1IUNA

Meta-cleavage product hydrolase from pseudomonas fluorescens ip01 (cumd) s103a mutant hexagonal
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
272
structure length
272
Chain Sequence
ANLEIGKSILAAGVLTNYHDVGEGQPVILIHGSGPGVSAYANWRLTIPALSKFYRVIAPDMVGFGFTDRPENYNYSKDSWVDHIIGIMDALEIEKAHIVGNAFGGGLAIATALRYSERVDRMVLMGAAGTRFDVTEGLNAVWGYTPSIENMRNLLDIFAYDRSLVTDELARLRYEASIQPGFQESFSSMFPEPRQRWIDALASSDEDIKTLPNETLIIHGREDQVVPLSSSLRLGELIDRAQLHVFGRCGHWTQIEQTDRFNRLVVEFFNEA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords meta-Cleavage product hydrolase
publication title Crystal structures of a meta-cleavage product hydrolase from Pseudomonas fluorescens IP01 (CumD) complexed with cleavage products
pubmed doi rcsb
source organism Pseudomonas fluorescens
molecule tags Hydrolase
total genus 97
structure length 272
sequence length 272
chains with identical sequence B
ec nomenclature ec 3.7.1.9: 2-hydroxymuconate-6-semialdehyde hydrolase.
pdb deposition date 2002-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1iunA00
5AKYA 4OPMA 5CT8A 3H2IA 1ZJ4A 4P92A 2WFMA 4X95A 2RIPA 2X5XA 2ZYSA 3H1BA 1MAHA 1OXMA 2OPHA 1KU6A 3FOBA 4TVKA 1D07A 3FAKA 3WWCA 3E3AA 1XQXA 2DQYA 1B6GA 4YPVA 1K5PA 1Q84A 1YAHA 3VDXA 5AOCA 4OSEA 1ACJA 5HFNA 3PUIA 3BF8A 4AMYA 2H9YA 5KWIA 1CQWA 1CUCA 1QIEA 5T4EA 1XQWA 4MYDA 3DYIA 3H2HA 3D2AA 5ALIA 3O4HA 4EBBA 4N5IX 5AI0A 5LZ7A 2CEKA 3IUQA 4HTAA 1MT3A 2HM7A 3C6ZA 4IHAA 2V98A 3E1GA 5ISMA 1VE7A 2G5PA 3IUNA 1TKRA 2H1IA 5ALXA 2WFLA 2OGZA 3I2HA 4IO0A 4B7ZA 1H2WA 1ZI6A 3IVMA 3MVEA 4HS9A 3A70A 1F8UA 1J06A 1GT6A 3YASA 2J3DA 4UUQA 1M33A 1WHTA 4P9NA 5HKBA 3FLBA 2G5TA 4HXEB 1P0PA 4Y2QA 5AO9A 4WCVA 2OXEA 5AJHA 2X76A 1QIIA 5I8PA 4HXGA 3I1YA 2P8SA 2HU5A 3VVMA 3SX4A 3DDUA 4KR0A 4L9AA 1XZJA 1GKKA 4J0JA 2RI6A 2GBIA 1GGVA 2BCEA 1A8QA 3KDAA 4EHBA 3IDAA 4ZI5A 3QH4A 2XMZA 4CG3A 1DU4A 3WWEA 1XFDA 3W06A 2XT0A 3CCBA 1E89A 3SWWA 5ALZA 1QFSA 4FBMA 5C8XA 5CRIA 5DYTA 1U4NA 1EX9A 4H7JA 3W9UA 1IUOA 2HL6A 4J0CA 1TQHA 4P93A 1G4HA 1AC5A 2XUQA 4GI1A 4BE9A 3C6BA 3STVA 1L7QA 2XQJA 4DSAA 4LKOA 1VJ5A 4HVTA 5ALYA 5EHQA 2JGIA 1QLWA 3I6YA 4C6HA 3V1KA 5DNUA 5JASA 2XUDA 3QMMA 4FKBA 1GXSA 4Y2RA 2C58A 3AFIA 2XMBA 3DNMA 3O4JA 1GPKA 3GA7A 4A16A 5C81A 2ONCA 1MNQA 2WFLB 3VXKA 1QO9A 3EBLA 5JD5A 3BXPA 3RARA 1SCQA 3H2KA 4FLMA 3LP5A 4YASA 4DMHA 1ZICA 4CCYB 5DNWA 1IZ8A 4PSDA 2ZYRA 5K3AA 2ZYIA 1U8EA 4BYMA 1C7JA 3H18A 1X2BA 2PUHA 2HA7A 5HF9A 4Y2YA 1MX5A 4P08A 2XUAA 2JGMA 4UFPA 1Q0RA 1TCAA 4LIPD 4BC0A 1MPXA 1R9MA 3OM8A 1ZGCA 4OYLA 4X90A 3WKBA 5JALA 5CURA 1JU4A 3OC0A 5ALDA 3C45A 1EHYA 4A23A 1EK2A 2GYUA 2VF2A 2V96A 3R0VA 4H7IA 1UZAA 3DD5A 3STYA 2Z3WA 5E4JA 2WHPB 3I28A 2BJHA 3KXPA 1UKAA 1YS2X 3FBWA 2GBGA 3C5VA 2JF0A 4BATA 5ALQA 5KREA 4N8SA 1WB4A 1J1IA 5LZ8A 1DT3A 2PKYX 3E0XA 1IVYA 5LZ5A 4MWSA 4FFVA 1H2XA 2DQZA 5D7BA 1ZD5A 1IUPA 4EY7A 4XX1A 1AMNA 1YCDA 2YH2A 3WK7A 1XRRA 4Q3OA 4QLOA 4B80A 3D2CA 1VA5A 1XQVA 3G0DA 1RWQA 1P0QA 4UHCA 4BP8A 1JKMA 1CUGA 4CI9A 2DFPA 5AIAA 1UXOA 5EHZA 3FVRA 5JARA 3ED1A 2PM8A 4ZRDA 1N8SA 3Q8WA 2V9ZA 3AZOA 2PL5A 5ALPA 2ECFA 4QZVA 5K3CA 4AMZA 3IB3A 3PUHA 5F4ZA 2XUJA 3DOHA 3FWHA 5HCUA 3OURA 1E8NA 2YYSA 5ALMA 5AK5A 5HQ3B 4UHEA 1YR2A 5K3FB 1QIMA 1A8SA 4YX9A 2DHCA 1LPOA 4RGYA 1Y7IA 1NU8A 3HXKA 2JGLA 1EK1A 1JT2A 2LIPA 5CH5A 2QOEA 4UBKA 1F0PA 2JEYA 4Y2TA 4B0PA 3QMWA 4O08A 5FXMA 4HRXA 5AKXA 2O2HA 5JAHA 3D7RA 2V97A 1VZ3A 2C4HA 2XQKA 2XUFA 2PSEA 3WL7A 5HQ3A 1CV2A 1IMJA 3FCYA 1XLUA 2XDWA 4PO3X 3WL5A 3DYVA 3C6YA 1CUHA 2WUFA 2BUCA 5AI9A 2QRUA 3C8HA 3WK5A 2HU8A 3WK6A 4EA6A 2CKMA 1G42A 2VQ6A 1HPLA 5AI5A 3WIOA 3WZMA 4WJLA 4UBLA 4H77A 3H2JA 5CT4A 4G8DA 5EFZA 1EA5A 4CG2A 1EB8A 3W04A 1XLVA 1UOPA 5ESRA 2XUGA 4I4CA 4J0HA 1MNAA 4WY8A 4DNQA 3D2BA 5JAUA 1NX9A 1LZKA 4FFWA 3H1AA 5FOQA 1BROA 2ZVDA 3NWOA 4U2BA 2HU7A 3PICA 3BL8A 3RKSA 1GPNA 4FDMA 4LYEA 3FYUB 2C0PA 1W75A 2HFKA 1DTEA 2WTMA 3ZLVA 4ZWNA 4ZV7A 3W9BA 3WWDA 3QYJA 5A7HA 1BS9A 1PJAA 4F60A 3QPAA 3WWPA 4UFOA 4X7BA 2BUBA 2C7BA 3STXA 3WYNA 4KE7A 1QIKA 1W76A 4G1FA 1CUEA 4QA9A 3LS2A 4KE6A 2UZ0A 4OCZA 3PI6A 3V1NA 1E8DA 3F97A 4G4GA 1XZBA 3DL4A 3O4IA 3ESDA 4DNPA 5JAPA 4BZZA 4PF1A 3T52A 3G02A 5JYCA 1XZMA 3UUFA 5C8ZA 1EXWA 5IVIA 2XQFA 3WKEA 4WFKA 4DMFA 2X8BA 1GQSA 5DYWA 