA 1A3CA 3R7SA 5KYUB 4ZWNA 3WL7A 4BO8A 1CUUA 2WTBA 2C0QA 5DLQC 1CIPA 1ESCA 1Q50A 3QE2A 1KKLA 2ZWVA 4CMEC 3IP6A 3PEFA 1L5NA 2MCFA 4IRXA 1N2BA 1WF6A 1QH8B 1JU9A 2OSBA 2C5AA 2Y92A 2ZSDA 2G7ZA 3PGA1 2G80A 2AJLI 2WJAA 3ZE9A 5A06A 1PDWA 1DC4A 1MIOB 2H51A 2OEPA 2P11A 3G9UA 4KBFA 3LXXA 4OBBA 1T36B 1BGWA 1UM9B 2GEUA 2WSSD 2HK8A 1A9ZA 1S2IA 4UUNA 3R7WA 1TW2A 3E7DA 3RKUA 2ZJOA 1AQIA 3OU7A 4G5OA 2NUAA 1OW3B 1Y9DA 4ILKA 4X7BA 5EKSA 3ZQ6A 1H22A 3NBMA 4FFBA 4AX8A 3ZX4A 4UW9A 2D7JA 4EP1A 4JI4B 1FFGA 3QV1A 4Q6BA 1WP9A 1F3OA 4QO7A 2F8TA 1WL8A 3H86A 3OJOA 4XTRA 3O94A 4UKDA 5IT9A 3O7WA 4BTEA 2WYVA 4FWIB 4CM1A 5EP1A 5KNCD 4UULA 3JQGB 4IUYA 3SF8A 3P9KA 2LZ0A 4YX9A 5CJJA 5TY0A 3RC7A 2BMDA 2G07A 1MLDA 1RJGA 2O8FA 1V43A 2P90A 2YJ5A 5B1IA 1V1RA 4Q1FA 4PIVA 5LYJA 3GF4A 3A1CA 4GXRA 1GNPA 4F5WA 4KX3A 2XUFA 4Z4QA 1ATZA 5CYOA 5D5QA 4QQKA 3UHJA 4EUNA 3K6RA 2Z09A 3QFHA 4NICA 4NH4A 4X71A 3WTBA 4EUFA 1G8YA 4DLYA 2BPOA 2CE2X 1WUIS 3DBRA 4GRAA 4PZ9A 3GJ5A 1Z25A 1K6JA 1QGDA 2IIPA 3AHHA 1Y3FE 3BFXA 4EW3A 1NW7A 1MC8A 1Y3BE 2WAOA 2C3PA 2UDPA 3CNLA 5EQJB 3VQTA 5KYXA 5EINA 5FFMA 5K7SA 3O21A 1K92A 3L79A 4LFAB 3RFUA 1EHIA 2JLWA 1SR8A 2EJVA 1SU8A 5PNTA 4KPYA 2V4ZA 3KRTA 3D8NA 3THRA 4YV1A 1V25A 1KA9H 1C1XA 4B3TB 1OV6A 3WL3A 4N7JA 1BXGB 3KS9A 4NU0A 5DLEA 3B1JA 4BBZA 1W5EA 3TEMA 3FYUB 3A3OA 3IOCA 3QKSB 4PYKA 4DRZA 1YIDA 2PEYA 4R40A 3KAJA 1HE4A 3MT0A 1YI1A 4IHKA 1SOAA 4R98A 2VDMB 2V7QD 2HQSA 1Q19A 2UUOA 3HCBA 3PNPA 4JBLA 5JMPA 3T3DA 4RMNA 2O5CA 4B47A 5IHXA 4RD0A 1SAYA 3VR1A 4ZEXA 3NVAA 2CVPA 3E5RA 5F1PA 5HK9A 1WS6A 4OQYA 3IIMA 1SIWA 5K3EA 1FLVA 1PL6A 3BQMB 2V9CA 5JCOC 5AWFC 1YVPA 2JFUA 5IDXA 2J6CA 5JISA 4WDRA 2YJZA 2WPNA 3NC1C 3MJDA 5HF9A 4WY8A 5FUVA 1WV0A 2L17A 2C7GA 4QE3A 5DM0A 4XDHA 1EM6A 1PSWA 4Z2YA 1QK4A 4J3FA 2E21A 2C7BA 2VDJA 4QNMA 2HBYA 5DP1A 4QGBA 5KTKA 4IKEA 4CDNA 3SAJA 3GJZA 5K6TA 4XJTA 3BD9A 4AWAA 1HDZA 2IZZA 3OTHA 4FDAA 1QYXA 2OK7A 1U2QA 3PB3A 4GW3A 3T5PA 2HLDA 4E0BA 2X19A 1L8LA 2WZQA 2CVQA 3KQTA 2VUTA 3ZD9A 3H99A 5COAA 1Y81A 3A6DA 4K86A 1Y4UA 3D8UA 3AR3A 4HNAA 1F0NA 5LA6B 3ETEA 4B5KA 