1I30A

E. coli enoyl reductase +nad+sb385826
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
256
structure length
248
Chain Sequence
GFLSGKRILVTGVASKLSIAYGIAQAMHREGAELAFTYQNDKLKGRVEEFAAQLGSDIVLQCDVAEDASIDTMFAELGKVWPKFDGFVHSIGFAPGDQLDGDYVNAVTREGFKIAHDISSYSFVAMAKACRSMLNPGSALLTLSYLGAERAIPNYNVMGLAKASLEANVRYMANAMGPEGVRVNAISAGPIRTFRKMLAHCEAVTPIRRTVTIEDVGNSAAFLCSDLSAGISGEVVHVDGGFSIAAMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ENOYL-[ACYL-CARRIER-PROTEIN] REDUCTASE [NADH]
publication title Inhibitors of bacterial enoyl acyl carrier protein reductase (FabI): 2,9-disubstituted 1,2,3,4-tetrahydropyrido[3,4-b]indoles as potential antibacterial agents.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Oxidoreductase
total genus 89
structure length 248
sequence length 256
chains with identical sequence B
ec nomenclature ec 1.3.1.9: Enoyl-[acyl-carrier-protein] reductase (NADH).
pdb deposition date 2001-02-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1i30A00
1PU2A 3JYQA 1QYCA 4ZGWA 3A28A 2JD1A 1NFRA 1TT7A 2Z1NA 5TS3A 3VH4A 1HE2A 1Q7BA 2DVMA 4Z0TA 1NPDA 2D3TA 4FSHA 3VAZA 4CM1A 4PIVA 1R4NA 4R4JA 4ID9A 1M6WA 3IUPA 3E5MA 3PJGA 1VC2A 1N9GB 2D2IA 2DBQA 1EVYA 4AL4A 4CUZA 4WK6A 4BMVA 4K1LA 5JFOA 4AFNA 1HE5A 1A9YA 2DPGA 3JQ7A 4XB2A 4OSOA 1NWCA 2Y0DA 4XA8A 3S2EA 1PZHA 2NWQA 4MVJI 1HXHA 3JD4A 5ILOA 2B36A 4BGIA 5IF3A 5ENVA 3GNSA 1ZVMA 4FFRA 4LSWA 3FI9A 1CRWG 4E31A 1LC0A 4RVFA 4NJOA 2NU8A 4XIJA 2RHRA 3QWAA 4E32A 2IRWA 3ZH2A 1HDOA 5THKA 1KC1A 3VOSA 2DM6A 2Z1MA 2DFDA 3RVDA 4WCFB 1NAIA 4YJGA 4TMFA 4R41A 4AJ1A 5EMHA 4CV3A 5HRUA 5T8KA 2DLDA 2NADA 3U4HA 2DQ4A 4B3JA 3LF2A 4IPTA 4CMAA 1P1FA 2DUUA 2HK8A 2Y0CA 4B3HA 3I1JA 2BHLA 4OIMA 4KQWA 3G0OA 1ADGA 1HYGA 2XPCA 5CDUA 4NH4A 3WBFA 3WWYA 3N7UA 5KTKA 3UN1A 3BTVA 3GUCA 1WDMA 4QT0A 1X7DA 2G1UA 5C7LO 1CDOA 2IZ1A 4NDNE 5GMOA 1CIVA 3ZV4A 2FPGA 2AEJA 3ANMA 3ASUA 2GZ3A 1E3WB 2AQIA 3FN4A 1R4NB 4M8SA 1T2AA 1NVGA 4J43A 1NBOA 4AJ4A 1GL3A 3E03A 4BIIA 2GNAA 4XYMA 2WE7A 3GZ4A 4XJTA 5JMWA 2I65A 5COBA 1IHXA 3BYZA 3GPIA 1B26A 1CWUA 2YDXA 1U5AA 2NTJA 4W9NC 3AFMA 3DZFA 1DIBA 4DRYA 1NQAO 2NUAA 3LVFO 4I5GA 1PR3A 3GGPA 2V65A 3GG2A 3ZWOA 2J5KA 3W4IA 4NBUA 1UP4A 3CKYA 1XYGA 1VL0A 4KDEA 2AMFA 1DAOA 3PWZA 2BGLA 4D79A 1UAYA 4FGSA 2XF8A 5U9CA 3B20A 4LW8A 4NHEA 1SC6A 3INRA 1FDSA 3EUWA 3OEYA 1ISGA 3PYLA 4W7HA 3SC4A 3QV1A 2BELA 4EYEA 4BNGA 2VWGA 5IJZA 4FJ1A 2HAEA 2OGUA 5FFFA 4GX0A 2OFPA 3I9MA 4ND2A 3HDHA 4CMBA 1NYTA 4EUFA 4KOAA 2PGJA 4ALNA 1I36A 1Y7TA 1YB4A 3HDQA 1W0CA 4TROA 3GZNA 1R15A 2CVOA 2JKVA 4A7PA 1RWBA 3BMCB 3H8VA 4BNLA 4WCFA 1NFQA 4P4LA 1U2DA 1K6JA 4FFOA 3VH3A 1T2EA 4J9UE 2I6TA 3N74A 3JYPA 8LDHA 5I8WA 1ENOA 3WYCA 5L4LA 3GT0A 1HZJA 4TVOA 2GZ2A 1LTHR 1EVIA 5A5EA 2X9VA 3PGJA 1PJSA 1ZEJA 3JQ8A 3SJ7A 3GVIA 3ZWNA 1HSZA 1BHSA 3NEPX 5CG1A 2P68A 2YHIA 1RM3A 3FRJA 4LK3A 3KM0A 4BMNA 1D1TA 3CMCO 2JD2A 4FOSA 3WTBA 3KSUA 4ZQEA 2AEMA 1ZK2A 1PGQA 4CUJA 3F1KA 5MDHA 1DLIA 2J5QA 3MCVA 3S8MA 1BTOA 5I9NA 1T25A 3TPCA 4B7UA 1GQYA 2Y1EA 3HE3A 1A27A 2VTEA 1IZ9A 5B4VA 1VI2A 4H15A 3PK0A 5CDTA 4YPOA 4CR7A 3T4EA 4E30A 4UVDA 3ETEA 4R1TA 1KY5A 1CERA 1K89A 3S2IA 2PNFA 3K6JA 4HXYA 1R12A 4IGFA 1Q0HA 2XOXA 4XCVA 4Y6RA 2VHVA 1ZJZA 3H9QA 4WCFC 2Q99A 3L9XA 3QWFA 2R6JA 1ID1A 3OHSX 3A06A 4NNJA 2V6MA 4NFYA 5LDGA 5DCUA 3O03A 4BO2A 1PJLA 2HCTA 3WICA 4RPLA 5F5LA 2D8AA 2IXAA 2OO5A 4XQCA 5JDCA 3EYWA 2EERA 5GY7A 2D1YA 1NFFA 5JO9A 4JBIA 3ROMA 3MTGA 1WMBA 4JBGA 2HK9A 3KRTA 4NPCA 1JKIA 2IZ0A 5KJ6A 4UEOA 1FF9A 1OBFO 4E21A 5KJFA 1J49A 3O38A 4GX5A 4ZQFA 1TLTA 5DP2A 1E3SA 3QVSA 4FS3A 4PLCA 2DBRA 2G5CA 4TRMA 2W2LD 4BNUA 2CDAA 4IMRA 1OOEA 2V7PA 3SLKA 3EC7A 3TOXA 3R0IA 1E7RA 4MVJF 3VPHA 4HV4A 1Z73A 2ZB3A 4E2XA 1IPEA 1NQOA 3GQVA 1Y8RA 1KBZA 4F6LA 4R69A 1X13A 1YGYA 2J6IA 2VOEA 3DEYX 2GERA 4BNKA 1LA2A 5DT9A 3SBOA 2VRCA 4AVYA 1ML3A 3MJEA 2FRDA 2E49A 3JQGA 3W1VA 1H9BA 4R1SA 3OIGA 4CQMA 2JAHA 4NZ9A 3U4DA 4LRTB 3TQHA 4CODB 5A06A 5KKCA 1JU9A 1S7CA 2PGLA 4RPJA 2OXIA 5CG2A 4EUEA 2PR2A 1IPFA 1DC3A 4D45A 1MA0A 4J4BA 4FBGA 1T4BA 3V2UA 4BGUA 1Q7GA 2FN7A 5JNLA 4PN3A 4CQLB 3JQAA 4Y9DA 3TZHA 4AJIA 3HG7A 1CJCA 2QQ5A 4ND4A 1IOLA 2PKQO 4JJFA 3EK2A 3WIEA 2Y67A 3WBBA 1FXSA 2YHIB 3PDJA 1ZUD1 1P3DA 4JX8A 1O0SA 5T6BA 3UF0A 4FPXA 3ADPA 3QSGA 4YJFB 2AQKA 3DBRA 4JXKA 4AJLA 5JE8A 2PZLA 4BUCA 4H16A 4TRRA 2WSBA 4XD2A 4MKXA 4UUOA 4BOYA 4J7CA 2ZTVA 2WD7A 3JTMA 1V3UA 5JDIC 1LRJA 2A94A 5JY1A 1EFKA 3PQDA 1Y6JA 3GLQA 1GEGA 4FIZA 1DC5A 4GSLA 4KWIA 2I99A 3SX2A 4QUKA 3BZUA 1OC2A 2Y05A 2C59A 1PGNA 3PIIA 4DREA 3PEFA 1BGVA 3CE6A 3KEQA 3QVTA 1E7SA 5A9TA 5CHEA 4IGEA 1HF3A 1KC3A 2CMDA 4CQLA 4GH5A 1V8BA 4I5DA 3DZIA 1QMGA 4WCDA 3RUFA 3T7EA 3RC1A 5EL0A 3FNHA 5CPFA 3T7CA 2UV8A 3JQ9C 4M86A 5DBFA 4XIYA 1ZK4A 2WYUA 2IXBA 1U2GA 3RUCA 1AUPA 1GAEO 2ZQZA 1I2ZA 4EUHA 2OOSA 2YQ4A 3NTOA 4LCEA 4UUNA 4HNHA 4I5EA 1T2DA 2EG9A 3K96A 3ICCA 4MIYA 1DAPA 1EDOA 3NGXA 5CP8A 2WD7B 5CDGA 4CM6A 3RWBA 3F9IA 1LDYA 2GZ1A 3OJEA 5BT9A 1E92A 1XG5A 2CF5A 4O1MA 2POQX 3KEOA 5DZSA 2GSDA 2O3RA 3PZRA 1JQBA 3JQBC 2JCXA 2VWHA 2HUNA 4FD3A 5K9ZA 3ULKA 1DLJA 1E3WA 1T1RA 3KTDA 4RQUA 1SO8A 3ZWAA 4CM8B 2X9GA 1HE4A 