1JMYA 1A8UA 2Z8XA 3G9UA 3PF8A 4C01A 4GDMA 1DX4A 1CUWA 1MN6A 1QZ3A 5C8VA 5CTAA 5HF6A 2WSLA 5A7GA 2JGFA 3IA2A 4H7DA 1PV1A 1HQDA 2HA0A 5FRDA 4BE4A 1YS1X 5YASA 4FBLA 5I7UA 5BOVA 3R3XA 2HA2A 3C6XA 2GYWA 2OQIA 4JEIA 4BZWA 4ARAA 2ZSIA 2GBCA 3PFCA 2FJPA 4D9JA 2XLCA 2ACKA 2VA9A 3IIIA 4ROTA 2ZJFA 5DTIA 3I6ZA 2QR5A 1WHSA 4WDQA 1BE0A 1KEZA 3SK0A 2HFJA 4QDOA 3R3YA 2HHAA 3O4GA 1XZAA 4EY8A 2B4KA 4KEAA 3I1IA 1QTIA 5ALVA 5JD4A 1R1DA 3DOIA 4BTVA 2XMCA 5HK9A 1ZD2P 3WK8A 3FYUA 4KE9A 3MUNA 4UHDA 5KWJA 1XLWA 3OOSA 3C70A 3ESCA 2WIJA 3CXUA 5ALUA 4KAAA 1QIJA 5T4BA 1A7UA 4E46A 1QJ4A 1BN7A 2BUAA 4KJXA 3B12A 1JFRA 2C0QA 2WJ4A 3KOOA 1QE3A 1CUFA 2W6CX 3W2TA 4W63A 3WQHA 1CUDA 4J0GA 2JGEA 3H17A 3I2IA 4W1QA 4RE5A 4GW3A 4OB7A 1UWCA 2QUBA 3PF9A 3WLAA 2XE4A 4S0XA 4BAZA 1AURA 4Y2VA 3BIXA 1BEEA 3AIOA 2XUHA 5BWCA 1XRMA 3F98A 1AZWA 5EHXA 2J4FA 1ZOIA 4INZA 1UKBA 2AJCA 5A6VA 3TJMA 2Y2VA 1CUVA 2B20A 5EIEA 5K3DA 1JJIA 2HDWA 2XUIA 3G0IA 4QDTA 2D0DA 2WKWA 1QONA 5I9IA 1VZ2A 5JATA 4Z49A 2EDCA 5FPQA 1YASA 1R9NA 3R41A 1HL7A 3IBTA 3U1TA 1XZKA 4OUKX 3GZJA 2O7RA 1DQZA 3NGMA 2EDAA 2VJCA 3KSRA 1Y37A 4PSUA 3LCRA 1KU0A 3STWA 4X97A 1EVEA 1LPBB 3A6ZA 4F5ZA 4M0FA 2PSJA 4L0CA 5AM2A 4OYYA 3QBJA 4B81A 1EINA 5E2IA 1PFQA 1ODCA 5AM3A 4Y2SA 3BJRA 4CCWA 4U2DA 2XQGA 3DLTA 2WIGA 4GWLA 3ZLTA 2J4CA 3FSGD 3E4DA 3P2MA 1VE6A 4DNFA 5HF8A 2OCKA 4FWBA 2WHRA 3MGAA 1SOMA 5IVKA 3RM3A 5EHNA 4EUSA 1E66A 1QIFA 6YASA 1G5FA 1FSSA 5DLPA 1BCRA 2OAGA 4RPCA 5AKKA 2VT7A 3WA7A 3ZLUA 4C4YA 1L7RA 4LXIA 4X93A 2WUEA 3ZV7A 3WJ1A 4BDTA 3ICVA 5IVHA 3ZWQA 4KE8A 5DTJA 3G9TA 1QOZA 2VJAA 1JJFA 4TPKA 3B3QA 3WJ2A 1OCEA 1N5RA 4J7AA 4X6UA 3STTA 4BVLA 5FDFA 5K3BA 1SCKA 1UT6A 4NMWA 4X71A 3STUA 3O9VA 1BU8A 4I3FA 1MO2A 1TAHA 4FNGA 3K2IA 4PV7A 3WKAA 4C4XA 4ZV9A 1LPPA 4LHEA 1QFMA 4U2CA 4CFSA 1DWQA 4I19A 1I6WA 1L7AA 1G66A 3B5EA 3WMRA 5D6OA 3WK9A 4N8DA 1B41A 3AUKA 4W1RA 3FNBA 2WG2A 2WM2A 4HZGA 5AKLA 4CCYA 2YXPX 2ZSHA 4J0DA 1R88A 5HZGA 3FSGA 1IZ7A 1CQZA 4UFNA 2WJ6A 3W05A 2VJBA 1BCSA 4MJ3A 5EI5A 3KWFA 2XMDA 5AICA 4DIUA 4AXBA 3M83A 4ZREA 3QPCA 1DQYA 4MWTA 3C87A 3C5WP 1WB5A 2WU3A 3LIPA 4AO7A 4BRSA 1VXRA 5IKXA 2JBWA 5CT9A 1DINA 1W4LA 1TRHA 2I3ZA 3OTQA 5ALGA 5CXUA 3K6KA 1ODTC 3WZLA 4G5XA 1EDDA 4Y2PA 3JWEA 4PSCA 1XZLA 3V9AA 1P0IA 5T4FA 3EQ9A 1QIHA 1ZD4A 1XZIA 3BIWA 2QJWA 2R11A 3O95A 3CN7A 4K6KA 4HAIA 5DNVA 5LIPA 4G4JA 3G0CA 3AZPA 3G0BA 3DCNA 3DQZA 4KRXA 2I03A 1WCYA 2H7YA 1P0MA 1QIGA 1SC9A 5SYMA 2WG1A 1XZDA 5AKJA 3IURA 1LPAB 4ITVA 4QDUA 2PBLA 4M0EA 4G9GA 4B9EA 4DSZA 4AN1A 1CUZA 3G7NA 4DGQA 4AO8A 1S8OA 4B83A 4JYMA 1FFDA 1R4ZA 4OD0A 3FLEA 4JYPA 5EIAA 4AQDA 3SC2A 5ALSA 4IH1A 1ZI8A 3DL7A 5EGNA 2XMQA 1UK7A 3A2LA 1HBJA 2GBFA 5H3HA 2XI4A 4HRYA 4CG1A 5AKHA 3DJYA 3HEAA 1WOMA 5JADA 4UHFA 1DWOA 2HRQA 2DCMA 3QITA 3VKFA 5IVDA 1GPLA 4KYVA 4UHHA 1CUBA 1A88A 2W22A 3RLIA 1R3DA 2QT9A 4DMKA 3N0TA 3PFBA 1MX1A 3VJKA 2VTVA 4PQEA 4LYDA 4W1SA 2XUKA 3F67A 3D0KA 1HKHA 1U2EA 2PVSA 1FJ2A 2DR0A 4BRZA 4XWGA 1USWA 4Y7DA 2CJPA 1VLQA 3EQ7A 3WKCA 5FP0A 4AN0A 5ALTA 1CUXA 4E15A 4DYHA 2BGNA 4B6GA 5CBKA 1E5TA 4OB6A 5AOBA 4X85A 1LZLA 5BWBA 5LP1A 3TGLA 3GBSA 4EY4A 1XZEA 1Q0ZA 1W6RA 5ALOA 4IH9A 5LYYA 5JZSA 1E3QA 1NU6A 2CBGA 2PSDA 2Z5GA 4J0IA 2Y1KA 1ZJ5A 1LBTA 2ROQA 5AOAA 2OAEA 4GEGA 1FFCA 1MJ5A 1FFBA 2DHDA 2WIFA 3EIOA 2WHPA 1CPYA 5JZ9A 2OCGA 3HZOA 3R3UA 1CLEA 2JIDA 3WYDA 2RHWA 4W9RA 2WILA 5AM4A 1O6FA 2VT6A 4QEKA 2CUTA 1CUYA 1EB9A 2PSHA 3ESAA 4B82A 4JH0A 5K5EA 5AM0A 2QUAA 4U2EA 5LKAA 5LZ4A 3EQ8A 3BE8A 1YA8A 1ZD3A 2XLBA 3HI4A 1VOTA 2VATA 3BF7A 4V2IA 2ZJ7A 1K4YA 4QE3A 5AH0A 1H2YA 4E11A 3V48A 1VKHA 5AK6A 4OU5A 3I6MA 5C7YA 5JIBA 4NS4A 4N5HX 1QGED 4Y2JA 1QIDA 3GROA 1XZGA 4Q3KA 2IX9A 1XRQA 3S2ZA 4UBJA 1ORVA 2AXEA 5D3ZA 1XRPA 2HADA 4UBIA 5ALKA 2QS9A 4DM7A 3WI7A 3AIMA 3WK4A 1ZIYA 1JMKC 3HC7A 2ACEA 1LPMA 5ALFA 5CH3A 1YB7A 4G9EA 2Q0XA 1HLGA 4X6XA 2WUDA 1ZI9A 3LLCA 5J3JA 2I3DA 4RE6A 4ZGBA 1LPSA 5AI8A 3D3NA 4G8BA 4BCCA 3ESBA 3L1JA 1C4XA 2B61A 4DMCA 3ZPXA 4H7HA 4HXFB 4C4ZA 2ZJ6A 3H0CA 2QM0A 2PPLA 1C7IA 2O7VA 1MU0A 1K63A 2AJ8A 1QO7A 3G0GA 4J3JA 3VISA 1LNSA 4BB0A 5A62A 1BRTA 1SCIA 1WPRA 4PW0A 3VJLA 4PNZA 1H2ZA 2B9VA 5AHXA 1EDBA 1XKLA 3AIKA 2HA3A 3H19A 5AIBA 4QWWA 4B9AA 4TGLA 4H7KA 5EIHA 3G9XA 5D3KA 1BN6A 1XRLA 4M0MA 4WDRA 1CUJA 2WJ3A 