3PP8A 3HU2A 5F7JA 4F1JA 2NADA 2FWRA 2XA9A 5AI9A 3KV3O 2OY0A 3OQJA 3EGVA 1NY5A 1HNWB 1RHRA 1UFRA 4ZOQI 4MQLA 1WZEA 2ODAA 3SJZA 4F1WA 3H05A 5UKDA 4DSAA 2ZTVA 4HDRB 1B0ZA 2Y1EA 3E35A 2HKIA 3W6ZA 3A9UA 1QU2A 2N1MA 5IH3A 5BQPA 1SB8A 2P6UA 3DLAA 3KEFA 3STHA 2Z57A 4MV1A 1UP6A 1X38A 3SXUB 4CJXA 5GWXA 1YBAA 2GRUA 2PAAA 4A6XA 1P75A 1DTEA 3PA8A 5FA6A 3F4KA 4UNPA 4K3UA 1AK1A 4HDSB 1T1IA 1I0LA 1NN5A 1NUSA 3ND8A 2NNLD 3DZHA 2BCJQ 4BO2A 1VZ2A 5B12A 5I9SA 4AY6A 4W63A 4OP1A 3JV7A 3UUWA 3MW8A 1RZRA 1VCMA 1UDWA 2E49A 4JVSB 1O6CA 3M9XA 4GDFA 4J90A 1HK7A 3KSAC 2EF1A 2AC4A 3RTEA 1DDOA 3KKEA 3R3WA 4EIWA 4CGYA 5IAKA 3AETA 2EX4A 5LIPA 5KWSA 2P79A 3L0OA 1T3TA 1G7RA 2B34A 4M1KA 4CMHA 4FFNA 2PWBA 1EA7A 4KREA 3ZE6A 3VHLB 1L5MA 1FTNA 1X7ZA 3FCAA 4EW1A 2D4HA 5AQ1A 5KC8A 3SLGA 1IFXA 1LXCA 2PR7A 1ZIOA 4HGPA 1VRWA 1USVA 1PAUA 2Q07A 3PVZA 3Q0TA 4KKVA 4YB8A 4Q7KA 5KQMA 3GP8A 4KXFB 1YFLA 1V3VA 3FSEA 4Q18A 4E94A 2P9JA 4FJ1A 2BN4A 3F74A 4W7HA 3PT9A 2QQGA 3V7WA 4EPYA 4OJQA 3K2EA 3ACDA 4KJXA 4X1IB 1OGIA 3V4ZA 2EFDB 1J0DA 1GUDA 4KXUA 2IXEA 3CBGA 1URPA 3D4IA 5CM9C 1XDZA 3G9ZA 3QFRA 5LYYA 5A05A 1V11B 3CEPB 1VCOA 2RHLA 4X44A 5D3QA 4DRYA 4DQVA 1RD4A 4FB5A 2O7SA 2Z1MA 3AFOA 2IPMA 1QF9A 4TVOA 5DTEA 3VSCA 2G1KA 2EBUA 1QJ4A 4MW4A 5AVYA 1T9KA 5A5FA 1Z0IA 2VWQA 2EZTA 3AYZB 2DERA 5KSWB 4BTLA 1XI2A 3BD7A 2WP0A 4EG5A 1R5OA 4FFDA 1HDGO 1N4DA 3IS3A 1P29A 2ORYA 3QVXA 5CYPA 5I9MA 4TN1A 3I73A 4BO0A 5CJPA 1QGOA 2QX6A 2FPUA 1Y4DE 4G0NA 4QGGA 2Y1XA 4JC4A 4CKBA 3WYFA 5JTTA 5H9WA 3U5TA 4G9BA 1RWVA 4ZVOA 1G5IA 3HDQA 4IIGA 1AOXA 1L7XA 2JK1A 3KXIA 2J3QA 3KZMA 1CLUA 3OM8A 3PDUA 4AD8A 4BJ3A 3GOQA 4BQIA 1L4BA 1S01A 4JR1A 5IDQA 4HTFB 1V41E 1M6NA 2RHOA 4BNIA 1M76A 5BWNA 5TIIA 4UMFA 3H6GA 4QRIA 1EXMA 3GUUA 1X1EA 4M99A 2QVLA 4PLPA 4JBWA 4MEJA 1CR0A 2C5HA 3W3AD 2FDXA 5BWBA 2V3CC 4UXIA 3G9XA 4HF7A 3ADPA 2YHAA 3QSGA 4JWTA 4Y2HA 4ZALA 1JLRA 2ZWMA 2WD7A 3EVCA 1EFHA 3LT1A 1UUFA 4QYIB 1FB5A 3ZV5A 3H8VA 1BE1A 2R1VB 2P3OA 1ILEA 5G0SA 3A9TA 3I0ZA 2YINC 4ZHQB 1LKZA 2AFHE 4AZ3A 3LAWA 4GXTA 3ZKAA 1AQ6A 2QAGB 4HC4A 4CGZA 4CG1A 5E8JA 