2X0JA 3IIEA 4IQ8A 1I33A 5GZ6A 1B8UA 4AG3A 4GX2A 4WASA 3RKRA 4RJTA 1BDBA 3RU7A 5A1TA 5I7EA 3I9LA 3ROKA 4BO1A 1DRUA 3L4BC 5JPIA 2P9EA 4LVUA 2C2YA 3ZGYA 1O6ZA 2AQHA 3QHAA 3TJRA 5IZCC 4DQVA 1GU7A 5EESA 1WAMA 1ISMA 3OP4A 1XU7A 4YJGB 1G1AA 2CDCA 4DPMA 4E2ZA 1WZIA 3KETA 4GVLA 1I3MA 4XX0A 4II3A 1ADBA 1PS9A 2YHUA 1A5ZA 3P5SA 4RPGA 4LN1A 4HKTA 4A2CA 3JQFA 3RUDA 1ULUA 2DC1A 3A9WA 2XXJA 4D0RA 5JCJD 1QKIA 4JIGA 3GN1A 1NP3A 3Q2KA 1Z7BA 3VKVA 4EI2A 4L0QA 3JD2A 4KQXA 5JAQA 5TRTA 2Q2WA 2ZJ0A 3AI2A 4OKIA 1IHYA 1LDBA 3L0DA 4DLBA 1E6UA 1PZGA 1N7GA 3WYEA 1N1GA 1J5PA 1PJQA 4R9RA 1ZEMA 5A9SB 1DXYA 1I3NA 3DAFA 3GHHA 1C0LA 3GRKA 1C1XB 4BNTA 1BXZA 3WMXA 1JN0A 1N92A 1YL6A 3PVZA 5L7YA 1PGPA 1ZK0A 1GUFA 1ZCJA 3AUAA 4GL4A 2W2LA 3ROPA 3HZZA 4M54A 1W8DA 1MLDA 3CEAA 4S1VA 1Q1NA 1M6HA 1PWZA 2BRUA 4FFLA 1NVMB 2DKNA 4G81A 4AJ2A 1IL0A 4GLLA 2ZJ1A 3IQDB 5L4SA 4GKBA 2Z5LA 5IZCA 1PGOA 1YVEI 3PHIA 4BNWA 1VLLA 3C1TA 1EEHA 3OIFA 4PLVA 3WQRA 1YONA 4CMHA 1U1IA 1AXGA 3K73O 4JK3A 4WUVA 2B37A 3SC6A 3ASVA 3WGHA 2WYVA 3RI3A 2I66A 1R0LA 4W4TA 4CLRA 4XRGA 5IDWA 4WPGA 3PLNA 1DEHA 5G4KA 5KVCA 4DLAA 4EJ6A 2EJWA 4MKZA 1P44A 4RV9A 4TZKA 3JQFC 2ZTUA 2R2GA 4XQGA 4JP3A 4IZIA 4IY1A 2Q1TA 2H63A 4NI5A 3WG9A 1P45A 2Y66A 4OXKA 5IG2A 4E5NA 1LX6A 4B7XA 4MP8A 2OORA 3D3WA 1WP4A 2JFHA 4HFJA 4OXYA 3OQBA 5I7SA 1PJBA 4B4UA 4FB5A 5B4UA 4EBFA 2J5RA 1ZH8A 1QYDA 4IM7A 2FWMX 1MXFA 1PX0A 2RIRA 4AJKA 1AN9A 2DUWA 1J6UA 2VHYA 2B4QA 3WLEA 1PS0A 4JNKA 3VH1A 2Y1OA 3CH6A 1E6WA 3IKVA 1AHHA 3VKUA 4OSPA 3V2GA 4YQYA 4MVJA 3DZHA 1IB6A 4CUKA 5L7TA 5ILGA 2PK3A 1SB9A 4JBHA 4RVSA 3F5SA 2D0IA 4J0EA 2R00A 4TVBA 4KUGA 5B1YA 4Q3DA 1GZ6A 1JTVA 3INTA 1YJQA 2Q1SA 1MG5A 3AFNA 2WE8A 5TF4A 4LCJA 4EITA 2Q50A 4AJOA 1V6AA 3W8FA 3FSRA 3MEQA 4F46A 1DRVA 2RCYA 3EGOA 4JQCA 4L4RA 3HJAA 1I10A 2YYYA 4B3IA 1FDWA 2BFOA 1WW8A 4KP7A 1SEVA 4RCVA 2PZJA 1BVRA 3G17A 4RPKA 4UREA 3DWFA 5A04A 5A05A 4GMFA 4J0FA 1U3VA 1UXKA 3ZDFA 1M66A 3FWNA 4LISA 4K6CA 3ZWYA 3DOCA 1KIFA 1NM5A 2ILTA 2EIHA 5G0TA 3AUTA 5A9SA 1DFIA 1C0IA 1GPJA 2QHXA 3VZPA 1R0SA 2C82A 4XQ9A 1C1DA 4DBVO 2EW8A 1QG6A 2NSDA 2JD0A 4HY3A 4Q39A 4BKRA 1N9GA 4DQXA 3H5NA 4CM8A 3RFVA 1HLPA 3E1KA 1JVBA 3Q0EA 3GMSA 4ILKA 3JSAA 3JD1A 1O89A 3HADA 2Q49A 4DXHA 2O3TA 3ZZNA 1F0YA 3LLVA 5JXWA 3DONA 4XWYA 2C2XA 3DHNA 5A4DA 5IAAA 4U0JA 2NV6A 5JY6A 5C7OO 4K26A 2B83A 3O4RA 3GEGA 4O59O 4XEHA 5TGDA 1BSVA 2IE0A 4DVJA 4JCOA 1PQPA 5I9LA 3DDNA 4BO9A 4WLNA 3PLRA 2GD1O 1BXKA 4P4GA 4ZQBA 2Y0EA 4BNIA 3P2OA 1UXJA 3EZLA 2VYVA 2C5AA 1YWGO 3MJSA 4R01A 1FMCA 1P74A 4R1NA 4UVEA 3FPCA 2OL4A 3BMQB 5KKAA 1SPXA 2VUSA 4CLRB 3VHRA 4IBOA 1VJTA 3WR5A 1BXGA 4OKNA 3B6ZA 3MZ0A 4RLHA 3JQDA 2JHGA 4I9HA 1R37A 4LSMA 1QYWA 4XYBA 1N2SA 1U9JA 2VT2A 1I0ZA 1NQ5A 3VVBA 2PD6A 1WWKA 3PPIA 3U09A 2Q4EA 5IXSA 1F8GA 4NK5A 4XYLA 5TQVA 2AW5A 2A92A 3Q9UA 3WGTA 3R3JA 2ZIZA 2X0IA 4E6PA 4A0SA 1TB4A 4MVJE 1I24A 4CJXA 1K3TA 3CXRA 1GCOA 3HQ4O 4QO8A 4ZRMA 3U4CA 4RORA 4R3WA 4FC7A 1A4UA 1OAAA 1R4MA 1A9ZA 5DCYA 2YJZA 4U8GA 3BTSA 4YAEA 5AYVA 4ZN6A 4GX1A 1JAXA 1A4IA 4KDFA 2VWPA 1JVSA 1ZJYA 2Q1WA 4L4SA 1GPDG 1ONOA 1VKNA 1HDZA 4RVUA 5EN4A 5KVQA 2JAPA 3VPSA 2HKIA 2WTBA 3GDGA 1Y9EA 2P4QA 3QVOA 3QA9A 5TSDA 4OGWA 3NT2A 4DBZA 1GEEA 3NT4A 1DIRA 2VUTA 1C14A 3ZNNA 1D4FA 1HDYA 3QLJA 4RPHA 5AOVA 4ZU3A 5L53A 3WSWA 2PH5A 4KTTE 1GZ4A 4NJMA 4QXMA 4J1SA 2H9IA 3ZHXA 5FI3A 2QW8A 3FNFA 2I5PO 3WIDA 1G0NA 1YL5A 4J91A 2I76A 2VHZA 5G4KB 4BV8A 1YJ8A 3GK3A 3IAHA 3GVPA 4TRNA 4YQZA 3WQSB 3HHPA 4R5MA 3PWKA 3QY9A 4BVAA 4BQPA 1GY8A 1MP0A 4QFDA 3GN2A 4CLOB 1CQJA 2EWMA 2NTVA 1SBYA 1A7KA 1UXGA 3ZV6A 4QECA 1M75A 4XRRA 5KJEA 1Y9AA 3PHHA 4CR6A 1U5CA 2PZKA 7MDHA 4LRSB 3U4IA 3FBGA 3GFBA 4RF2A 3K9QO 1BMDA 5BNIA 5IDXA 4QX6A 2AHRA 1EDZA 3BMOA 4W7IA 3OQ6A 1I2CA 3OJFA 1EBUA 3WOHA 3I23A 2PKRA 2GASA 1K0UA 2QZ9A 5DN9A 3VZRA 3WTCA 4BS9A 1QLJA 3JCZA 3OA0A 3P7MA 1ZMOA 3AM3A 5L9AA 3I52A 1PQWA 3NGLA 1V9LA 3FTNA 4CQMB 2X23A 1LSOA 3JQGB 1DBVO 3W8DA 3ZWMA 1X0VA 2TMGA 3ANLA 4YBZA 5CDYA 1GUYA 3KYCA 3S55A 1P1HA 3QWHA 5GZ3A 1DFHA 4MO2A 4UULA 1JA9A 3ZV5A 2RAFA 2V6BA 3DR3A 2AXQA 4NG5A 4FGWA 2IODA 4F6CA 4IMPA 5C7IO 1JW9B 4YAJA 4IINA 3KZVA 3ORFA 2ZTLA 2PA3A 1I8TA 2Q46A 3HFSA 3WYBA 4KTVE 2Y68A 2JL1A 4BV9A 3RD5A 2EF1A 2GN9A 1N5DA 3ZHZA 1YE3A 3PJDA 3WMWA 4HADA 4D46A 2P5UA 3IP3A 1UJMA 3RUHA 1P0CA 1JKFA 2LDBA 2PTGA 3BHJA 2O4CA 3L77A 1F17A 4W9NA 1XWFA 3B1JA 4FFNA 4YYZA 5TX7A 1PJ2A 5F1OA 4OXNA 5JCJA 2Y99A 3CPSA 1J4AA 1MGOA 4OH1A 3WGZA 1TXGA 1Z7EA 2HU2A 2CY0A 2W4QA 3NT5A 3FWZA 2OHXA 3JQAD 3ADOA 4Y6SA 4WECA 3ZU3A 1I01A 2PGDA 4I08A 3TZKA 5EPOA 5JC1A 3GMDA 3UHAA 1BW9B 2AEFA 1XA0A 2W98A 1ZXLA 2BGMA 3DMTA 5F5NA 3TZ6A 3UCXA 4OO3A 4PFJA 4XDZA 2QYSA 3QJ5A 3ST7A 4DC1A 3DAGA 4I8XA 4MVJG 1R6DA 4XZ3A 3H3FA 3PHJA 4J6FA 4MDHA 4BHTA 3DMYA 3DBRB 2NACA 1UZNA 2DTEA 5HTOA 4E0BA 2H1SA 4L74A 3DZKA 1TEHA 3G1UA 3E9MA 3PJEA 1B15A 4N54A 4YDRA 5T8KC 5ICMA 4RZHA 3P19A 1A72A 4WEOA 4PZCA 2UYYA 5HM8A 4ROSA 1LLUA 1BXGB 3LDHA 3OICA 1ENYA 4AICA 1PSDA 3AOEA 4GGPA 4OAQA 3BHMA 1P31A 2PD3A 3AY6A 4NU6A 4AJJA 4CM7A 2WM3A 3DTTA 3UXYA 4ZQHA 1GYQA 2CVZA 4I9UA 1DIAA 3G3EA 1K6IA 1LC3A 3WB9A 1B2LA 2BF7A 1JDJA 2HK7A 2LDXA 1V0JA 4RVDA 2D4AA 