3DS8A 4JUIA 2WIDA 5JANA 2VAXA 2WLSA 4C88A 4B0OA 5FLKA 5DJ5A 3PE6A 5A2GA 3D5EA 3WA6A 3WWOA 4GHWA 3FLAA 5AKZA 4U2FA 1YB6A 3NOXA 4WFJA 4MEAA 4NZZA 4C87A 4ZXFA 2HA5A 1T4MA 3EF3A 4MYSA 3HSSA 3QM1A 1K6EA 4OU4A 4K5QA 4GXNA 2WTNA 4GECA 1EDEA 2VJDA 3QVMA 4E14A 5KBYA 4AB1A 1ORWA 3VJMA 2IITA 5ALLA 1TIBA 5ALWA 2WU4A 4BAGA 3FVTA 1ETHA 4MQLA 1AGYA 4ETWA 1DX6A 4CIAA 4XVCA 4XJVA 1EI9A 2BAGA 1J07A 3TEJA 4BVJA 4Y9SA 1ISPA 5ALNA 3PDCA 2E3JA 1LGYA 2PX6A 4K6HA 4Q1VA 4EB0A 3L1IA 1CUAA 2QZPA 2XMGA 5HF5A 1GQRA 1CRLA 3G9ZA 4AX4A 2RONA 4IH4A 2Z3ZA 1YSCA 4X00A 2Y6VA 1UK8A 2FJ0A 1XZCA 3M82A 1WM1A 1GKLA 1THTA 4G8CA 2QVBA 4KRYA 2XUPA 5HKAA 5HK8A 5CT5A 1J2EA 2H7CA 4BCBA 4Q05A 3ILSA 2WUGA 4FMPA 4Q34A 4FOLA 2FX5A 4FLEA 3HABA 5BV7A 2GZRA 2PSFA 2HA4A 4H7EA 1W52X 1WPXA 3X3HA 2QXTA 4Q3LA 4MEBA 3BDIA 4NVRA 5CXXA 2D5LA 2ZYHA 4BBZA 1LBSA 4IQ4A 1Z68A 2GZSA 1CR6A 2C5FA 4FTWA 2Y2UA 5ALEA 4GLBA 1AKNA 3I2GA 4AO6A 3V1MA 3HACA 4A5SA 1R50A 4UHBA 2HRRA 4DNOA 3I2JA 4BAUA 3O0DA 2G4LA 4AZ0A 1Y7HA 1VXOA 2BKLA 3BJMA 5IH7A 5LLSA 1RP1A 3OPMA 4F21A 3D59A 3BWXA 1Q83A 3UMJA 3ICWA 3R3ZA 3I2FA 2VSQA 2WHQA 4Y2XA 3A2MA 4N8EA 1XQYA 3QPDA 2OCIA 1UK6A 4AZ3A 5LZ2A 2XB6A 3AILA 3RK4A 4W1PA 2IIVA 4B84A 1U65A 3KD2A 3K9BA 3CN9A 4QDZA 2CMFA 2O2IA 4UPDA 5AK4A 4KAJA 3M3DA 5AKIA 5T4HA 3M81A 1O6GA 4UBMA 1F6WA 3TRDA 4BP9A 2WFZA 4C89A 3DKRA 4X3CA 2K2QB 4KAFA 2AJDA 2QXUA 2WG0A 5AP9A 1FFAA 3L1HA 3F9CA 1T2NA 2C5GA 1H22A 1XRNA 2Y6UA 3WL6A 2JEZA 2O2GA 4RNCA 4X94A 3O9MA 4H0CA 2QTBA 3OG9A 5ALRA 1BEZA 2XQIA 4FLFA 2J3QA 1UFOA 1CUUA 4X91A 4L3WA 1ZGBA 4EY5A 5AM1A 1F0NA 5CMLA 4Q82A 1DT5A 4QWMA 3U0VA 3GELA 3WL8A 1THGA 1AQLA 1AUOA 4B85A 2FUKA 4J03A 4L72A 3NUZA 1X70A 2XMRA 5AM5A 4F0JA 3HLKA 1UOOA 2XUOA 2OLEA 1MAAA 3HRHA 3R3WA 2OGTA 4BDSA 3F8SA 2WIKA 4H35A 5E4TA 1HDEA 4DTCA 5FUMA 5FPPA 2HA6A 5FV4A 3DKKA 5JAOA 3I2KA 5LZ9A 2RAUA 4BCDA 4BTLA 1FFEA 1ACLA 2OGSA 2BFNA 4Y2UA 4U2GA 1SFRA 1YAJA 4EY6A 3UUEA 1AX9A 2Z8ZA 4H18A 5AI4A 1RYYA 1GZ7A 1MX9A 1XROA 4K6GA 2WQZA 4MXDA 5CW2A 2AJBA 4OB8A 5E4YA 2CB9A 2GYVA 4YK7A 1VA4A 4J0KA 3A2NA 5DYYA 1TK3A 4ARBA 2DHEA 2RGUA 1UOQA 4BC1A 1N1MA 3BDVA 1CVLA 1JJBA 3C8DA 1UKCA 3FYUC 2OQVA 2ES4A 2HIHA 2EEPA 5AKEA 2JGKA 5LKRA 3IUMA 3WIBA 3IUJA 3V1LA 1JU3A 2PU7A 1DWPA 3FCXA 1TCCA 5JD6A 1XZHA 2QKYA 2RHTA 2VAVA 4WY5A 3N2ZB 4QNNA 3MUOA 3R40A 2NW6A 4LXHA 1H23A 3H2GA 2BGRA 5AKGA 5CH8A 3C43A 1LPNA 2JGJA 2OG1A 1XZFA 2R8BA 2VEOA 5AI6A 5FKJA 2CZQA 7YASA 3HYSA 4H7FA 3T4UA 1TCBA 5HFAA 1IUNA 1CIJA 4G4IA 2PU5A 4MQMA 4DLNA 3HJUA 1CFJA 3QMVA 5SYNA 4CIBA 1CUIA 4LXGA 4XIIA 2G63A 1X2EA 3S8YA 2OCLA 1OILA 3ANTA 1ZIXA 3IULA 4FNMA 4QDXA 4BVKA 2AJLI 5ALJA 3ZI7A 5K3EA 3QZUA 5CT6A 1W1IA 1ODSA 4QLAA 3AJAA 1WB6A 2XMSA 3LIIA 3GFFA 3D4LA 4X6YA 1EH5A 4EZIA 1E8MA 2QJRA 5DWDA 3F96A 4WFIA 3CCCA 1QTRA 4X92A 4UBNA 4UBOA 3AINA 3ANSA 4FHZA 1K8QA 2H7XA 1LLFA 1CEXA 1YA4A 2ORYA 2DSNA 5A71A 1EVQA 3DEAA 5K3FA 1N5MA 4K2AA 2YASA 5AK3A 3FYTA 3WKDA 2PUJA 3GUUA 3JYHA 4JNCA 1UK9A 4GBGA 3VVLA 1XKTA 1CUSA 5JZBA 2QMQA 3R3VA 1JI3A 3Q0TA 3G8YA 3JW8A 3KWJA 3AZQA 3H04A 5ALHA 5A7FA 4KACA 2I78A 1MTZA
chains in the Genus database with same CATH superfamily
5AKYA 2W6ZA 4OPMA 2HMUA 3H2IA 4WESB 5CLIA 2Z1MA 4YCMA 2O7SA 4JWKA 1M5UA 1KFJB 4HSEA 3GJ3A 2RIPA 3W2IA 2MCFA 3LNTA 2QGFA 4XUEA 3IDFA 3TLXA 4M54A 1G21B 3GY0A 5AVWA 1NAIA 1S3IA 2SKDA 4HFNA 4JX9A 3HUEA 3ELWA 3ZJYA 3FDZB 3AR2A 4X66B 2BI4A 3A3NA 4UC0A 4BGDA 5KVCA 2O07A 4XVHA 3ZIAA 1LNZA 1RIFA 3TD6A 2Q2NA 1L5SA 3HYRA 2NTJA 4OJTA 1V9LA 1XQXA 3NFRA 4MKRA 1B6GA 4IIVA 4YPVA 2C8KA 4DMUB 1X13A 2HWWA 4CMCA 4R69A 3A1NA 3PT5A 3RUCA 4WASA 4CN8A 1QTNA 1KBQA 1UZMA 1YAHA 4J4TA 4LZZA 2NSYA 3A1DA 3RU2A 3VDXA 1JYSA 2JLWA 1DBQA 5HFNA 4DY4A 1J0CA 1QWOA 4Z6KA 1RJGA 3PUIA 4KIGA 5F77A 2B1JA 4YMTA 1QCDA 2OR3A 3QKIA 4NX2A 4AMYA 2H9YA 1T9HA 3UGQA 1C3OA 3SYNA 2A5LA 2CT8A 1II8B 2FV8A 1RIIA 2XA1A 4IOJA 4FR5A 4TT8A 1UBKS 1CUCA 1QIEA 3BSYA 2I1QA 1I7DA 4DR3B 4JEHA 3THWA 5HMLA 4BMXA 3DYIA 3IC5A 1U3VA 3DMFA 2OA0A 1JPVA 3MHPA 3LAWA 4EO4A 4IIGA 4QXPA 4EBBA 4P3PA 4A8JC 2Q1TA 1E63A 2NWQA 1MAUA 5JSHA 1QHHB 2OXCA 4N5IX 3THOA 3BWVA 1I3LA 1WKVA 2DOKA 3G2NA 5JNSA 3HXQA 5CVJA 5H7XA 621PA 4TQUS 1IK6A 2RK6A 4FFBB 5EWLB 4IHAA 2FKAA 4Z99A 1C0PA 2V98A 3NHZA 4NMHA 2SICE 5DTRA 5BYAA 3EDCA 1BWQA 