1QFSA 3HI6A 1QOQB 2CLSA 1GPKA 3VVMA 2GD2A 3HHPA 4MQUA 1GA6A 4PNZA 3SY8A 5KSYA 4M87A 2D3TA 2FPXA 3RRNA 1ZCAA 5E7MA 5HUJA 1GUBA 4RX1A 1E9SA 4Z9YA 2IYQA 1M2GA 2XJ9A 5ALFA 2HDHA 2AQIA 4X8HA 1TUGA 1ELOA 3A4LA 1H9AA 5LDDC 3IIJA 3HCNA 1PJCA 2TMGA 3N58A 5EE3A 2OWEA 2JH9A 5JSYA 4A36A 4I8IA 2R5WA 3GZNA 4TKLA 1LFAA 1ND5A 3TVTA 4Q4AA 2GK3A 1I6MA 3IEIA 3F98A 2AXPA 3P0RA 1WM1A 4FSDA 1F2DA 1SKAA 4WEQA 1VL0A 4BMDA 3LUDA 2IYFA 5I48A 5LLSA 2JVIA 4AXXA 3HUUA 4JAVC 2P77A 2XCIA 1L9XA 3AF1A 2R8PA 4L9SA 3T5DA 4IXTA 1XP8A 4RDIA 3V8PA 2NX2A 4LRQA 3MM4A 5WRFA 1D2HA 1KZ1A 5C2JB 5AW7A 1KKMA 5ESRA 3A3KA 1RYBA 5CVTA 3V8VA 1IQ0A 1HKHA 5AUOB 4UOEA 2W6IA 3T5GA 1G8PA 3OOJA 2DCUA 1B26A 4KP7A 3ZQJA 4IJUA 1X2EA 1U2ZA 1I2MA 3BX1A 3KUUA 4EFDA 5EQFA 1J9GA 5AO9A 3PNOA 4C0BA 3B60A 3L4JA 2Z5LA 3CWQA 1YHZA 1QHNA 4MXDA 2FE4A 4Y2GA 1HRDA 1JQBA 1RYHA 4EW2A 1VBMA 1FRQA 4BTVA 4PYJA 4YRZA 3NRJA 1YS9A 3HYLA 5JI3E 3EEQA 4KLCA 1K3FA 5LQMA 1RKVA 5FOSA 3LSTA 2PR2A 3JVIA 2RGBA 3ND9A 1I4TD 4WY2A 4ERXA 3FNFA 4MCAA 1CP2A 3HACA 3KOXA 2P35A 4TXNA 1F2UA 2A94A 2CSUA 4Y9RA 1THZA 2X0RA 3DP7A 1DJQA 1RVDA 2IEBA 2XDYA 4MUXA 1ZGCA 1U7WA 2G76A 3K9BA 3PKIA 4QAJA 2XWPA 3VKGA 2IK8A 1IHPA 5K8CA 3EYWA 2AN5A 5G4KA 3NHSA 4AWXA 4HX2A 5BWMA 3AUKA 4RMJA 3DAHA 4R8KA 4ZQFA 2QRVA 2VF7A 5HQ3B 4YV2A 1U2EA 3CLUC 3EDMA 3QBVA 4ROSA 2VJAA 1V39A 1CUYA 5K2OA 4YGXB 1E3MA 1G63A 5E9JA 4YAOA 3QI7A 4C01A 1S4QA 5JH7B 1RXVA 4IHQA 4RHFA 5TVKA 2R4QA 4H60A 1VYTA 2BGJA 2Q8QA 4LF9B 1P2VA 2R7KA 2PZLA 5EIWA 1G8KA 1ZVMA 3PUZA 2VIIA 3A1TA 5AP9A 8LDHA 2ERYA 3NEYA 2QTCA 3ZDXB 1F14A 1L7EA 1GZDA 1HT2E 4FGJA 4RVOA 4Z8XA 4ZAWA 2BDTA 2FP3A 3WYAA 4CV0A 2WUFA 4W5QA 5GJBA 3M4YA 3RUAA 4L9RA 4JYAB 1WEHA 4O1MA 2IYSA 1VSBA 4ZCMA 1MQ8B 2OG2A 4P58A 2BMEA 3MZ0A 2H11A 2H4ZA 3HG7A 4LC0A 4DMFA 4H3KB 1YA6A 3MRVA 4TLAA 1HF3A 5C8YF 3COVA 3VO1A 3EQZA 3HXPA 1H8EA 2X1MA 3K5IA 2XRYA 1I10A 4PNHA 1QGYA 1ISMA 5EYPB 1ZK2A 1MHPA 2X4IA 1G7TA 2J85A 3FGPA 4YFVA 2NU8A 4DZRA 1A9XA 1A8HA 2ZBFA 3OQOA 4HNRA 4Q3AA 3L8DA 5B1HA 1DFIA 3TGPA 1BCSA 1IZ8A 2FN4A 2B82A 2IHZA 2RHDA 3R3JA 3LDUA 4HYYA 3BIWA