3KO8A 1AGNA 3A4VA 3D4OA 2HSDA 4WKGA 3V8BA 3ICPA 2VQ3A 5B4TA 4J3FA 5AXCA 1NPYA 4XKJA 2E48A 3ONEA 4WLUA 4R16A 3GG9A 4PRLA 4DLLA 1YBMA 4R68A 1F06A 2E82A 3FPLA 3UW3A 3F4BA 4R54A 4AJNA 4NBTA 2GO1A 3R3SA 2A9FA 1DC6A 3NKLA 1X0XA 3SLGA 3AOEC 3H3JA 3VTFA 4ALKA 1MX3A 1MXHA 1XSEA 4XYEA 1DPGA 1KS9A 1P77A 3I3OA 3UVEA 3INGA 1QORA 4E5YA 4G5HA 4BL5A 3OJOA 2PY6A 3V5NA 1UZLA 1WLYA 4YRDA 5H82A 4NJMB 3LT4A 2V6FA 2BI8A 1UUFA 3HFGA 2E6UX 5JAZA 4MKRA 3W4JA 1EK6A 4BNVA 2UUOA 5BSHA 4XGKA 2C20A 1VE9A 5GZ1A 1E7WA 4NMHA 1ZK1A 5IN4A 1V3VA 3LT1A 3IUSA 2PV7A 3LZ6A 3TN7A 3CZMA 2CSUA 4UVGA 4YT8A 2Y1DA 3PHLA 2PWZA 3PYXA 2CZCA 3DHYA 1RM5A 3GC6A 2FSSA 5IXYA 3D4NA 1HWYA 3ZU4A 1ZKMA 4W99A 4J2OA 3WFJA 5DBIA 2VRCD 3JQ6A 4D0SA 4E5PA 4INAA 2DAPA 1DJNA 2GF2A 5DDIP 3I6QA 3ZU2A 1S6YA 5A3JA 1QSGA 4NFSA 3KHUA 3GVHA 4PLHA 1PJTA 4URFA 1E1NA 5TJHA 4E12A 4ESOA 1C0KA 4UVIA 4WEQA 3WNVA 1P33A 2EV9A 3X2EA 3ZHYA 3OA2A 3WGGA 1L7DA 2IYPA 3GR6A 1DHRA 3E9NA 3K5PA 4CMCA 1NR1A 2B69A 3JYNA 2YUTA 2NTNA 2JCVA 3NDIA 4CLXA 3H9EO 4OYRA 5CEJA 1HKUA 1IE3A 2XAAA 1OI7A 3UUWA 9LDBA 3LF1A 4XGIA 3LU1A 4PRKA 3AWDA 3BXXA 4WLEA 4ZVVA 4E3ZA 2HMSA 3PP8A 5FWNA 3F3SA 2RH4A 1EK5A 3ZW8A 1HZZA 2NU7A 2NNLD 3WJ7A 1EVJA 5KVVA 5J23A 3HN2A 5EINA 4WLFA 1MC5A 4NIMA 2VT3A 4YCAA 3GFGA 3IKTA 1UXHA 1T1SA 1GYPA 3GEMA 4BNJA 3GH3A 4RDIA 1GTMA 2EHDA 1U3WA 2HJSA 3MOGA 4PG7A 5EIOA 2BGKA 1ZK3A 3JYLA 2Y93A 4K9DA 4IDAA 1UH5A 4KUHA 1PWXA 4R1UA 4NQZA 3ZW9A 4ND3A 1FDVA 3C24A 3VC7A 4EDFA 3E48A 1HDGO 4BB5A 2QRKA 3RUEA 1U4OA 3GEDA 3ZWVA 3C8MA 1M2WA 1LRLA 1B16A 3OJ0A 1LU9A 1Y5RA 2NVUB 1NPTO 1JLLA 5JW6A 2B35A 4Z3DA 1E5LA 3V2HA 5BSFA 4RL6A 4DIFA 1UZMA 2UVDA 1PGJA 1H94A 1RJWA 2H6EA 1QR6A 3V1TC 1IY8A 3FR8A 4HFRA 4PLGA 1XELA 3FF4A 3ENKA 4U7WA 5FF9A 1VM6A 5L95A 2AE1A 2B5VA 2NU9A 1LSUA 3F1LA 1QP8A 1KEUA 1LSJA 1V3TA 3ZNOA 4QQRA 2NVUA 1GFSA 1XDWA 1LDGA 1HETA 1Q0LA 3GPDG 4OQZA 3U49A 3B1KA 4WLOA 4B8WA 1UP6A 4DMLA 1LI4A 3IOYA 1UDCA 1E1LA 3S2GA 3V1YA 1XIVA 4O63O 1YL7A 4J4TA 5C37A 2QG4A 5U4QA 3DTYA 5ADHA 1GQQA 3RFTA 1EUZA 3ON5A 3FR7A 4QTZA 5A03A 1ADCA 2GR9A 5BNTA 1R66A 4D44A 4FQ8A 4YACA 1SCUA 3WQQA 2P5YA 1YOVB 2X5JO 5T64A 1H2BA 3TF5A 4E2YA 3C7DB 1DIGA 3KB6A 1X7GA 3H4VA 3GNTA 1SOVA 4M87A 3ROQA 4QEDA 5AXBA 4J2HA 1MFZA 3KSDO 3M6IA 3JQ7B 1Y5MA 3C1AA 6ADHA 2RBEA 1XEAA 3WDSA 5JBIA 4BGEA 4DYDA 2BH9A 4GPD1 1NHWA 4DWVA 1T4DA 2O48X 2I67A 3RBZA 4ZHSA 4RVHA 2WWRA 9LDTA 2DBZA 4GGOA 5ES3A 3TNLA 5L51A 1KVRA 4WOJA 3CINA 1ZW1A 1C1XA 4B4OA 2GCGA 2VHWA 4ALIA 4Q9NA 1MB4A 5EJ2A 1KVQA 4Q3CA 4ALMA 3H5AA 1E1MA 3TL2A 1ZSNA 5T5QA 2ZYDA 4GSKA 1NHGA 2YFHA 2IDZA 4BGVA 1X14A 5EQFA 4KWHA 1L1FA 5DULA 3QW2A 1X7HA 4ND1A 4PLFA 4ONEA 4W6ZA 1VL6A 5BNFA 5IDYA 3PQEA 1N7HA 1PEDA 2EW2A 2NVWA 1YDWA 1XR3A 3DAPA 3DQPA 4HNGA 3RASA 4BO6A 1D7OA 4RLSA 2WMDA 1HDCA 1GR0A 3EY4A 1GADO 4FN4A 2EGGA 3I4CA 2HRZA 3LC1O 4ITUA 4JLWA 3G1TA 1ZMTA 1GZ3A 1EZ4A 4J49A 4XGNA 2P9CA 3LT0A 1BDMA 1R16A 1ADFA 3E9QA 3IP1A 4NK4A 3RBXA 5JAMA 5U1PA 3K2EA 3FCOA 1M76A 1KEWA 1ZO8A 4UVHA 2YV2A 3TOZA 3NRCA 3U3XA 2X22A 4LMRA 3MWDB 5K6AC 1ZFNA 4IDCA 1CF2O 4CM5A 1TT5A 4M55A 1NNUA 2Q3EA 4HFMA 4DQUA 2DFVA 3KLPX 2WJPA 4BKOA 2NQ8A 4P8RA 1ZBQA 4YJHB 4BKPA 1SMKA 2AQ8A 3GOHA 4OL9A 3CIFA 1O94A 2EKQA 4ZA2A 1X15A 2FR8A 3I83A 2C07A 3F6YA 4XB1A 5F1KA 1F14A 4CMIB 4XJSA 1YO6A 2W2KB 5A3VA 2JJYA 2ZK7A 3V1UA 2G82A 3MWEB 2AA3A 1WDKA 4WNIA 2HRBA 4X54A 2R00C 4CV2A 2GPTA 4IQ0A 4CMEA 1DC4A 3GGOA 3VPXA 4J90A 2Q4BA 3RQSA 4FJ0A 1EE9A 2HJRA 3NAQA 4FDAA 4QFCA 3TL3A 3SVTA 2DTXA 4OMUA 3D3EA 4B4WA 3PWSA 4YAKA 4Y6PA 1XLTA 5AXDA 3RIHA 1RYDA 4GBJA 5HWSA 3JQAB 1IZ0A 3T4XA 4IDFA 5IFLA 4BQRA 1LBEA 3CSDA 1DDOA 3IS3A 4GAEA 1W73A 1EE2A 5ER6A 3QIVA 1YQGA 2GYYA 4CV0A 1H0KA 1NX6A 2C7VA 4HX5A 3EDMA 4Q3BA 4I5FA 5DNAA 2ZKLA 1GV1A 3GY0A 3ZI0A 4CLDA 2B0JA 1MV8A 2Q1UA 2O7SA 4MP6A 3HDYA 1C3VA 2ZYGA 4DPLA 3D5TA 1KOLA 4BNMA 1FDUA 2OMEA 3ONFA 2FPPA 4BNHA 4D7AA 4DIOA 1NASA 1VRWA 3UH1A 4JGBA 4PLWA 1KY4A 4PG5A 4DUPA 4YJFA 2BI7A 1E3LA 1AHIA 2CF6A 2YV1A 2O2SA 4E2WA 4YAIA 5CPBA 3PYMA 2IZZA 1IULA 4ZJUA 3WWZA 3DOOA 2PKQP 3O26A 2FR1A 2RH8A 3M1AA 4AJPA 5G0VA 3ZWXA 3CUKA 3ZNQA 3GDOA 2X1HA 3DZBA 1H6BA 4N5NA 1MG0A 3D7LA 4NFHA 4NR0A 3PXXA 4OOEA 3GVCA 4CQMD 4RGBA 3ZWPA 5G0UA 5JYEA 1L7EA 3TSCA 1Y8QA 1ZXBA 4CMIA 2P4HX 2WD8A 4YXFA 3KYDA 1T24A 4IDBA 4Z9FA 2ZB8A 3BTOA 4Y8VA 1DJQA 2Y1FA 3NTQA 4TKMA 2X7HA 3H9UA 4BNYA 4XR4A 3H2SA 3L6DA 3BAZA 5H81A 5G0SA 3NX4A 4OQYA 5JSFA 2CFCA 2VOJA 4PCVA 3H5RA 3VZQA 4KUEA 3Q11A 3MJCA 4PZEA 2FPIA 3HSKA 4JJIA 5AXAA 1KVSA 3NYWA 5FI5A 2ZCVA 4LVCA 4BO8A 1FK8A 2X6TA 1YH3A 3DFZA 4GWGA 1E1KA 3UCFA 3WGQA 5JC8A 5EERA 5KJCA 3JQ8B 4XR9A 4U6SA 3ANNA 1XGKA 1SNYA 1D1SA 1PTJA 1ORRA 3UGKA 5T57A 3A1NA 1KVUA 3PGXA 2HO5A 3PTZA 4GKVA 3W6ZA 3U5TA 2GN6A 2VUUA 1A7AA 1VJ1A 1Y8QB 4FC6A 4C7KA 5G2OA 3WS7A 4J4HA 1B8PA 4Q3NA 1FDTA 3WGYA 2RHCA 4L75A 1XQ6A 2NVBA 2VNSA 4NBWA 2FOIA 4BO4A 4M49A 5K0ZA 3EZYA 1O9BA 1MUUA 1Q7CA 4OM8A 4WNCA 1E7QA 3NV9A 4IS3A 1LUAA 5COQA 4CLOA 5MGBA 3AJRA 2NQTA 3PZBA 4EJMA 3L07A 4HP8A 4YRAA 1QRRA 2BFMA 3L4BA 2D5CA 4CMKA 2PZMA 4U0KA 1VSUA 1ZZEA 3WNQA 1UAGA 5TT1A 2Y1CA 3IMFA 1H93A 1I2BA 3RAJA 3ZWWA 3TFOA 1I3LA 4FJ2A 1B8VA 2W8ZA 