4IJKA 1QRTA 1RQLA 1NONA 2H1IA 2W37A 3OIVA 4HAUA 4UULA 3TAXA 2BW0A 1Y1TA 3H6HA 3X1ZA 3MGCA 2OGZA 4UXIA 3I2HA 4IEIA 1W4BA 4JLAA 5A2QA 3NRCA 4G1EB 4IZOA 1RRGA 1H2WA 1SBNE 2ZT8A 4RESA 1IBLB 1G5RA 1QK3A 5HM6A 4ZJUA 1DAGA 2OE2A 3FJOA 1W46A 5K0FA 3FOZA 1ID8A 1UDAA 3NPAA 4MW5A 1JTFA 4D4IA 2J0SA 1JIQA 1OASA 1TYDE 1Z45A 2HPVA 1GT6A 2OV3A 3CC8A 4H27A 4B47A 5KQRA 4GS5A 4JI4B 1M33A 2HBZA 5REQA 2HJSA 2OCXA 4FOTA 1AQNA 1XYYA 5H02A 1DC5A 2DPHA 1II0A 1M0SA 1EAMA 3HJGA 1ZUNA 2G5TA 4Q9AA 4BNDA 2F3SA 3TG8A 3GVCA 1P0PA 2AS0A 2X1VA 3OKFA 4CHGA 5CVTA 1P80A 2Q3LA 2CUKA 3K6SA 3BXXA 5E2BA 2RH8A 1EP9A 2FZLA 3HJHA 4OI2A 2MT9A 2R751 1OLXA 3GCXA 2EBWA 3OIYA 4FR2A 3EUWA 2Q21A 2Q4TA 2X76A 1FP1D 2PGJA 2H16A 4TOIA 5FBVB 4Z4GA 1RRPA 1IONA 3F9IA 3FPAA 3OA0A 4CRWB 2OAQ1 3IEXA 4YCAA 2JD1A 2I6SA 3W79A 2E4YA 2P4EA 1M2FA 2GETA 2ZE7A 1OI2A 4NBLA 4L9AA 3OF2A 1CZLA 1N5DA 3Q6NA 1ZMBA 1T5LA 4D6PA 4NCNA 4DZRA 2J5RA 2OHVA 2RI6A 2HHJA 3CNEA 4I50A 1R00A 2DQSA 2DAPA 2GBIA 4LQDA 4N3CA 1RJWA 2XYVA 4KN9S 3UHJA 4XCXA 1RE1A 3H2SA 4YRGA 2FVYA 3KDAA 1OT3A 1VP3A 4RVGA 4ZEOA 1VI5A 4ZI5A 1EFAA 2WVGA 1U2GA 3QH4A 2Q3HA 1G6HA 2AI1A 4BKMA 5JFTA 4QUAA 4BMCA 3WB1A 2Y1FA 4E2FA 3ILVA 3HKDA 5BMVF 3PWSA 1SZPA 2HUNA 2IEYA 2XTNA 4E5UA 2JCBA 1T9GR 2J6CA 3HE3A 2XT0A 1QZZA 4TSKA 3QLJA 2QX8A 3WSWA 2DTEA 1QRDA 1QFSA 2BM9A 1P9NA 1BCSB 3X2FA 5C8XA 3OLXA 5JS1A 1P7YA 4YRZA 4P98A 2FPGB 4RPIA 4RVDA 3ZQKA 1NI4B 1U4NA 2Q4DA 1EX9A 2GNAA 3AUAA 4TTJA 3PD1A 1BXRB 2RK3A 3TTYA 3QOYA 3QE4A 1IUOA 4ZQGA 4CLOA 2TECE 1Q19A 1PS8A 4FDLA 2EGUA 4J0CA 3TB6A 3W5CA 2WYWA 2XKKA 2H6EA 5EQDA 4A6XA 2H9IA 2I29A 2EOAA 1FNDA 2CXOA 3ES9A 4HNSA 3MWYW 1AC5A 1L4GA 2WKPA 2XUQA 4M1QA 4JC8A 4E94A 4ECAA 4BUZA 3X2EA 1SUAA 2GDZA 4S24A 4YUAA 1K06A 1A7KA 1ULHA 4P36A 5CW1A 3ZY6A 5LUAA 3Q3JB 3OI7A 4M4SA 1MF7A 2WHYA 4M87A 2GPNA 4RF4A 1DADA 3IERA 5FPSA 5EHQA 4OGFA 1Z0DA 1IIRA 4IV8A 3S2EA 4PWYA 1E0AA 1UXHA 1XCJA 3FHLA 1QLWA 5DSZA 1CE8B 2AB0A 3I6YA 4HZUB 4C6HA 4P5DA 5EKUA 2CFSA 3A2KA 1VRVA 5BUCA 3BH7A 2XUDA 2DMRA 2JIPA 4JA0A 4JT9A 4Y2RA 4YP0A 5DNDA 3U1VA 1UBOS 1J2TA 2YTZA 1DS6A 4LF8B 3DYBA 1JJ7A 1ZISA 4G24A 4R2JA 5K8JB 4LF4B 2QNBA 4P7BA 3ELUA 3HVIA 3GN1A 3G3EA 4TV9A 3U7QA 4HNTA 4X61A 5A0FA 2C95A 4L5CA 1TA4A 3GD7A 1SC4A 1GPKA 2N3ZA 1AVTA 1SVWA 3VBEA 2MINA 3IPXA 4M89A 3TS1A 5K0GA 4N7RA 7GPBA 3N0XA 1ZESA 4HP8A 3L6BA 2PVPA 3TBFA 3HO1A 1Y9JA 2JDIA 1KAGA 1V8DA 4FD3A 5K01A 2ACVA 2R65A 4S1VA 2DFDA 1QO9A 3RYHB 2GKSA 3X1JA 2BEVA 1N36B 3R5XA 3T5BA 2IT1A 5I5GA 2P2CA 3MWDA 1AQ6A 2ZQYA 3Q2IA 4WE3A 2K7FA 2Q6TA 1ML4A 2WAAA 1OQAA 3KEQA 1HT1E 5EZYF 4E32A 4OL0A 3FSEA 1E3LA 1O0CA 1Y1QA 3IPAA 2XMPA 3HBLA 4U7FA 4YASA 1TM2A 4BWGA 4DMHA 5IAAA 5CFQA 3TSOA 3P4YA 2EKDA 2QM3A 5LMNB 3V8VA 1KNXA 1E79A 2IP1A 2UZ3A 4ZALA 4ZT4A 2YWFA 4GRAA 4UCQA 2I1WA 1KO8A 1OR8A 4FXPA 5EIOA 1QMPA 2FDCA 4BEVA 5KQPA 2XADA 1KRXA 3C3WA 2VH2A 3RVNA 4LX0A 1C7JA 1KOJA 2EHDA 1JQ3A 1PEYA 2J32A 3EGWA 5J63A 3VOBA 5HF9A 4HAXA 5L3SB 1ZS9A 1GR1A 5DT9A 4TM7A 4EKGA 2OFXA 4GMXA 1UDRA 3QLEA 4IDPA 1Y4SA 1Z56C 3OZEA 2ID4A 1N0IA 4UNRA 2DY1A 3U5ZB 4BEBA 2JVIA 4LIPD 3TLEA 3O1LA 1BX3A 1MPXA 4W99A 2HO5A 1W59A 4C14A 4EFNA 3VHLB 1CR1A 3N2KB 3O5AA 1USKA 4M1OA 4I0WB 1Z4QA 5GOZA 4FR0A 1Y82A 1T3ZA 1KFBB 2EZTA 2ODQA 3IBSA 2X0EA 3ANNA 3KS9A 3VH1A 4FOOA 2F90A 3O0TA 2QTNA 1R8YA 2VSNA 1CRZA 1T25A 5EIBD 4H7IA 4HMOA 1CY1A 4MVJD 2EYQA 4R1QA 1ILEA 1VFPA 2A5DA 1MV5A 1O5TA 2CKDA 2XNKA 2JFFA 1Y5RA 1ZJWA 3V7WA 4P3KA 2BJHA 4FIZA 3T9FA 3CJTA 1YDHA 2JJ2A 1U8ZA 1O77A 3HY3A 3WMEA 5K0BA 3NBZC 1POWA 1XD9A 2QNRA 3TR5A 4OLFA 1UMDB 5KREA 3F4LA 4U39A 4YAGA 3UPTA 2PZJA 4DCOA 1WB4A 1J1IA 4C06A 2GK4A 4TUYA 2GPBA 3MJDA 3ZI0A 2NO5A 13PKA 1DNPA 2PKYX 2Q99A 1V2HE 1XU7A 2J30A 2WPDD 3LUJA 3WYBA 4EM6A 4FGKA 3FPCA 5AFSA 4QXOA 1U99A 3JZAA 1FYXA 3L4SO 4U02A 1VJ0A 4A82A 4BZPA 2OC9A 3JATA 3R23A 3CVVA 1T3SA 1DZ3A 3COZA 4WLNA 2GZ2A 3IHTA 1DEKA 1HEUA 2RGEA 4L07A 5DTMA 4XX1A 4EY7A 2C31A 2Z08A 1YCHA 1EX6A 5A4KA 4Y6RA 3PPVA 3UANA 4W5QA 1VECA 4RW0A 2V4ZA 4REQA 1R64A 4EKYA 1PAUA 3L1UA 3WK7A 1HGXA 1QS0B 2IW3A 3JQFC 4ENTA 2Z6AA 3ZHSA 3ODPA 3PUXA 2JZCA 3TXAA 3EXFA 3EUAA 2PYDA 2PGXA 3GLQA 4QQFA 4C07A 5BQPA 4B80A 4YQFA 5B2ZA 3N76A 1PFUA 5EERA 1E3IA 2OCAA 5JH7F 4DV3B 1V3QE 3KWLA 4F8YA 4HVAA 4RULA 3H2ZA 1GZ6A 4YV7A 1BZYA 