4PLYA 4IQGA 1DB3A 3UAGA 1CQIA 2VZ9A 2GUGA 4IDGA 4WLVA 4N5LA 1PZEA 4I1IA 3UOGA 1GCUA 1MC4A 3STHA 1ZSYA 3ZHBA 3JQ9A 2GN4A 1E6EA 3COSA 4OHUA 3GAZA 4EEZA 3LLSA 5EQDA 3KYCB 3WJAA 4TZTA 2VNAA 3GDFA 1GYRA 3BIOA 4H3VA 4XQEA 1SB8A 4BNZA 4CMGA 1YBAA 3AY7A 4FCCA 5G4LA 3RFXA 4LMPA 1YOVA 3JD3A 2O3SA 2W2KA 4FR5A 3DBLB 3K92A 1Z45A 4J16A 2ZB7A 3UKOA 3QVWA 3G49A 2V6GA 3FBTA 2F00A 1UP7A 2FZEA 5L7WA 4IIUA 2WYWA 5AQ1A 5BSGA 1LNQA 5DCWA 4P4NA 4UUMA 3NJ8A 3E82A 3AUUA 2FR0A 1Z82A 3C7AA 4Z9YA 1O8CA 3VZSA 3IL2A 3WSVA 4L73A 3SXPA 4PG8A 2EEZA 4RO0A 2J8ZA 4A26A 3IDSA 1OFGA 2X0RA 4IUYA 1E3IA 2BLLA 2DU8A 3AK4A 1O95A 5TT0A 3ETGA 4BMSA 4D3SA 3PI7A 1C1DB 4DIBA 5JDIA 1CYDA 1LDEA 5C5IA 1G6KA 2I3AA 1HLDA 1LDMA 1QLHA 2EJVA 2QYTA 1F8FA 3L6EA 4MVJH 5CDSA 4IZHA 1Q0QA 1ZNQO 2G17A 3AM4A 1K6XA 2H5LA 2B5WA 4BNFA 4D41A 3JV7A 2HMTA 3OSUA 1U7TA 1MFPA 1YKFA 4YJDA 1U8XX 3VVCA 1H5QA 4G65A 1WPQA 2DT5A 4ND5A 2Z95A 1LLQA 4RQTA 1KYQA 4PLZA 4AJHA 1ULSA 1Y1PA 3D1LA 3BMNA 4N5MA 4HUJA 5FYDA 4MIOA 2BD0A 4BKUA 5HA5A 3AOGA 3TFQA 4E13A 3E6AA 2YW9A 1OC4A 4YAGA 2B4RO 2ZTMA 2F1KA 4GWKA 3WXBA 5AVOA 3I9JA 1YS4A 1PR9A 1CETA 1E0DA 1YDEA 1HE3A 4ALJA 3EHEA 5CFZA 2NLOA 3OH8A 3B1FA 2GDZA 1U3UA 3DMTC 4B7CA 5B12A 4F3YA 3HWRA 3JQCA 3AW9A 4PLPA 5JS6A 3K8ZA 4BO0A 2X5KO 3LSYA 1SEPA 2WEKA 1D8AA 3OIDA 6LDHA 1EUCA 1E77A 1H2HA 1PL8A 3GNQA 4AJEA 4HWKA 3FHLA 3EVTA 3RBVA 1FJHA 2FZWA 3C7CB 4WE3A 1UXIA 4DYVA 5I9MA 4R5HA 1YB5A 5IN5A 1ZSVA 1DHTA 5I7FA 3OEWA 4J1QA 2A35A 5BSEA 3LC7O 1R0KA 3NDJA 1P1RA 2OUIA 4JP2A 4JN6B 5TIIA 1VL8A 2O2YA 2TMDA 3QRWA 2PD4A 1H9AA 4MP3A 3MJ4A 4RZIA 5IZ4A 2YZ7A 2HLPA 3CZRA 3HB4X 3PQFA 1ISFA 4J7UA 5ITVA 3DZJA 4LGVA 3DXFA 1CEQA 3H65A 4W82A 4F45A 2OBYA 4A10A 3RC9A 4YA6A 2SCUA 3WLFA 1JKJA 3FTPA 1EUDA 3HN7A 4KZPA 5JDCC 4YT4A 1DIHA 3U9LA 1HT0A 2FMUA 1TVEA 3PFWO 4GI2A 1U4SA 3EMKA 1H6AA 1BWSA 2P91A 1Z75A 3RKUA 5F1PA 3QWIA 3S1LA 4Z3KA 2E4AA 4CL8A 4CLEA 3ONDA 4D3DA 3DBLA 2X4GA 1HYEA 2VWQA 3PJFA 4MOWA 1I32A 4M89A 3CTMA 3VDQA 4PG6A 1NXQA 3RJ5A 2HMVA 3VDRA 4RF3A 4CLHA 4EJ0A 1QV7A 2GN8A 1P9LA 3EVNA 5I7VA 4G2NA 3ZWBA 4J9VA 1ONNA 1W6UA 5F21A 4DTIA 3LYLA 1G0OA 2OZPA 3Q6IA 3C85A 1AE1A 3DBHB 1YQDA 4XYGA 4YEDA 2O50A 4BO5A 5F3RA 1U8FO 2EP7A 2QRLA 3BMNB 3QE3A 4B4VA 3PIDA 2EGHA 5THQA 5IDQA 1J0XO 2P2SA 4BNXA 3RCBA 2WDZA 3S2FA 5COAA 4II2A 3OF2A 3DC2A 4B79A 3ZWCA 3DFUA 2C7GA 3NTRA 4RDHA 5KJ1A 3RROA 4P22A 1ARZA 3H6KA 4C7JA 1LJ8A 4R9SA 5L45A 4DMMA 1WMAA 2ZCUA 3D3WB 1HDRA 3F4LA 5DF1A 5TNXA 2EP5A 2ZB4A 3GA0A 2C54A 1F12A 3AU9A 3RU9A 3LQFA 3VTZA 4MJLA 3KVOA 1YBVA 2J3JA 4FW8A 2G0TA 1GUZA 1P1IA 1DO8A 4PVDA 1KEPA 4GMGA 1GV0A 3Q2IA 2AG5A 1XKQA 1D3AA 3JYOA 4EEXA 2YQ5A 2EXXA 1VKOA 4Q3AA 3P2YA 1UDAA 4D43A 4QSMA 2FHSA 3H9JA 4KMSA 3RC7A 3D4PA 2C0CA 3ENNA 2O3UA 2BMAA 4D3FA 5B37A 4ZICA 2J3KA 1EQUA 2X5OA 1ENPA 5ITWA 1E7YA 1WVGA 5HBRA 4P38A 2DTDA 2AE2A 2QIOA 4TWRA 2GGSA 1C0PA 4E5KA 2GRAA 4L4XA 1HSOA 1BW9A 1XU9A 4N7RA 4R51A 3RC2A 3I4FA 3K31A 8ADHA 1OZAA 2VN8A 5L3ZA 2CUKA 4YWJA 3I6IA 4M1QA 2CD9A 3H9GA 4GVXA 4DA9A 3DL2A 1KEVA 3FNGA 4OOFA 1AXEA 3BTUA 4IJVA 5CEFA 4CR8A 2FY8A 4FFPA 2UUPA 3IJPA 4BB6A 1OMOA 1B14A 3DHEA 1DFGA 1RYEA 1QV6A 5LC1A 2NM0A 5JYDA 4CMEC 1WDLA 1B3RA 1LRKA 4IXWA 3DBVO 1HDXA 1X1TA 1B3BA 1LQUA 4PVCA 2VHXA 3OETA 1NTOA 1LLCA 2VTDA 3K2BA 3GAFA 4L76A 3DZGA 3QWBA 3I5MA 2YV3A 1Y81A 4ZRNA 2YDYA 5TC4A 2JHFA 4IJKA 3RSHA 1ENZA 3M2PA 1UDBA 1E3EA 2ZYAA 4L9RA 5JAIA 4CM3A 1LEHA 3E5RA 7ADHA 5A02A 3D64A 4MIEA 3AUSA 5C3MA 1H6CA 1RKXA 5L4NA 4K6FA 1EBFA 1V35A 3X2FA 2X8LA 4U6QA 4HFNA 2HQ1A 3D0OA 3AI3A 5ICSA 4JROA 4TRJA 3M1LA 1KERA 4PLTA 4DC0A 5HS4A 2C5EA 3CMMA 4YR9A 3D5QA 3SEFA 1HL3A 5DBGA 2X9NA 1PS8A 1XCBA 2QRJA 4O5OA 3VH2A 3NUGA 2VYVD 4S3MA 3AI1A 4TSKA 1LLDA 1X1EA 3KUXA 4BKQA 4DGSA 2FP4A 1LXCA 1BG6A 2Q2VA 2ZQYA 3BA1A 4CV1A 4RVGA 2PFGA 4A03A 5JCXA 1HTBA 2VYNA 1PJ3A 3EAGA 2OP0A 3WGOA 1JAYA 3DOJA 3HUDA 1PJCA 4EGFA 2A4KA 5FEUA 1Q2XA 4PZDA 4MINA 3WX0A 2HDHA 4E33A 4E5MA 1N8KA 2CVQA 4ZD6A 3AM5A 4CPDA 1GQ2A 3JD0A 3AY3A 5I8ZA 3B70A 4H7PA 2J3HA 1JWBB 2O4UX 4ALLA 2HMWA 1QYVA 1DRWA 3RUAA 3IJRA 1IUKA 4YT5A 4FOOA 2JFGA 4U5QA 3SJUA 5HS6A 4NBRA 4IDDA 3H2ZA 2P9GA 1T2CA 1NAHA 3BMOB 2YFQA 2ET6A 1B7GO 4TQGA 1ZIDA 4YJHA 2NU6A 3GHYA 3RUIA 3IC5A 4IXTA 3UCEA 4A73A 1TA4A 3MJVA 3AU8A 3F47A 1N1EA 1B0AA 3TRIA 3Q9NA 3LT2A 4IS2A 1SAYA 3KXDA 3UFXA 4IIVA 4WGGA 4CM4B 3H7AA 3OM9A 4XDYA 1ISJA 5L40A 4L8VA 5H83A 1PZFA 2VRBA 4HBGA 3GRPA 1R4MB 3KBOA 4Y98A 1IYZA 2HMUA 1O5IA 3FNEA 3MTJA 2I3GA 3VPFA 3JQEA 1HEUA 3U62A 5KWEA 2EKPA 1I5RA 5KVSA 2D5AA 1EFLA 4UEJA 1I30A 1T2FA 3NDRA 2CNBA 2VYND 3U0BA 4DL9A 4IDEA 4PG4A 3K30A 1E7MA 4IJUA 4QO7A 5KIAA 1YQXA 4I9NA 4MPDA 5LCXA 4CMJA 3Q1LA 3GGGA 1NQTA 5KOIA 4J1TA 3R1IA 3GVXA 5KNLA 1PJ4A 1YXMA 2IEBA 3G79A 2PH3A 1VSVA 2QX7A 3WFIA 3ZU5A 4RF4A 4UEKA 1HYHA 1K2WA 3EW7A 1RM0A 2BFAA 3OMLA 2O23A 3DO5A 3I9OA 5KCZA 1ONPA 4YB8A 4PGFA 3BMQA 2X58A 2Q45A 3KLMX 1LSSA 4MVJP 4R3NA 3I9KA 2O3QA 1TI7A 1ISIA 2D59A 1RPNA 2BKAA 2QZZA 2X86A 4OJNA 3VPGA 3KYDB 4O6VA 4YTEA 5LDHA 3O9ZA 2UDPA 3KV3O 5ENDA 5TJ9A 1PQUA 3ABIA 2VZ8A 1NVTA 3E18A 2IYOA 5A9RA 4Z9XA 1BVUA 1WZEA 2FSVA 2I9PA 3PHGA 3L6OO 4GQAA 3HB5X 3TWOA 3TZQA 4BNNA 4WOKA 5DOVA 3MJTA 2DBVO 2J3IA 1TT5B 1P0FA 1PIWA 1VJ0A 1XHLA 2CDBA 3OFSA 4J1NA 4EW6A 1Y8RB 3ETDA 4YVFA 4CM4A 2GLXA 1DOHA 3KOUA 1DSSG 4WJZA 1BRMA 5ER9A 3QP9A 5BR7A 4CL3A 1LDNA 1WNTA 5DOZA 4CM9D 1XQ1A 3M2TA 4D42A 3W8EA 1WXDA 3ZNPA 5JMPA 4YRBA 4C4OA 2XXBA 2PLAA 2G76A 3GUYA 3C3XA 3TZCA 4A27A 3PDUA 1H6DA 2VZ0A 4ZQGA 2EKLA 3A14A 1Z6ZA 3LC2O 4Q3EA 3DB2A 2X0NA 5JLAA 1ISHA 3E8XA 3MOIA 2W90A 4Z6KA 2Q2QA 5JO0A 4FFMA 4IJWA 1GDHA 1YB1A 5T67A 1PL6A 2IEDA 4RF5A 5CAEA 3C1OA 4NU5A 4Z0HO 4J7XA 3F5QA 1NR7A 1UR5A 2B4TO 4YT2A 5A5FA 3OJLA 3KSZO 1GD1O 3GZNB 5DP1A 1JWAB 3FD8A 3Q3CA 1U3TA 3R6DA 3KYBA 3OBBA 4BO7A 3PRJA 3JQBA 3I9NA 5G0WA 2ZATA 1QXSA 3ITDA 3OQ1A 5BQFA 1KETA 2JCYA 1P1JA 4MVJD 2O3JA 2YY7A 3QVXA 3QQPA 4CM9A 3ZCXA 4E4YA 2JFFA 1HRDA 1SZJG 1M67A 2OP1A 2DPHA 4N18A 3RJ9A 3WGIA 4EZBA 3F46A 1EMDA 4UAGA 3W4KA 3BMCA 2AG8A 1E3JA 3NJ4A 1K5HA 3LK7A 1W4ZA 4A5OA 4MVJM 4TKLA 4BO3A 1T26A 1Z74A 1EQ2A 4O0LA 3ZN2A 4Z0PA 1KVTA 3N58A 5TLSA 2UAGA 1A71A 3GF4A 3W6UA 1PL7A 4Y67A 2C29D 4B8ZA 1SOWA 1RM4A 3TDKA 5CEEA 2VCYA 4NBVA 1I3KA 1LQTA 1QYXA 4DPKA 3ITKA 2BFPA 1E5QA 2E37A 3DBHA 3UICA 4UUPA 3BHIA 3L9WA 3HDJA 3O8QB 3O8QA 4JJGA 1U28A 3HNPA 5K6AA 1EVZA 3OECA 1U7HA 3ZV3A 1YRLA 4GLOA 2OBNA 1VPDA 3L4SO 3PFFA 4K28A 1NWHA 2Y1GA 2O7QA 1P1KA
chains in the Genus database with same CATH superfamily
4BWGA 3OP1A 4LYGA 4OGKA 2W42A 4TKVA 1RABA 3A28A 4BQEA 1NFRA 1K7SN 5KQMA 1GA4A 5AJWA 3U3DA 3P9NA 3VH4A 2H0RA 5K8VA 2Z8YA 1Q16A 2J0VA 2RK4A 3DEKA 4FSHA 2QQEA 2P69A 3VO2A 4PIVA 1R4NA 5GVSA 4KL8S 3V9PA 4MO9A 4ID9A 1QG2A 2BEKA 3A1TA 5CLGA 2B94A 3IUPA 3PJGA 2MSDB 3OFVA 1EWKA 2DBQA 1KU6A 3CPHA 3DW1X 3QKTA 9MHTA 1EVYA 1WULS 4AL4A 4I50F 1G7TA 4CUZA 4BMVA 5JFOA 5HRAA 4C2UA 4AFNA 5HK9A 4Q82A 3CRVA 3H11B 1NWCA 2J3DA 2G0AA 3AFGA 3HI4A 3QF4B 4Q48A 1J8DA 5SZKB 4DM4A 1A96A 2J4CA 4MVJI 4UBLA 4BGIA 3IT2A 1DL5A 2YWEA 4NJOA 3N8DA 1UOEA 3RSLA 5AVZA 2RHRA 1WIWA 5DHSA 4E32A 1NP6A 2IRWA 2WKSA 2ZDGA 6REQA 2O8FA 3VOSA 3QVMA 1JI0A 1WXHA 3E8SA 1W30A 4WCFB 4ZCSA 4QPCA 1KAGA 3OX1A 3BF7A 3P2IA 4ENTA 1QTIA 3QXJA 4CEHA 1IJFA 1XVAA 5EMHA 2DLDA 1AQIA 3D7KA 3FBWA 5LQKA 4WKBA 4N03A 4B3JA 4LHXA 4E22A 3OQHA 2LPMA 2JEOA 4IPTA 2CZGA 1JFLA 1O95C 2Q9CA 4HZGA 4Q7EA 4QOHA 2P9FA 3I1JA 5DSZA 2BHLA 4JYBA 5AJYA 1XMSA 4L5AA 1GNVA 4ZOLF 2GBIA 3TNYA 4EHHA 3NVMB 4NH4A 4HDAA 3ORQA 1LCIA 3BTVA 3N8HA 2XZLA 4UZSA 1U65A 1ZESA 3EDQA 3ZHTA 4QHTA 1H3EA 4LJ5A 2XMQA 4G1MB 1E63A 1YDGA 4P7KA 3TUJC 3VPAA 3HS3A 4NDNE 2D54A 1V1RA 3LOUA 1PCXA 2FKNA 4K9SA 1E3WB 1ESCA 1U0JA 2G4CA 4TXMA 1ZICA 2YWHA 3FN4A 2Y77A 4RIEA 3DVAB 4WESB 4J43A 1MNAA 2G8LA 2DWQA 1GL3A 2X6QA 4K9MA 1J9GA 4BIIA 3CSUA 3RS0A 2CEKA 2WE7A 3QLTA 5CFMA 4YAUA 4PYIA 4PSVA 2BN4A 2MOKA 4MRAA 5K0CA 4JXJA 4L3OA 2IVZA 2YDXA 5EWMB 1TC2A 1UF9A 4M76B 3AFMA 3BXPA 3T7SA 2ZZMA 4OYYA 3MYYA 5F3WB 1RXCA 1NQAO 1WXGA 1KMHA 2NUAA 2I9KA 4OMCA 5BVGA 2VHUA 4US2R 3RVSA 3ZWOA 3LLUA 3T5TA 1IB0A 1ULHA 5DH9A 1RBZA 4BX8A 4N7BA 1V16B 1VL0A 1NZDA 1NNSA 1VE7A 3KU1A 5FA5A 4DMKA 1HORA 3QUTA 4RUKA 2BGLA 2XB2A 2NG1A 2EDAA 3QG5A 4B43A 3O1IC 1Y3BE 4NHEA 1FDSA 3EUWA 4DY6A 1ISGA 2D0PB 3CRMA 1L9XA 3SC4A 4YNBA 1A7JA 5BQXA 2BELA 4QJBA 1FEZA 4MRRA 3SYKA 3C3EA 2DCMA 2GUWA 2QG6A 3UK1A 4BCDA 2CLOB 2JGIA 2ACEA 1KNXA 1VE1A 2PGOA 3O9VA 2A1UB 3SLRA 2X3YA 5IW8A 4IOMA 5JS8A 1RLMA 3JRXA 1AZWA 3WIDA 3QBDA 2XT9A 3G59A 3GZNA 4BNLA 4GRDA 3UK6A 1A9SA 1RWBA 2H5EA 4TKVB 3TAUA 3MWKA 1WB9A 3AESA 2WIGA 1U2DA 1G60A 1EFVB 2QMHA 3PC4A 1NOIA 3EDRA 5ALHA 2OV3A 3VH3A 3WRWA 3ELBA 4J9UE 4WFJA 8LDHA 1GKLA 1Z8FA 3WYCA 5L4LA 1E3MA 3GT0A 3LS2A 1DEXA 1TRHA 3DOUA 4TVOA 3SSNA 1L8QA 1VOTA 2GD2A 2GZ2A 1LTHR 5BV8A 5KDOA 2C4VA 2GX6A 2LP4Y 4KFCA 1ZEJA 3SJ7A 3WADA 2HLDA 3GVIA 1TUBB 1GR1A 3IVRA 4ODIA 4MV8A 2QVBA 3BSWA 3O94A 4QBGB 1P2VA 2YHIA 5MFPA 1RM3A 3I4LA 3JAWB 3KM0A 3B3QA 3O21A 2IEGA 1W46A 2BY4A 2C9MA 5LMNB 4FOSA 1BFDA 1GGKA 5HIMA 3WTBA 2Q5CA 1K66A 2AEMA 3K4QA 3KS9A 5CFOA 1HZZC 1B73A 5ARDA 4Z4IA 4UJ5A 1A97A 1IVNA 1QAMA 5FI1B 2WHRA 1GA1A 5FNVF 2O7VA 1T25A 3TPCA 2CV1A 1GQYA 3IODA 4F4CA 5DGDA 1I14A 2K7ZA 4IR7A 4C22A 2I80A 1X8KA 1NJ8A 1Z4MA 2H2GA 5DSTA 3OM1A 4ZIRB 5B4VA 4B1FA 2FEPA 8ABPA 1I0LA 4KX3A 3NKFA 5ETJA 4YPOA 3VMFA 4E08A 2PSFA 1R5OA 2HLHA 3ETEA 4TVSA 1N5LA 3T34A 3G5UA 4R1TA 2MMCA 4LXGA 1KTIA 3RUPA 3SP1A 2ZUUA 3LPDA 5CCDA 3AEQB 4GS5A 2GFQA 4RTNA 4C01A 2XOXA 4XCVA 2DMRA 3ZDRA 4LGCA 3B1XA 5AK6A 2HT6A 3U19A 1Q1EA 3CFYA 4Y6RA 3RWMB 4DJDC 2BTEA 2VA9A 3QY0A 1Q44A 3P94A 4EENA 3O8CA 5K8IA 3L9XA 1KYYA 3R3HA 2E5WA 3ZCTA 4JSTA 1ID1A 1AN0A 3OHSX 4XD7A 3TCXB 2AN9A 3ELUA 3VRHA 4BO2A 2SICE 4LNHA 3WICA 4MA5A 5DTQA 4TUYA 2XHEA 2BR5A 2EERA 2Q4RA 4UOZA 1W36D 4AKEA 3TNFA 2D1YA 3MB5A 1NFFA 3OPVA 4JBIA 4ZYWA 1TIKA 3L01A 2ASVA 4NPCA 1JSRA 1KBOA 2IZ0A 2XUAA 5KJ6A 3TTXA 4N0QA 4H1HA 1HYBA 1FF9A 3PQ8A 3RS5A 2GDJA 3L7JA 5C9ZA 3V34A 4EG5A 4PRYA 1J49A 3IFSA 1P2UA 4HDCA 2OLEA 1Y1LA 4KN5A 2FSIA 3TS1A 1TLTA 2OWDA 5DP2A 1E3SA 3LHIA 3V00A 4EGQA 4ZCPA 1T1JA 4WTOA 1GAWA 2P79A 1W5AA 2Z5FA 1J2JA 4TRMA 3RW9A 2HPHA 2QR2A 4QBTA 1KI1A 2PM8A 3B38A 4PX9A 3T7DA 4IMRA 3PITA 1BVYF 4YJ3B 3WYGA 5K8CA 3ZR4B 2IFTA 1QM5A 3EC7A 4GXQA 2WNHA 2VF8A 2XIJA 1T0UA 1HPLA 4P84A 3M3DA 3C16C 