3QEOA 4UCWA 1P0QA 1RWQA 4MW2A 1B73A 3T3HA 1JKMA 4OUDA 5JHGB 3GPBA 1NNI1 3ZOKA 4IGIA 1CUGA 4A7PA 2IOQA 4PLZA 4EWLA 4N0QA 121PA 4IQFA 4CI9A 3TAHA 2B2NA 5E7MA 2AHRA 2D2FA 1JKJA 4KYTA 3GIWA 4EPTA 1ORRA 3I37X 3O2JA 2AZ4A 4KQHA 2OLJA 1BOOA 2O3RA 3Q72A 2Z57A 1QG0A 1V45E 2W7TA 3A1UA 3RVSA 2MINB 4A26A 4XFKA 4YLEA 4BN5A 1ZC3A 1L5HB 3CHYA 4ZRDA 4DA9A 1CEQA 1N8SA 4JXJA 3Q8WA 5H0IA 3D6UA 5JSQA 2FFQA 4QPPA 2CSXA 2FSVC 2HPZA 2X6RA 3I83A 4AJOA 521PA 4ZO8A 2DWOA 1OSNA 2FA9A 3A9WA 3AZOA 3MBOA 4P82A 5ALPA 2ZRIA 3FF4A 2XGSA 2ATCA 2ECFA 1RM3A 1YFKA 2JAPA 3QVGB 3SNKA 2BGWA 2EW8A 5K3CA 3G8DA 3R7BA 2EC5A 4NPAA 2B4YA 4WK4B 5JMWA 3ACCA 2HHHB 4H6WA 1Z2AA 3OU6A 1EIWA 4TQ9A 1UBUS 4EDFA 1MJGM 2EGHA 1X15A 1E8NA 2IYLD 2JBAB 2W70A 4NARA 4Q15A 2I5PO 1R8JA 3KM0A 4IRUB 3LPNA 1BQ3A 3FFXA 1JKFA 1JLLA 3ZNPA 3BHJA 4MV1A 1Y3CE 3L7IA 2OD2A 3MJTA 4EEZA 5FUQA 1PTJA 2B25A 3LPDA 3IMGA 2C00A 1UAGA 2QRLA 4MVXA 4ETMA 5BOSA 2QTRA 3AJ8A 2SECE 1PEKE 4UMDA 1UAAA 1EDOA 1EK1A 2JGLA 1ZNXA 1JT2A 3EC2A 3DT6A 2VJPA 1WXXA 3JU3A 1RAAA 3E1SA 4CVNA 4OX9B 4XW2A 2QOEA 3TZLA 3FRJA 1PJCA 4OV6B 1F0PA 4QQNA 5K45A 5KSWB 3RRYA 1QZTA 1ZWLA 2F00A 4K9DA 4IPTA 1JA1A 2NO0A 2E4VA 3QMWA 1W35A 4DABA 3ETLA 3FY4A 5I4IA 3AKEA 3H1GA 4MQ5A 4HRXA 2FPMA 3T41A 3I32A 5LQKA 4CWAA 5LJIA 2O2EA 1PR4A 5EOVA 1NVDA 3BD6A 1E2EA 4H59A 5JAHA 3LL4A 4Y1RB 3P0HA 3VU1A 3AUSA 4R6XA 1MT0A 3U7EB 1VPVA 1VZ3A 5CNMA 3URKA 1AK1A 1R4AA 2JAWA 5C46F 5EE5B 4JB2A 4OAQA 1ZW1A 2XQKA 4AJNA 4R41A 2ONKA 1P2GA 3ZCRA 1RTTA 4D2IA 2HSGA 2V65A 4EUEA 1XHFA 3EZFA 4F85A 3QELB 5BO5A 1XUOA 1JFSA 1PI3A 3F4BA 4GR4A 1P3Y1 4EVRA 1P1RA 4TV9B 3IILA 1PWZA 1XLUA 1KH3A 2LD4A 3P9SA 1O58A 3DYVA 4G0ZA 4D42A 4NRDA 2QRMA 4OJNA 5GGXA 4JLWA 1N1DA 1ZK0A 4MMZB 4PNPA 3GT3A 3BWDD 5AI9A 2BKVA 4ZIRA 1JLKA 2QRUA 3VR4D 1KJWA 4R1MA 3PJRA 2NZ8A 3GLRA 3H5OA 4GRIA 2IYNA 4NE9A 1RMQA 2AIRA 3DB2A 3OQOA 2CKMA 4OM8A 4IJQA 5AVSA 3RC1A 2ODWA 2VQ6A 1HPLA 2JS7A 4GYKA 4YCDA 3GK3A 4XB6B 5BW8A 2VQDA 2YXBA 5AI5A 2CXUA 3U48A 3WIOA 3WZMA 4UTVA 5CA1F 3ABZA 5AUNB 3UKJA 4IMJB 5D87A 3TOVA 4L3OA 3CSUA 1VLJA 1EAYA 5EQTA 2B8EA 4KGXA 1Y80A 5EFZA 4CG2A 1KVSA 4EHDA 4A4DA 5E6RB 1U28C 1YJXA 1KQGA 2P9QA 3HVUA 1XLVA 1YBHA 3LKDA 1UOPA 1A97A 5D1HA 5AW0A 2XUGA 3KE9A 1KVRA 2O8NA 3TG2A 5SZIA 1RHKA 1W47A 5DLYA 3R8CA 3TDMA 1NF8A 3CVYA 2H5LA 3AL2A 3HB5X 3D2BA 3H99A 1RM5A 5K0LA 4PTLA 1LZKA 1CZOA 3O83A 3H1AA 1QHGA 3CWQA 5TC4A 5B3AA 3NWOA 2O3JA 2VJLA 4C7KA 4XGQA 2NNLD 3SYLA 5EZYB 2ZXEA 2WB2A 3C6MA 4PFKA 2ZYWX 4OYRA 2CFIA 4D6XA 1DTWA 1F6DA 3EE6A 1I80A 4I1RA 3WRWA 1FB5A 4PC6A 1K75A 4Y2GA 3DV0A 3DZIA 4XZ3A 3UGTA 1P8AA 5JQGB 1ENOA 1DTEA 2WTMA 2UZ4A 2JLVA 1RQ2A 3STHA 2DX7A 1YS7A 3VNAA 4QEDA 1KIFA 1UADA 1Z6ZA 2X8WA 3NP7A 4JHLA 3LYUA 4FFPA 5AW6A 3FGOA 4JJIA 4WJKB 1A0OA 1ZDMA 3AVOA 3M2PA 1T6ZA 3QF7A 4XJSA 1LW6E 1SD5A 2G1JA 3EPRA 4MQEA 4ZPJA 1YJCA 3IDZA 5IN5A 4EB8A 4OQLA 4FEGA 2V4UA 1D2RA 1UZLA 4UJ5A 8ABPA 4M6WA 2XPCA 1MO4A 3I2YX 4G1FA 3DVRX 3AW9A 3OEED 3B6EA 4FYYA 1XMOB 3K9NA 1CUEA 4EYSA 2F1KA 4BLTA 3EGOA 2GXSA 2WHEA 4QA9A 3T7EA 5AXCA 4FGZA 1BD3A 4BO7A 3LS2A 4LZWA 1Z62A 3E7FA 3WGGA 4RLQA 4OCZA 2E0IA 1R27A 3PI6A 5GWXA 1XT6A 3V1NA 4FCTA 4KN8A 3F97A 4BLPA 2AHOA 4MWZA 1I7SB 4N3BA 2EERA 4KRFA 2BMWA 2II6A 3GGOA 4NMLA 5JAPA 1EBBA 1XNHA 4AKHA 4PINA 2Q5LA 3IRUA 1V4BA 1GNPA 3CJRA 4I6EA 3TMKA 1ANKA 4ZZIA 4D0SA 2FRVA 3KQLA 5EJFA 3T52A 5LYJA 5JYCA 4B35A 1FP2A 3TTXA 1BWRA 1KYWA 3CX8A 2XAAA 1NW6A 2DR3A 4YJ3A 3OM9A 5DSXA 2E1RA 4H60A 4QOGA 3WHPA 1E0KA 2IHTA 4A5OA 1A8UA 1HORA 1OFUX 1JPUA 4YR9A 5JBIA 3V8PA 3UK6A 3AFGA 3PF8A 3WGJA 2AVDA 3CMMA 1YBAA 2H1LA 4WZAA 3EFHA 3LWDA 1VKRA 1KK2A 4C01A 1VYHA 4OK3A 4YMLA 4G65A 1U94A 4YH1A 4ON9A 2Q28A 1P44A 3UXHA 1MN6A 4D57A 4IP0A 3DSRA 3SE7A 4D8UA 1Z7GA 4G56A 4CQNA 1OIXA 4RM2A 2H00A 3ZXSA 3UXYA 1U2DC 5HF6A 1WZUA 2PGLA 5AVQA 1C9DB 4CYMA 1KPHA 2GN2A 2JGFA 2XOXA 2VF7A 5CEEA 2WWIA 5K09A 1GUFA 2W2TA 1Q0PA 4H7DA 1BW9A 4H17A 4HOYA 1BDBA 4ENQA 4D82A 1L8XA 2HA0A 5FRDA 1ZU4A 4RKFA 4TUYF 5FFMA 4BE4A 2XITA 4FBLA 5I7UA 2IJGX 1VJ1A 1V6SA 3KZ1E 3LT2A 3QFCA 4JT4A 1KDVA 3LOQA 2IV2X 2XOKA 2ZTHA 2ZTVA 4NBUA 5IC6A 1OIVA 4KWEA 5BV2P 3GFSA 3RIXA 1W0KA 4ZYWA 1CYEA 1AGNA 1KFKB 1TM4E 1UC9A 3PV0A 1OUMA 2FYTA 1TJ5A 3LDHA 1P6UA 1E1RA 2QVZX 4JEIA 1O95D 1TVMA 2XNDA 3IP5A 