4KV9A 4AXBA 5JD4A 4MVJF 4HV4A 4OCZA 3EQ9A 1T0HB 1Z73A 7AT1A 2FEXA 1NQOA 3GQVA 1Y8RA 3RYHB 4BDTA 1QRSA 1OH6A 1C4XA 4Q01A 4WCVA 2J6IA 3DEYX 1JX6A 3CLSD 4OATA 4XCQA 2KWIA 2AF4C 1V5FA 1AO0A 4XLLA 4LHWA 4D25A 1ML3A 3U16A 3EAFA 3WMFA 5LOVF 3JQGA 4U63A 1N2CE 4NECA 1QWSA 5E1DA 1RHUA 4BFZA 4ENVA 1Q84A 1WW2A 2D13A 4BYMA 3PV0A 1E4VA 5DWDA 3DV0A 3VHXB 2WKQA 1JU9A 4KI7A 4MR8A 4CODB 5A06A 3V4RA 1GGMA 2JLQA 2OXIA 5CG2A 1MEOA 5FBHA 1Y8ZA 4OVKA 4EG6A 3GLGB 5CD1A 1NY6A 1QFZA 4FMCB 4UM9D 2AZTA 4LE2A 1YRQA 4D45A 1JTFA 2WABA 3PEVA 2BSAA 4BGUA 4H7KA 2GZRA 5TY0A 4M1TA 1Q7GA 2WF6A 2ZRLA 3IYLW 3N2EA 3P71T 4UTOA 3W2IA 5JNLA 4MPPA 2XVYA 5T7BA 1Z4PX 3GJRA 2F67A 3HG7A 3QVGA 3BWBA 4GPTA 4MWEA 3GQBA 2QQ5A 3N7AA 3EK2A 2Y67A 3AHGA 3WBBA 1FXSA 3PDJA 5I9SA 1OIWA 1P3DA 1NC3A 3T7AA 5ILQA 1G64A 1CUEA 4B85A 4F1KA 3RVJA 3DBRA 1KI9A 1I5OA 3FYDA 1EVQA 3AF2A 3SNKA 4AJLA 2HQOA 1CLUA 1UZAA 1NKSA 4RD0A 5J43A 1OY1A 1FP7A 1P39A 1P0PA 1SVMA 2AOUB 1RJEA 2XYPA 1H66A 4MKFA 4XD2A 5LXTA 2NP6A 4J7CA 1P2BA 3JTMA 1LRJA 1YIDA 2Q6TA 3OQPA 1IAQA 4CZ2A 1XTIA 5JY1A 5CJ2A 5ED4A 4BMCA 3HYSA 1E2LA 1JEQB 2GNOA 2I99A 3H97A 3MCTA 3OQIA 3BJEA 1YQUA 1D2HA 4LJ9A 3V7NA 3VZCA 4I2VA 2FEMA 3KKQA 2ADMA 5DWVA 4QUKA 4PRZA 1PNVA 4Q24A 2FPWA 3I53A 3DNMA 4XIGS 2FCAA 2JLZA 2CLEB 4JXZA 2F8MA 4NOMA 3RBAA 4CKYA 2R5NA 4AD8A 4DREA 3PCXA 3PEFA 5EZSA 5F64A 3RVOA 2K2QB 3WV5A 1IQRA 4D9NA 3E3LA 1V8BA 3DZIA 3P9IA 1R6AA 4WERA 1F9EA 4O4HF 2JIDA 5KNDH 3SNHA 2QT1A 3O8NA 1N2IA 4I7EA 4M86A 1HT3A 4MW5A 4XIYA 1ZK4A 2ZBGA 3SX4A 2J48A 4F9TA 1XZFA 2RHTA 4GOXA 1U2GA 4QOGA 1DELA 4QQFA 4X3PA 3K6KA 4UEWA 2IY7A 4C06A 3IMKA 2YASA 4EAAA 5HX7A 3NOOA 3OOJA 5FPPA 1E62A 2WB2A 2AMJA 1J06A 1LK7A 1DAPA 3NGXA 4PZAA 2GYWA 5ER6A 5JWRA 3ZJUA 2OFOA 3M89A 1NR5A 3RWBA 2DOKA 3D6JA 5AHXA 5BT9A 4UHCA 2EX0A 2XH8A 2CF5A 4M0DA 4RHXA 3Q3EA 5JXJA 1XZMA 1UANA 4IX9A 1OFHA 3FG9A 3GBVA 3HP7A 3KEOA 3M7IA 3PZRA 4L0MA 4BLSA 4EG0A 2JCXA 3H5OA 1AKMA 1V7PC 2VWHA 4URWR 3ZOZA 4DIKA 1PT5A 5CU7A 2OBXA 2FPIB 3M5WA 3O4IA 1G55A 3NXKA 5C0OE 3WL4A 2RAUA 3RSSA 4ZK6A 5KNBH 3BGWA 3FDIA 1FMLA 1T1RA 4BC0A 1M7GA 5EMNA 1MQSA 1YDMA 2VL7A 2Z2JA 5D8DA 4EY3A 2WYIA 2WAXA 4LV8B 1HE4A 2XCQA 4TVKA 4BXOA 3K09C 5C8YB 1FYVA 1VLVA 1WSWA 3ESBA 5KC8A 5IC5A 1N9KA 3SOPA 4Y2SA 3PDCA 1ST2A 2PX2A 4EELA 2OXFA 3DM9B 4B9AA 2JHPA 1TZKA 5I7EA 3I9LA 3ROKA 5FTLA 3QELB 4RH0A 1QRAA 1GA6A 2A7QA 1ZM2A 2P9EA 1C3JA 1T3HA 4WA7A 5FP0A 3K8YA 3UK2A 1M9NA 4U3JA 3ORRA 4YREA 1YZTA 3TD9A 1W36B 2EYQA 1Z12A 2K5UA 3QHAA 3CW9A 4MGIR 3O6VA 3R6GA 4AZ3A 5KYWB 3UAYA 4TLEA 4DILA 1CQXA 3A3OA 2B8NA 5EZYA 3A1SA 2CDCA 4C4RA 4E2ZA 4M2LA 3KETA 1LPPA 3LA8A 1KQOA 3MG9A 4DT1B 4RPGA 2OCAA 3MXTA 3P5SA 4N0MA 1AH2A 3D8RA 2DC1A 1Q3KA 2W6JD 1QKIA 2I1WA 4GVPA 1RR6A 1E1YA 1WU7A 2GN2A 3HN6A 1YASA 3VKVA 1UXOA 1Y8AA 4L0QA 2ZS7A 1DAIA 4WMLA 1A04A 2VJNA 5JAQA 2Q2WA 4OKIA 5IHXA 4DC9A 1F3OA 3THSA 4DLBA 1E6UA 4IIDA 4X1IA 5AI6A 1N1GA 2KS6A 2P1ZA 2MYTA 5A9SB 3M82A 3MLBA 1CUZA 4HQ6A 1ZY2A 1M2NA 3GRKA 3QSYA 1PWEA 1H2RS 1QH8B 2B1QA 3EQ7A 4HB4A 3H2IA 5A71A 4CGYA 4EA8A 3AEXA 2QE6A 1KQFA 3AUAA 1M2EA 1LZKA 2HOQA 2OFXA 4UAVA 5E4FA 1BJRE 2Z08A 4B31A 1TKAA 2GWHA 2ZKIA 4QU9A 3W5JA 3ICEA 2WT9A 1PT8A 4ZO6A 5IZCA 1V8ZA 3PHIA 4BNWA 4E15A 2JI7A 4R8KA 1F2UB 2FW7A 1E9DA 3AKDA 4CMHA 1NQVA 2HFKA 4XSHA 1U1IA 4Y30A 3KR1A 1AXGA 4JK3A 1DE0A 4KMRA 4NPHA 5TQ2B 3I2KA 2J9ZB 3IAEA 2I66A 2NUBA 2O5CA 3PC6A 1PBNA 2O2DA 3T9DA 3TSAA 5EXTA 3CVXA 5EJ5A 3PLNA 3EEQA 1VHWA 3A6PC 1CR2A 1V95A 1Y3AA 1NLUA 2H1RA 2R65A 2WJWA 2WSIA 3OZRA 4OK5A 4EJ6A 4MKZA 1Z22A 2R86A 4RV9A 4R2HA 3MWFA 1MJGA 3H0CA 5D1NA 4JP3A 4ETNA 3QI2A 1DQPA 4OXKA 5I7OA 2F3TA 2YIVX 3HCEA 2FRXA 4KO8A 5MN5A 4YIHA 3RHTA 1ZOIA 5JYCA 4IDOA 2Q4DA 2H7CA 4FB5A 1HC7A 4IUBS 4EBFA 5E1OA 5GGXA 1QYDA 5JRJA 2FWMX 2AOWA 1RKQA 2FE1A 2JB9A 1E5TA 4S12A 4RNDB 5E3JA 5D87A 5M29A 4M0UA 2B4QA 4MV7A 2BJVA 3LIPA 2BFWA 3A04A 1RHRA 2AD5A 1XTBA 1TJYA 4MUKA 3IR5A 3ABOB 4RD2A 2M6LA 4Y3UA 4MHOA 3WLEA 1OH5A 4I4CA 1AHHA 1N7IA 1Z07A 4YCBA 4YQYA 1P60A 3V2GA 4ZEVA 3SGLA 3FSEA 4OQEA 1U6JA 2X0FA 2GJ8A 1XZPA 2O59A 1TO6A 4C7MA 5AW4A 2H4ZA 1Y3CE 3UNXA 5YASA 5ILGA 5IP5A 3HCCA 4C9BA 4XW2A 4QGSA 5I47A 3PUVA 3AEUA 2BGNA 3RYTC 1V4BA 2PJZA 3T94A 2V6IA 2D0IA 2C8KA 5AD1A 3C4JA 1RQXA 3WB2A 5B1YA 1GZ6A 1IZYA 3EG9A 1YJQA 1R00A 1MG5A 1C8VB 2E18A 4J0HA 4AJOA 3O7MA 4RZ3A 4TTPA 3WLAA 4F04A 2KBFA 3Q5EA 5ICEA 4X65B 3FSRA 2NMVA 3CC8A 2H1LA 3MGGA 4F46A 5F9FA 4ROTA 1I1QB 2N0SA 2XZDA 3QXGA 4JQCA 4L4RA 3PFKA 5JNSA 1JQJC 1I10A 4B3IA 5A4MS 2G71A 1H8HD 1E2QA 3G2NA 4HLCA 2XMRA 2YL2A 2KHZA 4U3JB 5KWIA 2O1SA 3DMFA 4XTCS 1FPMA 3CB4A 3DWFA 4CTJA 4KV7A 3JW8A 2JG3A 1U3VA 3K0FA 2BSQA 3EEYA 5CMLA 2PBRA 4BLPA 1FYWA 3PPXA 3AO0B 3ZKWB 5CXUA 1NM5A 4PIMA 1M73E 1HURA 3AF4A 1J2UA 1DU4A 1G3RA 3DH0A 3HH8A 1Z56C 1C0IA 3M83A 2G9VA 3NFYA 5EMJA 2X5XA 4DDHA 3R3UA 4RSGA 1C1DA 4IJ6A 4ZVPA 1EX1A 2OHVA 4OA5A 1QG6A 4S24A 4HY3A 3LGXA 1S3GA 3N3BC 2XY4A 3BH7A 1O0BA 1MW8X 2BI4A 4FR0A 4H3HB 3ZDZB 1HLPA 3U37A 4X66B 3TLMA 5EHIA 2QV7A 3GMSA 4DUYB 4WIAA 3ZHRA 4TZ0A 1P3JA 3JSAA 5GADl 3JD1A 1AB5A 1P7YA 4PTZA 3HADA 2Q49A 1IU9A 1YVDA 1ZUIA 2I8CA 2R8ZA 5ALFA 2AN5A 1G21A 3AONB 5JSYA 3NHBA 5CXXA 5AHOA 1RPZA 5JXWA 2AJDA 5HF5A 3Q3GE 3MF4A 4HI0E 3GI1A 3GGCA 2BFDA 1JHUA 4U9HS 3GEPA 3W7VA 3N2KB 5ED0A 4DCOA 2NN3C 3AC0A 2NU8B 1D2AA 4ZK2A 1GTG1 4KHZA 2IE0A 4F1WA 1PQPA 4BO9A 1JPNA 3IBCA 2PUEA 1EFPB 3LA6A 4P4GA 4M99A 2CNDA 4E7PA 5CLJA 2IVFA 5AUQA 2Q9UA 2ZRPA 1YE8A 4M7PA 1YKSA 1QCYA 2IK8A 3VHLB 3ZZUA 1KSJA 5AHWA 5T41A 4R01A 4P32A 2CBGA 3H1BA 4UVEA 1NQWA 5EJ8A 2R97A 5JFTA 3ZTWA 5KKAA 1RKBA 1US8A 1SPXA 2FGJA 4EY7A 2PGXA 1PF7E 4P82A 4GO1A 4H6WA 4IBOA 1BXGA 2IF0A 3HMKA 4FOPA 1LFAA 3PRYA 4RLHA 4I1VA 2JHGA 1ODSA 1N2SA 4KFTA 1WUJS 4S04A 2V6JA 1I0ZA 1NQ5A 3VVBA 2R6HA 3MNFA 3U09A 3FFBA 3HBFA 2JK1A 1OR8A 2Q4EA 5IXSA 5P21A 1NLYA 5C5CA 2YIJA 2AW5A 2A92A 3Q9UA 4AO8A 4A0QA 4C2BA 2ZE6A 4E6PA 4A0SA 5B7NA 3P9KA 1TB4A 4OX9Y 2BP7B 5F4ZA 5FUYA 3D3JA 1IN1A 1E1CB 4UJ3A 1TJNA 3AF0A 3CXRA 3STTA 4EB3A 5C4IA 4HH3C 4DLKA 4FC7A 4Z4HA 1J0AA 2Z8ZA 4EQZA 4B35A 4H7FA 1JYEA 1A9ZA 4V2UA 3EPJA 1QK5A 2YJZA 4HMOA 3NBUA 4U8GA 5AYVA 1K08A 4EYQA 5FLEX 1QNFA 1A8HA 4P4UA 2JLAA 3S6JA 1ZJYA 3N0XA 2Q1WA 2CNNA 2VXOA 1ONOA 3A6GA 5FBKA 2QQFA 5DGXA 4MQ4A 2QR3A 2HKIA 2WTBA 4Y2RA 4E6EA 1X19A 1I7PA 5GTDA 1P7WA 3PUWA 4FZVA 2BUBA 4ZV9A 3A1CA 1PFGA 1PBTA 1T9KA 2ZUSA 1DIRA 1C14A 3DWGA 2VUIB 1FZQA 3H9BA 1FP4B 4P6VF 3AEYA 5JZBA 3TIGA 4RPHA 5AK0A 1LPAB 3UC9A 1H5NA 3OIYA 1CQIB 4KGXA 5L53A 4WN3A 2MJLA 3WP0A 1ZM9A 9ABPA 2OPHA 4NJMA 4QXMA 3K20A 1M34E 3GCZA 1PDVA 1ZJWA 3HBLA 1G17A 1M0EA 1JEAA 1TVKB 1QHEA 2VHZA 3SC2A 2SKCA 3CZAA 4RDXA 4DOMA 3ZQKA 3IAHA 2VP6A 3KD2A 2JLCA 1Z0DA 3GLHE 2OO5C 4X7BA 2QMQA 1ZU5A 3RAPR 3ND9A 4AP6A 1AKVA 1OIXA 5JCZA 2CD7A 2IEIA 3K0CC 4LXQA 3G2PA 3HHPA 5H9VA 4D6PA 4H4DA 3HB7A 1XQWA 2V7XA 3QKWA 5BT8A 4O4JB 2OQ2A 1FRQA 3BILA 3GN2A 4QUDA 1IY1A 4K9NA 5HJEA 2C7QA 2LXNA 1Q0ZA 4TL6A 4JOSA 4QECA 1M75A 1C3OB 3M1IA 4UU1A 4K8RB 4DM3A 3PHHA 2I2CA 3UJ7A 1JILA 1RWVA 4FEEA 3SF8A 4MEBA 5BNIA 1SKYE 4QX6A 3SYNA 4EMUA 1LW6E 1U5BA 1WUHS 4MYUA 4HDOB 2QUHA 4Z3OA 5J4LA 3WOHA 3WTCA 2PKRA 3PC7A 2C9YA 5AH0A 3JCZA 2Z6UA 3B9PA 3AM3A 2WINI 4LRQA 1PQWA 1OX6A 3DLCA 4CFYA 2D74A 4QXAA 3R3ZA 1I1OA 1GU1A 4KSYA 4N48A 3FTNA 3IAAA 4YWHA 4ZEWA 3UENA 4CQMB 2XD9A 4HZIA 1Q77A 3NHAA 4LHEA 5ESDA 1CB7A 1H2AS 1RRMA 2JZNA 4CIAA 1KK0A 1ZMRA 2JAQA 3S55A 5CXQA 3QWHA 4IHAA 1W36C 1SJ9A 2HY7A 4UULA 1W0KA 4UPDA 1JA9A 1LWNA 3ZV5A 4LHVA 1PUXA 1EWTA 3QKRB 4LIPD 5DB4A 4NG5A 4B82A 1IIBA 5JD6A 3DTNA 1L4YA 5A05A 2VP9A 1UJ5A 3AG5A 4IX1A 4DSUA 2Z5GA 4J0KA 4UCXA 4Y9UA 1BCRA 4GICA 1OHHD 5J2TA 2ZUCA 3A9CA 3WHLA 4UTNA 2W8BB 3Q41A 2J0EA 1RSZA 2PA3A 2QAIA 3A6JA 1AO3A 4MQBA 3VMMA 4AMYA 4F5DA 1TK2A 2WR8A 2JBWA 3HU1A 1QIKA 4HWOA 3E7PA 2G1JA 4YO8A 3UJDA 1OPXA 1N5DA 3QH4A 2VVTA 2NPIA 3T1VA 1ZNZA 3PJDA 3WMWA 1GN8A 4F0JA 1L9KA 4PE5B 2P5UA 4Q18A 1ODTC 4D46A 3CKKA 1UJMA 3RUHA 1X38A 4UE3S 3IKLA 1P0CA 3DVRX 3QITA 4B3MB 2I4LA 1PVDA 1F17A 3COPA 2MDTA 2X3FA 5AVXA 4HQFA 3ER8A 3NEYA 4R0MA 2Q29A 4IYJA 5F1OA 3IHKA 4I4LA 3IXQA 4DR1B 4G97A 1J4AA 4G5SA 1E2EA 1EGAA 1Y6QA 4KPUB 1MB2A 2PAFA 3CF6R 3C15C 1A69A 2W4QA 5BW6B 2XZPA 2OHXA 3ADOA 3HB9A 5JJ5A 2I6FA 1QP0A 4I08A 3KHSA 2OWEA 5EPOA 3GMDA 5TQJA 2AEFA 2J6CA 4HQLA 4EHDA 2EDCA 1G3IA 2XI4A 5GGYA 1QB7A 1GFWA 2BGMA 3DMTA 5BOVA 2RB4A 4OO3A 4LV6A 3QJ5A 4DC1A 4Z7NB 4TM8A 3DAGA 1OLUA 4UATA 3U6KA 1Z6GA 4F21A 4OQDA 3QBJA 2WFZA 4OHPA 3ELYA 1EFVA 3E2MA 1ZM7A 3PHJA 4J6FA 3DMYA 4BHTA 1NG9A 4IVQA 1R8QA 1FP1D 2NACA 5LLTA 4E0BA 4O4IF 3L0ZA 3NG1A 4IHJF 1X42A 4WKPA 2VNIA 4N54A 2QGNA 5DVZA 3UKDA 4LSZA 3WLLA 2C2GA 4JL5A 3N2NA 5H70A 1TU0A 1A8QA 3SIXA 1E20A 1W88A 4GGPA 4JT4A 4AW9A 3OQMA 4WACA 3IEMA 1J70A 3ANXA 3UJNA 2PD3A 4LZJA 4F60A 5CX1A 3PPWA 4CM7A 1J8YF 2WM3A 4UNPA 1DKUA 3PNMA 5FQOA 1GYQA 1ETHA 1Y89A 3LCMA 3OOHA 4GR9A 4I9UA 5F7XA 3TCNA 3AIKA 3LT5A 1DIAA 5ESXA 3HCOA 1MMFB 4AULA 4ZJYA 4AKGA 3WWOA 2C97A 1XNHA 1YOBA 4Q4AB 5FV4A 1GPH1 1QHSA 2ZAYA 1K6IA 3H99A 3MMSA 1PL0A 4DG8A 5HP4A 4YDHB 3DDCA 2I3DA 2Z9BA 4BPRA 2PPLA 3OPQA 1PO7A 3RAEC 1XRJA 3NP7A 3V8BA 5E7JA 3ICPA 5B4TA 3E9EA 4BTEA 1XT6A 5GINE 1TO1E 5CDFA 1P4RA 1AGYA 1NQUA 1O9HA 2R8EA 4WLUA 1H65A 3W5IA 1ILEA 3URMA 5DHQA 2BE7A 4JP5A 4OD0A 4GBED 5F12A 4NMWA 1Z16A 1FLAA 2E82A 5IJ9B 2QVGA 1NVBA 2Y8EA 2WJAA 4NBTA 2XIQA 2IEYA 3R3SA 5DHTA 3KEMA 1EZZA 3NKLA 1X0XA 4G2TA 3VTFA 3WHIA 1MXHA 2JFYA 3KTAA 3SXUA 4EWLA 1P77A 3I3OA 3A1FA 1QKKA 1PI3A 4OHCA 2Q2OA 4QU5A 2CLSA 3TIFA 4E5YA 3U5ZB 3ZHSA 2VPQA 4E46A 3AVXA 1L7VC 1QIHA 3I01M 3OJOA 2ORVA 2PY6A 1UZLA 3ER6A 1FFGA 4QA9A 1Z33A 4YRDA 5H82A 2AX3A 1JR4A 3LT4A 3OTGA 4ZT4A 1UUFA 2OO3A 3CHYA 3CPJB 2C2OA 3BXHA 3CZ5A 4MKRA 4CI0B 1N2EA 2JGKA 5D1HA 4BKMA 3MGAA 5CVVA 5GZ1A 2RC6A 3B5JA 3HCPA 4WQMA 1X7XA 2D1FA 5JJKA 2QTHA 3L8GA 3NBQA 4WNYA 1UFRA 3IJ5A 3AP1A 3VPBA 3L46A 1E7WA 2HCBA 4FYYA 3PQ3A 4ID3A 5KYKA 1NBME 4B6GA 4UVGA 4YAKA 2PWZA 5C81A 3IOBA 1QOQB 2AH5A 2FSSA 3AVTA 2PZFA 2QW0X 3ZU4A 1Z5GA 5BV0A 4UBMA 3WXMA 1ZKMA 3H84A 1PJ8A 5BNWA 2HXYA 3PC8C 1O6GA 4GP9A 4YONB 2QN6A 3UJ9A 4JUDX 5DBIA 2VRCD 3JQ6A 4MAAA 3LFUA 1UJ4A 3QG1A 4TMTA 4EVQA 3G6WA 2ZRJA 2GA9A 2DAPA 3I6QA 5FWYB 3ZU2A 4BRZA 1QSGA 4K2HA 4LFAB 3GVHA 3QKSB 2VJBA 2FWIA 4M88A 4B40A 3O0DA 4ESOA 2ZIUB 3SJZA 2YVAA 3CH7A 2ZEJA 1TADA 3X2EA 1WTAA 4LHYA 1K8RA 4LAFA 