1KI8A 3C3EA 3FLMA 3PFCA 5LXTF 3CRMA 5HE8A 2OKCA 4D9JA 1GZVA 1NWCA 3T5AA 2XRFA 3AVTA 4YO8A 1FDRA 1VPLA 2EJTA 2NSJA 3CRQA 3N74A 5CIWA 4HEHA 3HKBA 1M66A 4OKNA 5K0CA 1YDWA 1SO8A 2VZEA 4C05A 3HB9A 3E61A 4XIJA 1CY6A 1JQAA 3K9HA 3ZBQA 1VL2A 2OBNA 1RTKA 1M8GA 1KQ3A 2LTAA 1WHSA 2PMWB 1I30A 1PJ3A 2H51A 4FUTA 1Q7BA 2ZRJA 4L27A 2C94A 5FHRA 4TMZA 2Q5IA 3OX3A 2ZT5A 3JSXA 1KO7A 3UMVA 3R6LA 3R2JA 4ZAWA 2NO4A 3MGKA 5B3KA 3EUEA 1DEAA 3C97A 4QDOA 1PDVA 2AWNA 3PHLA 4Y3UA 4EY8A 2FPUA 4CM7A 3ENKA 3FPLA 4QPDA 4TTRA 1ID1A 4C4TA 2UYCA 2O5EA 1IE3A 1MFPA 3P8ZA 3PNBA 4G5YA 3I1IA 2R7NA 3UFXA 2B4QA 2YFKA 4NH4A 5A0TA 5J58A 2J5QA 4INAA 2C2HA 2YVAA 1FMCA 3HY4A 1GNSA 3SQNA 1EK5A 3PDIA 2HHCA 4FOSA 1N2IA 5KYTA 3COVA 3TQRA 4KE9A 1ADGA 3T99A 1WXFA 2CHEA 2C77A 1T3TA 3ESCA 5SZJA 3SKVA 3U19A 3W34A 1JG6A 2ZETA 4MI3A 1JHXA 4GGMX 2PX0A 4X84A 2F1OA 3V7NA 3ETCA 3WYAA 3Q8KA 1C7RA 3H5IA 4HG2A 3R9WA 1A7UA 4Q01A 3DE7X 4XSGA 4ZD6A 3F78A 4X8LA 4YRSA 1UJ6A 3F2VA 3WNQA 4QDJA 3ZR4B 2JIMA 2GHTA 1QJ4A 1BN7A 1ZR2A 5BT8A 1M3SA 4BQFA 3TDKA 1X7DA 3DBHB 2QAGA 5IJAA 4KXFB 1W7AA 4B4UA 2ZUDA 3B12A 1UBRS 2QRGA 3C4VA 3HCAA 3QVJA 4JP5A 4WXYB 2YZNA 5B1HA 4NCBA 3KEGA 1QQAA 4MR9B 4HDAA 5HJ5A 2QPTA 2QV0A 2X0NA 1DEHA 4PANA 5M2QA 1OTYA 3WQHA 3A6HA 4J0GA 4LSMA 1NBMD 1WRBA 2P4UA 4OHRA 4RA9B 5B1IA 2VHUA 2B7BA 4HN4B 1JWLA 1IY8A 4M9RA 3RS2A 1YBFA 2YCBA 3SOPA 3SZMA 1WPQA 1XPRA 4AIRA 1U5BA 4B74A 2EZ9A 2XW6A 2X23A 1JDSA 1PR3A 2NADA 3JQBC 3FNEA 3PGVA 4JROA 4WWHA 2PBRA 3N7AA 3X1YA 8GPBA 2JFNA 4FWIB 3U4GA 1VHJA 5E4FA 4BGEA 2PS3A 2Z2XA 5CPFA 2HT1A 1UIMA 3ZD9A 1JALA 1DMSA 4O1IA 2BKEA 1BEEA 3ROMA 5IH3A 1NJ2A 3EW9A 4QG3A 1OF1A 2EX1A 2MU1A 5C1OA 5TLSA 3PRYA 3OLYA 5LNK1 4O2AA 1X9IA 3B13B 3IAHA 5CA0A 1TU4A 3FZYA 3OT1A 5L8VA 4NV0A 3B51X 4EA7A 2WKRA 4ARZB 1NY5A 3CUKA 4ZTBA 2HDHA 5HJ2A 4WOCA 3ZNNA 3KXDA 4INZA 4MQFB 1C7FA 3UA4A 4XDHA 5B1EA 2I91A 3NASA 3VFDA 2CLDX 1V39A 2AJCA 2LWIA 2H4XA 1O94C 4RYDA 5K20A 5AW8A 1SBCA 4B4OA 3CF4G 1CUVA 4ZVNA 1WXQA 4E1BA 3P19A 5EIEA 4PG4A 5K3DA 2JIZD 3AJEA 2HDWA 2VHEA 3CU5A 2D0DA 3COSA 3D8SA 4QTZA 4XAQA 3RTAA 2P0AA 4HD8A 2V1XA 2WU1A 4NXNB 1ND5A 3K8YA 3LQQA 3L8HA 1TCUA 2GKOA 4KMMA 4Z8XA 5FFNA 3QUBA 1L4KA 1SIUA 1V1JA 1CFZA 2VG8A 3L7JA 1NXTA 3ND5A 1U7OA 5BMVA 2G9QA 1OOEA 1U8TA 2RIRA 3QWHA 3ORFA 4DAOA 5LUBA 1MEEA 1YASA 4CN9A 2AOTA 2GJSA 2P4QA 3IBCA 2VYQA 3OEEA 4GOLD 3U1TA 1XZKA 2YQ5A 5FBKA 4QHSA 5AVRA 4OUKX 2ID8A 4NOLA 2IYQA 4ENWA 1UCFA 2CLLB 3RH0A 3Q3HA 5G1NA 4UUAA 4D7AA 3MRXA 3O1HB 1ZEJA 4FGSA 1AIPA 5JVDB 3G6KA 2XDQB 5IXSA 1VKOA 5IC5A 5EJ2A 2WWXA 3F46A 1C9JA 2SNIE 5C80A 4OXRA 1G5HA 2NPFA 3BFXA 2YS7A 4QFDA 3BREA 2C4UA 2IYTA 1J0XO 1H66A 2YHUA 1EBFA 4YC7A 5F4BA 1FUEA 1YVUA 2JK1A 3IE2A 2I6QA 2JJQA 4PZAA 4KC0A 2L2QA 1Z34A 3BFJA 2BT4A 3OTWA 3KKLA 5AM3A 2RHMA 2VDNB 3B82A 3FKSA 3G1WA 4L16A 4OTZA 5GV7A 4DARA 3BJRA 4EGFA 3I05A 1R0YA 2XWJI 3K0CC 2AQ8A 4A15A 1EMDA 4FHDA 1L5KA 1CVRA 1NUSA 3Q3VA 2J4CA 1FDOA 1NL3A 2FQQA 3VAYA 1UJMA 4IL5A 1KXJA 1DAKA 4O4IA 3V3TA 5JCPA 5FWXA 1VE6A 4E51A 5HF8A 2BMJA 1XTJA 4FWBA 3ZOZA 3GDGA 1LRJA 1RRCA 1Z83A 1SOMA 5EEHA 4HVLA 1C0EA 1E66A 5DLPA 1VSBA 2D3WA 2OAGA 5AKKA 5BR1A 3WA7A 3ZLUA 2VYFA 2QRPA 3H6GA 2G9VA 3HZHA 1KPGA 1M72A 4R8MA 1L7RA 4LXIA 1T4DA 5CCEA 1AS3A 3W5VA 4O4LB 3V4OA 3ZV7A 4GC9A 4X44A 3WJ1A 3H5LA 1V5FA 1GPMA 3LVRE 3FXAA 2AQKA 4CTNA 1GG9A 4D5EA 4OP1A 1JXMA 3PA6A 5C4GB 1G18A 4M0UA 5DTJA 2O9JA 4OHZA 3G9TA 1I6MA 1I0LA 3FUWA 4MRAA 2OFOA 4TXMA 2VJAA 2BIFA 3ZD8A 4R71A 2HI0A 4HUTA 2KE5A 1WBDA 3NMUF 3GFOA 2NO1A 1U9CA 3JATB 1OZ0A 2PKCA 3W1WA 1YS4A 2Q5QA 3EAFA 3SJUA 4B4WA 4XGRA 1I5RA 3U49A 3LLSA 3IAEA 2P2YA 4BNUA 5C34B 4X6UA 1WQ3A 1W94A 5JAMA 2VTDA 6GPBA 4TKUB 3LY8A 3M1AA 3ERCA 2Z8YM 3ZE0B 4W7IA 3P26A 4QXRA 3WB9A 2BH2A 1SCKA 4OQ4A 3D9QX 4NI5A 1YI0A 2P77A 2WDZA 1UT6A 1KH2A 1Z25A 2PUBA 3OY2A 3ZCTA 3EA5A 2CXPA 1KYTA 1KDZA 1F48A 3M3PA 4G8JA 4Z1MD 1IN1A 2NXWA 2CLIB 5TV2A 2PMKA 3OJWA 5K8LA 3Q88A 3BEDA 5FQNA 2EX0A 1U90A 2K7ZA 3PDIB 4JC5A 4FNGA 4QQRA 1JE0A 4XJXA 3QOXA 4CQLB 4EMTA 4EG5A 2VNJA 2H2FA 3CUVA 3DNPA 2G7MC 2VNKA 3K2IA 4Z9XA 1QQ7A 3RF6A 3ZHRA 2BRUA 4C2AA 3PNPA 4ILEA 2MWMA 1OLSA 1HQCA 2NTEA 4OH7A 3DZFA 1V4NA 3EQZA 1NFQA 1T34A 3AR9A 4QEZA 3S5UA 1J7JA 5IZ4A 1LPPA 2C2KA 2LKCA 1AH2A 1QFMA 2X5JO 4KQ9A 1NN5A 3CNHA 1QAOA 3A05A 3VM6A 1Z2NX 2QMYA 4XD7A 4DY6A 3L6RA 1SQ6A 3I5UA 5AJTA 2CD7A 3N6RA 1ADFA 2REBA 1OBVA 4PG7A 5KU1A 3AY7A 4NDNE 1P2UA 5KYYA 3JQ9A 4IDNA 4GYYA 5E38A 1GL7A 2XHZA 4JCCA 5D6OA 3FTNA 3S1LA 4E4TA 2H1FA 1JB1A 2Y1LA 2YXDA 2VBFA 2A5GA 2BELA 3IMCA 5HKKD 3K53A 1M9NA 4N8DA 5JSKA 2DSTA 4KYIB 2VXBA 3QK7A 4AJPA 1FXSA 1FYEA 1PJSA 4M1ZA 1IY2A 4CM1A 5CFZA 5TDHA 4B3XA 1EM6A 2H2HA 4XOUA 4P4TA 5LQSA 1C8VB 4E70A 4TRJA 2J67A 1J2JA 3L7LA 1E1KA 3V2GA 5K8UA 5HZKA 4U7PB 2CYAA 1FTNA 2CE2X 2P2ZA 5DPMA 3U5TA 3D31A 3GQVA 4LZPA 2ZSHA 4CQMB 1FLNA 1MXHA 1XL0A 3LQ2A 5TE9A 2QUHA 3BHMA 4BO4A 4JQCA 3DV0B 5LC1A 2CVHA 3TZEA 4MUXA 2FSUA 3E23A 3GMDA 1WTCA 1BE8A 1E2HA 1N2SA 4PQYA 1I14A 3FSGA 4V24A 1IZ7A 3UN1A 2GF0A 2RHGB 3GLVA 4UFNA 3UZUA 1XMIA 1GGMA 4B7UA 2WWVD 4PYKA 3KV3O 4BO8A 1YD7A 4G5QA 4IJMA 1N4AA 3K6JA 4O63O 1Y9DA 4POAA 2FW9A 3PCRB 5CBPB 1R6TA 1X80B 4G36A 3W3ZB 2FHPA 1MC5A 5AICA 1GNVA 3QXXA 4Q1DA 4UDNA 4BO1A 3RE1A 4W5NA 5JNUA 4FWTA 1DQYA 2F9LA 2Z2IA 4MKZA 4EG7A 3C87A 3AP3A 3PQ4A 2V6JA 2B92A 2PH3A 2C3PA 3C5WP 4HQLA 5EJGA 4JUAA 3IIKA 4JMLA 5IKXA 2JBWA 1E1MA 2P68A 2DHQA 4WMLA 5CT9A 5A9TA 2QROA 3V6MA 1P0CA 5CLGA 1HE8B 3DMHA 1EE9A 5EPOA 3WWZA 4RFSA 2AC4A 3OTQA 3LUFA 3PPXA 4P53A 5AJUA 2I3BA 1L5GB 4BB5A 3DVQX 2ERXA 1X7WA 4O0MA 2AZXA 1J24A 1RYNA 1Y42X 2DB3A 3P52A 4G5XA 3FR7A 3A58B 1DLJA 3PHGA 4I9UA 4I5IA 4NR0A 1EDDA 2XDYA 2EW1A 5FOVA 4PSCA 3IR6A 1XZLA 4QGBA 3CLRC 1JBEA 4EHKA 2Z6QA 1E9VA 1TAQA 1TMOA 3B1KA 4ZQHA 2G08A 4ITRC 2KMLA 2QWXA 3L92A 4CMHA 3GBVA 3WG9A 1QHIA 4WESA 4AROA 4PHTA 1ODFA 1M6VB 2H1SA 3USCS 3J81k 2Z8YA 4HNAB 2J9FB 3VDRA 1A04A 3M6IA 2OVBA 3G2HA 1PLJA 2AFVA 1V7ZA 2I55A 2I67A 5FI5A 2G09A 3WGQA 4C22A 3ZJVA 3IV9A 3ZBTA 2YC2C 3LRTA 1FW6A 4AZ0B 1R16A 4TMWA 2IWHA 5EJMA 3HA3A 2EZ8A 1VSQA 3D3WB 3Q8LA 3R4VA 3UJ9A 3H8SA 1PJZA 3KLBA 5A4IS 2HRBA 4RH1A 1ZMXA 2REOA 1Z0FA 2YMQA 3CN7A 4K6KA 2QIPA 4UJ3A 4ZVOA 4ZCPA 1B1AA 3HU5A 4FYMA 2QMHA 1YU9A 1N2BA 1D2EA 3JASA 3RPEA 3PX2A 1GL3A 3T7RA 3AZPA 2ZYTX 4YRMA 5JYDA 1GDTA 2P75A 1J6UA 3QWIA 4CF6A 2Y1OA 2PQ0A 4P38A 5LL6P 1R18A 3FRIA 2G9UA 2ENWA 3EEBA 2A0UA 3KQUA 4IIXA 3TTUA 3KJZA 5DEOA 2JZNA 1P0MA 1QIGA 3BSSA 3L79A 5KI6A 2GZMA 3PXBA 4JI1B 1VIDA 2I7DA 1GTVA 3JWGA 1Q0QA 1XVLA 3RS7A 1Z8NA 4FFMA 3REOA 3ZY3A 4WNIA 4DQXA 3EY4A 1T8TA 4GXTA 3GAZA 2YMPA 3L8GA 1F51E 5KSOA 1ZU5A 1BG6A 4M1SA 1N2GA 1G6KA 2I33A 2VBIA 4GOJA 4ITVA 4JJAA 4QDUA 3IDQA 5ECWA 5HE9A 2RAFA 1MIOB 4EVIA 3HDQA 4OHMA 5CDFA 5AVXA 2QVCA 3ITDA 1H65A 4DT1A 2YVKA 1W2WB 3FM9A 2EKPA 2A9VA 3L4EA 4NZPA 1FFDA 5TVKA 3W6UA 2BEUA 3FLEA 5DLDA 5JC8A 4M3NA 4OL9A 3SC2A 3WQBA 1E9RA 2FPSA 4LOKA 4E1VA 2AEEA 3DL7A 2XMQA 1LSSA 3WLKX 2P9GA 2GM9A 5DWVA 3A2LA 2FQXA 2YYAA 4XPIA 3FYHA 3SYTA 1RLMA 3DBIA 3GGDA 1MJFA 3ZU6A 4A73A 4B09A 4KR2A 2VI5A 3AXSA 4CF4A 4GOXA 2CNDA 3TOXA 3PUJA 3R0JA 1QHFA 5AKHA 3DEFA 3HFRA 3HEAA 3UYLA 4MDEA 1E99A 1WOMA 3M6VA 1NOKA 1O7JA 4UHFA 1JEYB 2GEVA 3U3RA 5FTLA 5JR3A 1H0RA 3H84A 4JK3A 1VIMA 1CB7A 4U00A 1TLTA 4UMVA 5KYXB 2ZWAA 4XSHA 4OI1A 1TC1A 2X9LA 2XE7A 5KJ1A 4MUEA 3SBOA 5KINB 3LOUA 4OHCA 1CDZA 2GJ4A 1AO0A 3KHUA 1SUWA 4P3XA 3Q7IA 1GPLA 3SZGA 1WXDA 1Y0BA 4KYVA 2N1MA 1NVTA 1CUBA 3E22A 2OO5C 5FL3A 3QWFA 3A9SA 1OAOA 2ZS8A 5KYKA 6NULA 5GIOE 2QT9A 3K0AA 2P3OA 2FHSA 3QVKA 5KTKA 4XR9A 4M7PA 2C5SA 2AEMA 3CWZA 5FBWB 3OE1A 3A14A 4JDPA 3WGOA 2CY0A 1GQ2A 3EQ6A 4MS1A 2FLVA 2FSHA 4JYAB 2VFAA 3D0KA 4W5TA 2LDBA 2ZM6B 1IZ0A 1R6AA 1FJ2A 2DR0A 2VA8A 2HSDA 3BKXA 3AR5A 3C4QA 4BRZA 1M1YA 2HJWA 4CI0B 4HPWA 3RT9A 4Y7DA 5JCOC 2CHUA 1UBNA 3EX7C 1GY8A 2P35A 4U3JA 1KETA 2DYKA 1ILWA 1JAZA 2YWCA 3CTMA 3I0NA 3WKCA 4I50F 4BZQA 4G0VA 2BTEA 5KHLB 2VBGA 2VN8A 1L7NA 3BK7A 4K8OA 5JRZA 2XRMA 2KBFA 2AZTA 5EKDA 1XVUA 5LVAA 4DR1B 3HA7A 4E15A 4DYHA 2F3QA 2BGNA 1UH5A 2P6PA 1LV8A 5CEFA 5K3SA 1DJQA 5IPFA 4CR6A 1U7PA 3PXEA 2O8EA 3A11A 2OFFA 5K05A 3TIXB 2VAPA 3ELDA 1V47A 1W96A 3EXIB 2X9VA 3JZIA 4Y0NA 3U0BA 4CE6A 1CDEA 3I45A 4ZHQA 3LXUX 1GOTA 5T7BA 4QIHA 2GCNA 4EI7A 3LF2A 4MUFA 1CRQA 1JXQA 2ICAA 4P81A 1X7XA 2C7VA 2PKEA 3EVEA 5I7OA 4W8GA 4N5NA 4G63A 2FFAA 4IUDS 3ENVA 1BEUB 1BHQ1 5ALOA 1GD1O 2EF1A 1SVKA 4IHJF 2ZBGA 5B6IA 4QBFA 1TLFA 5T6MA 2UXDB 2XB2A 5BQXA 3V7UA 2A0FA 3ADKA 4JFRA 5BMOA 4H3HB 3PJFA 2PSDA 4J0IA 1PEAA 2AG1A 3E0QA 5ES3A 5H83A 4ZCLA 5C3UA 4EATA 