3WGGA 1KIMA 3GRUA 3R9XB 2CC2A 2AUMA 1NVVR 1VGQA 3Q8XB 3JYNA 4H7EA 2R5FA 6AT1A 1U0BB 2JAWA 3BG5A 4CLXA 3H9EO 4BL5A 4II7A 3TK1A 5C1IA 1IRIA 4PWYA 3CJRA 3O83A 1KF0A 5GVRA 3AR9A 4D9CA 2I3ZA 2XYHA 3O4GA 1RI1A 2A67A 4IFEA 3KKOA 1HG0A 2OHIA 1MW9X 3PA6A 4M53A 4WLEA 2OK7A 4IDHA 6NULA 5C52B 2J1LA 2FUG1 3S68A 5B7GA 3FCCA 1FYEA 3F3SA 3LV8A 1WU8A 2PRSA 2NU7A 2C96A 2X4LA 1Q7EA 3UBMA 3WJ7A 3LWDA 5J23A 1UBRS 1VTKA 2WPDD 4I5IA 1O54A 3S2SA 4RY8A 5AVVA 3JVEA 4U9UA 5KHAA 4ECEA 2VT3A 4Q1AA 1PFUA 1V6SA 3A9UA 1E89A 5AOCA 3IKTA 3GEMA 1GGHA 1P4SA 3OFJA 4L8YA 1K92A 2IA5A 3GH3A 4BNJA 4C76A 3MOGA 3EGDA 2CXNA 1PV1A 3R0ZA 1TCCA 4PG7A 3L7AA 4HDNA 1Z5UA 3S70A 4C0WA 5HM6A 1UH5A 2HB6A 3R8CA 4RJJA 1RHJA 4XWTA 3U39A 1RRCA 1AA9A 4YJKA 3OFND 2YR0A 5BRNA 2R1VB 4LRUA 4WZ6A 5F7ZA 1GNTA 5D5QA 1DKPA 4RMGA 4HHEA 2JJ2A 2CB0A 4NCIA 4DQKA 3GEDA 2EWWA 3NR2A 1HFJA 3UZUA 3GFTA 1Q2UA 1B16A 4KLRA 3ASZA 3P9PA 1LU9A 5BPHA 4Z1MA 3KZKA 1P1CA 4AKIA 5B30A 1ICIA 1NPTO 4HH0A 4QL3A 2F43A 2QZPA 5FADA 3VR4D 1JLLA 4BLTA 4EYGA 5K8UA 2WT4A 4Z3DA 1KO4A 1Q95A 3JAKB 2E4VA 4RL6A 1N78A 3CWCA 3CT6A 1UZMA 1FUIA 4DMGA 2H4YA 2UVDA 2X2PA 3A3YA 1VHTA 1QR6A 3A3KA 1T8TA 1VZ2A 1IY8A 4M1ZA 3V1TC 1USIA 4OEHA 3WKBA 1GRNA 2OOKA 5B3KA 1M5RA 4H77A 2AE1A 2P2DA 1CJTC 1AKQA 4LXUA 2Z6AA 3F1LA 1VXRA 2FV8A 3ZNOA 4QQRA 1OAOA 2BYTA 3Q88A 2XMZA 4Q3OA 5AHKA 5HHTA 1OFTA 2UXBB 2XGOA 3BCHA 1Q0LA 1VJRA 2BE9A 1SC1A 2ZXEA 4OQZA 4LYDA 4C78A 2RGGA 5CA1A 3ROTA 2XDWA 3R09A 4QGAA 1MJHA 1XMXA 3IOYA 1ADYA 4MUGA 3EPHA 4BTLA 3V1YA 1XB2A 2E4YA 3R6TA 2H3EA 5C37A 2QG4A 3ML1A 4L7VA 5U4QA 5IULC 1GQSA 2PT9A 3WKEA 5T3YA 1R8SA 3FR7A 4RJKA 3M6VA 1R66A 2BOVA 2LWIA 3K16A 4YACA 4D44A 2WHQA 3IBYA 2X5JO 5DI9A 1PVOA 3ZTTA 3HBAA 3JASB 1XV5A 2B8WA 3ZGVA 4E2YA 3C7DB 1DIGA 4ESEA 3G8YA 2R44A 3H4VA 4KLZA 3PB3A 2A2ZA 2V7QD 2J9GA 1MO3A 2BMEA 2BM8A 3K0FB 4LY9A 1X9GA 3O3OB 4UXIA 3HEBA 4PSDA 4RA6B 4DV3B 5KYYB 3KSDO 1SZPA 1QZUA 5H80A 3G02A 4I4IA 3BXEA 3C1AA 6ADHA 5EE9A 1O03A 4J0CA 5HQ3A 1Q6YA 1CULC 4P53A 3LCVB 2ZB2A 5IAEA 1N2GA 3LPNA 4DB4A 1XEXB 3GEBA 1GKUB 2IF2A 2FU5C 1CS4C 1SM4A 2QTGA 2YW2A 3LL7A 3VYRB 2RMKA 1PG5A 2BH9A 1ZISA 3BPSA 2ZE7A 1KFBB 3NB0A 1M1ZA 4J0QA 1GPMA 1W581 1CZRA 4BNXA 4G01B 2WJVA 3ORSA 1VMIA 1FJGB 3RBZA 4ZHSA 4RVHA 1EUCB 1U8EA 2FRVA 1ULBA 5BR1A 1AIPA 3FMVA 3PBKA 3TNLA 3RWOA 1Q3TA 3UTDA 1VJCA 2YHSA 1NVKA 1ZW1A 1C1XA 2R6ZA 5IVDA 3T15A 4BQIA 3IIMA 3ADBA 1G291 1EK1A 1QHXA 4Q34A 4KQEA 2AHOA 5J2TF 3RFUA 2B61A 4QTUB 3K0SA 1FMTA 2AGVA 2YC2C 3HZHA 3WVNA 4ALMA 2E5LB 4RY2A 1E1MA 2EJTA 1ZSNA 3WK8A 5KU1A 2WWXA 5CDHA 1L8OA 4MI9A 1V1MA 3U1BA 1UKYA 1Z5ZA 2OGWA 2ZYDA 1NHGA 4MHSA 3UOWA 1TKRA 2YCBA 1OREA 5DMXA 4BGVA 1X14A 4KWHA 1YRHA 4QD3A 4TYYA 2JLRA 3KAQA 5DULA 5KQRA 1MB9A 1TVCA 3CURA 4KH1A 1Z6XA 4ND1A 3OZBA 1VL6A 4OGLA 3ESZA 5BNFA 1A9OA 2VR1A 4M83A 4UKDA 4EI8A 2G88A 5EUMA 4ZVLA 5IDYA 3DGFC 1KE1A 3H5LA 5KUTA 5ARCA 2WU0A 3DQPA 3RASA 1OX4A 5B58C 5KTTA 1OB5A 3HY6A 4OB7A 1D7OA 2WMDA 5AW5A 1GR0A 1IBCA 5B3JC 1ZVQA 4RK6A 3O75A 4MNTA 3EXFB 4J0DA 3OCJA 4G5RA 4C03A 4DCSA 4ITUA 1X2EA 1XEWX 3G1TA 1BJKA 2QMUA 3OE7D 5CGZA 1FU8A 3KE9A 2PRJA 3KTAB 4AMZA 1KFCB 4D02A 1BDMA 1NJSA 4EKYA 4K0KB 1Y9DA 4U8HA 2YS7A 4OQLA 5U1PA 1VGRA 3BK2A 3K2EA 2VQEB 4JR2A 1ZO8A 4MUNA 1CF9A 1SPBS 5E6SB 4M1YA 4MLPA 4BJ5A 1O94C 3U3XA 2L69A 1V8FA 1WMSA 5CDFE 2EFEB 3HJUA 1ZFNA 3U4GA 3L3BA 4CM5A 1CF2O 3EZ2A 5K6AC 2VSXA 4HFMA 3QFFA 4A4DA 2ECKA 3CM0A 4QZVA 2L19A 1OWNA 2O0MA 3BBPA 2AKAB 4P8RA 4RMHA 2ZBQA 2PE5A 4JDUA 3TRFA 1YCFA 3BICA 3H0EA 4Y0VA 4OM7A 2EKQA 3WRYA 3FSGA 2Q21A 3QXSA 5HMLA 3HJBA 4PXAA 4GI1A 2O8DA 4ISCA 10MHA 1E2KA 1F14A 1RWXA 4PY2A 1QCZA 2ERXA 4ZAXA 4CMIB 1YO6A 3ABRB 2QV0A 4JI3B 1MVNA 1S8AA 2JJYA 2ZK7A 4QOEA 5HZMA 3CQ9A 2D1RA 4EW3A 2LTAA 1Z18A 1QIDA 1D6NA 4WNIA 2Z98A 5JZMA 3GPLA 5CA0B 4MUHA 2FTKE 1THGA 4X54A 3QTLA 2Z30A 3PXEA 1XZHA 1JT9A 3MRSA 3WZ2A 5FHRA 1P9OA 2QRHA 3GGOA 4Z7OB 4J90A 1SC9A 3EVAA 3OTQA 4B2LA 3IUMA 3NAQA 4G0PA 5FBZA 3RHSA 2VDQB 1Q12A 3REQB 4HVCA 2DTXA 2ISQA 2EC5A 2PDAA 1VSQA 3D3EA 4Q1EA 5JAHA 3K4HA 4HJXA 1XLTA 2PEZA 3F90A 4Y6PA 4TPKA 5J63A 3WLOA 5HR5A 3LBFA 4XH9B 5DIZA 1T3TA 2A1TR 3AHHA 3T4XA 2JDIA 2VJMB 3BOSA 3IO3A 4IDFA 3D8BA 4LZWA 4NOJA 3SY8A 3CSDA 4BQRA 4EHBA 5GV7A 5KEIA 1EE2A 4J29A 2OXTA 4B6QA 3N76A 3P0JA 4RZXA 4ZC8A 5J40A 3TLGB 4C3VA 2VBIA 1H0KA 2IYFA 2QD5A 2C7VA 4Q3BA 3EDMA 3OO0A 4I5FA 4I0WB 2ZKLA 5DNAA 2J45A 3GY0A 3NUQA 1MV8A 2Q1UA 1JDUA 2WG1A 3WV4A 2O8BB 3DTVA 2O7SA 3TBHA 6CHYA 3HDYA 4IG9A 4EG1A 4OTZA 3D5TA 4PZLA 1UQRA 1QO9A 1N8SA 1KAHA 3JR7A 3UAOA 3UJBA 3ONFA 4DFDA 4BNHA 3M4YA 3WBKA 4D9MA 4ZI2A 5CYGA 3DZCA 5J47A 1YJAA 5PGMA 1UBSB 4N0EA 4FYHA 4AXXA 1F7UA 4M1KA 4G85A 2BW0A 1UFQA 2ZBEA 3B3AA 3DL4A 4DUPA 3IEIA 1U2QA 1S0UA 3L5KA 3OE1A 1XZJA 1DIOB 3QPCA 3EZGA 1FRFS 1IULA 5GOZA 3VR2A 3Q5GA 2C1EA 3JWIA 2C03A 3DOOA 1FS5A 2BMWA 2P9QA 1R27A 1QG4A 5G0VA 3ZWXA 4QDXA 3THYA 3PCRB 1H6BA 3KX2A 4JJEA 1MG0A 2J0UB 3D7LA 1FP6A 3Q1KA 3JVIA 4Q4JB 3L8FA 3MS7A 3STWA 4ZI7F 5EJMA 3Q7RA 1NXVA 4RGBA 3EMDA 5G0UA 5TPZA 1RCUA 1FFWA 3NC1C 3ZWPA 1DKNA 2AB0A 1Y3DE 1Y4UA 3U4AA 5DXFA 4A8PA 3T1TA 3BCRA 2ZJBA 4CMIA 1MABB 1L5WA 3JWJA 2P4HX 5SV2A 2IIBA 4DR7B 1K6MA