1GM5A 2FE4A 2ROQA 2QPOA 5ICGA 3SQLA 4RTOA 3KVRA 4QO8A 3ADCA 1FFCA 2QZ4A 1YRBA 2AV6A 3KT3A 1XG5A 5BNZA 3PKIA 4M1YA 3GUYA 3K0CA 4IMPA 1MJ5A 1I4LD 2F48A 4I1UA 5DE3A 4C29A 5AJVB 2VJMB 2CL6X 1NRIA 2WUVA 3BCUA 3JQ7B 3LCJA 3OZFA 1OB5A 2DM6A 1I2MA 3TGPA 5KO2A 4MI9A 5FAKA 1E5LA 2ZAOA 3ISTA 1E1CA 1E96A 3RVMA 1PR0A 4N6GA 3L7BA 5J47A 1PWHA 3EFOA 3ILYA 4L8WB 1TZMA 1KZ4A 2AL7A 3WYDA 4IV5A 2VHQA 3TOCA 1FDSA 1RJFA 1CD5A 3MQFA 4P80A 4JFAA 4W9RA 3RFXA 2EV9A 4UTPA 3W2HA 2PUVA 5HVNA 5HIAA 5DGXA 4LJSA 3FW1A 4UE3S 1WMEA 1BYUA 2YWHA 2QE6A 3EVFA 3ADPA 3U7GA 3ESAA 4B82A 2XGJA 3VNUA 1SEPA 2GT1A 4M9QA 3B36A 1DIAA 2W6MA 1H1LA 3ZH2A 1C8LA 3DBHA 2BZSA 1FFXB 2IZZA 2J9RA 2R6CA 2QUJA 2ZAGA 3N0WA 1QAMA 1Y3HA 2J33A 1US8A 1VYVA 4YONB 3EEQA 3GJ0A 3TIGA 4DILA 3TNLA 3EQ8A 1P8JA 1OAAA 1IXSB 1RHUA 2Y4NA 1C3OB 1FSGA 1Z0ZA 3HI4A 4KPUA 4Q24A 1R5BA 1FJGB 2GRUA 3RUHA 3ZGLA 5KDOA 4RA9A 1KI3A 3GLIE 3BF7A 1GP2A 4V2IA 4Y6SA 1PGPA 1K4YA 2IPAB 3CA8A 3K4HA 2WUWE 5AH0A 3SSOA 3B7PA 2MYNA 1VDZA 3LDFA 4IYRA 5AK6A 3TPZA 5I48A 1SBYA 3EXFB 4HV4A 4UOZA 3P2KA 4B5KA 3LXRA 3OZXA 2ZYDA 5C7YA 4XQGA 1AMOA 4GI7A 4TMVA 2RI1A 4MGKR 1SVUA 2HJVA 2CE7A 2DBVO 4WNAA 4C3VA 1NM5C 3Q40A 4N5HX 1QGED 1KK0A 1RWWA 3GROA 4HGNA 3B52X 2J7KA 3ZHUA 4EG1A 4AP5A 5L7TA 1XJ5A 3CH4B 2IX9A 3V33A 3P9XA 3S2ZA 3H8VA 4HYEA 5A5DA 4UBJA 4DR5B 1TEXA 1ORVA 2Q4OA 2ZTMA 2HADA 3E2IA 4DM7A 5CXQA 1CERA 2CVQA 5DX1A 3AIMA 2F64A 3WI7A 5E7IA 1JIIA 3KYDA 3WK4A 4RTRA 1BGWA 1QP8A 2WD8A 4FCVA 2PH7A 3ZCSA 1B2RA 1ACMA 1LPMA 3GRPA 4WCFC 4ARZA 4DLPA 1S3FA 4G26A 3QX9A 3KZVA 5JPDA 5DH9A 4OA5A 1YB7A 3D1LA 1TJ3A 1V16A 2E49A 5ER6A 2CFTA 1GPWB 3GP3A 1HSOA 1BVYF 2X15A 1LW7A 2BEWA 4WQMA 1AJEA 5J2TB 2HGZA 1JSCA 1N6HA 2HU2A 3MT0A 1QC5B 4ER6A 1SOAA 3NDJA 4U7HA 5ABPA 3AF3A 5TF4A 1HKUA 1JAXA 1K3TA 4YXWA 4A92A 1L0BA 1TX4B 4OIFA 4EPRA 3OHSX 4RE6A 4UNQA 3RFFA 3EWNA 5H80A 3RSCA 4AUNA 2FU5C 3MCWA 1YULA 1LPSA 5AMXA 1Y1RA 3GH3A 5AI8A 5HGXA 1BJTA 3E05A 4ALKA 1GO2A 3ESBA 1K89A 1C4XA 3QNMA 4AD8A 5JC1A 2JLXA 2UXBB 2R1VA 1ZGHA 2IWRA 2VYVD 3U62A 1RQXA 1QYDA 1FA9A 1MQSA 5DBHX 4F06A 1J8MF 1K2WA 1RXIA 3D81A 5HDBB 4HS4A 4C4ZA 1G0OA 1JZSA 4RVUA 3PC3A 3H0CA 1RW4A 5KOJB 3DBRB 3K9WA 4PC3A 2COUA 2IKQA 4UU1A 2MIIA 4GZMA 5FTMA 1NTRA 4XA8A 5AVTA 1PQWA 4Z51A 1FZQA 3UC5A 3EGXB 3PFIA 4BFXA 2FX3A 3VISA 4KHZA 5JSFA 3Q98A 1LNSA 2OQRA 2RCNA 2IZOA 3L46A 2H1HA 1NKSA 1SUBA 1OC4A 2CW5A 2PD3A 3JQAB 3VNQA 1SCIA 4E4RA 3ASZA 1VL0A 2WNIA 1KK1A 3ETNA 5CUQA 1H2ZA 3RS4A 5BYKA 3BEOA 1BYIA 3KR0A 2C9OA 2XT6A 4H0NA 4NJEA 5AHXA 2JGNA 2WFAA 4AUEA 4IDHA 3QKWA 4I6JA 1LB1B 2Z3VA 2HA3A 3C3KA 3ABSB 5KUTA 5HR5A 4QWWA 4H2DA 5JSUA 3OJOA 4JGIA 5SV2A 1KMCA 3BB3A 5JCXA 4HDKB 2X3YA 4OXNA 2IEAA 3FKJA 3GJYA 1W8DA 1GYQA 1QCYA 4OQNA 2VCEA 3G9XA 2LDXA 1ZRHA 1EX1A 2MYUA 1VM6A 1JBKA 3KLPX 3JQ7A 1WY7A 3Q0IA 5LIRA 4GL2A 1IJFA 2M1XA 3HR4A 1CUJA 3PJEA 4LCBA 4OXIA 4W4TA 1C30A 2FSPA 2QLLA 1YWGO 1RSZA 3CX7A 4ILKA 2NZUG 2WIDA 4TLCA 3ZXIA 4Z4QA 4DKJA 4JI8B 3PQ2A 4FYJA 2BZGA 1C8BA 2Z5LA 3ROXA 2QTTA 4XWYA 2GILA 3TRFA 2I6UA 4D9IA 4LJ4A 1JMVA 1L7MA 4OAPA 2C1ZA 3F6PA 3NEAA 1Z5WA 2UXCB 1P1BA 1PJTA 4L4SA 1WCWA 4PFQA 3C74A 3WA6A 1CF9A 3BMOB 4AKEA 5A2GA 3T1HB 1EXDA 4MI1A 4PO1A 3URMA 4IDOA 3WWOA 2X9GA 3JAKA 3GP5A 4GHWA 4CL3A 2J07A 4V02A 3F3MA 3E4CA 3IP3A 3S28A 3WB2A 5K8CA 4OATA 2GCPA 5GADl 4ZOLB 4RGQA 4AZSA 4J0FA 5DM70 4QM7A 4JI2B 5KVSA 4BBPA 1N2ZA 1T24A 5E9JA 3IOEA 4OEHA 1ECFA 1H6AA 1L7EA 2Q3JA 3U3ZA 2FN4A 3PVCA 4RPKA 2OEPA 1NF2A 4UQPA 1YB6A 3C14C 4NBTA 4ZICA 1JQDA 2GPYA 1ZUNB 2PZAA 3BGDA 5G53C 5MFPA 1PL6A 3RRJA 1I3KA 4JJ8A 2P6RA 1MFZA 5DTQA 3GPCA 2GX6A 2QJOA 1NQ5A 3EIWA 5KX5A 5TJ9A 3D8BA 1IIBA 3K73O 5HILA 2ZPUA 4JL6A 3CXRA 3OQIA 5C5CA 1AO3A 1T4MA 2C3YA 4RF2A 2F9FA 1TCVA 3T3IA 4B6RA 3G9QA 3EF3A 4MYSA 1E2FA 3KQSA 3SMVA 7ADHA 2BEVB 2CLMB 1EXMA 4I4TB 3ZE6A 1NNUA 1M8FA 1XI2A 1Z2EA 2V6IA 3UJCA 3VKWA 1GSAA 1HYGA 3QOWA 1S9DA 1YRLA 4GXNA 4Q21A 3L4BA 3P9RA 1E9BA 3QJGA 4KQ1A 2JAHA 4GECA 4YCSA 3E9EA 3G6WA 2VJDA 1RS0A 1NOJA 2WVJA 2R6ZA 4OXKA 2DPXA 3QBTA 3RS0A 1NDQA 2RHCA 3AR7A 3F0TA 2ATEA 3L6DA 1NJGA 3I8SA 3HSKA 4UZFA 5DHQA 3I61A 2UVPA 3OKAA 4JGBA 1ORWA 3WS7A 2O0HA 1ZH4A 5ALLA 4J07A 4TTTS 1KMHB 5ALWA 1TYBE 4CM8A 1E92A 5TT0A 5B7QA 3EULA 4F5DA 4BFCA 1UIRA 4TKLA 1B8PA 4I46A 4IJUA 2BFFA 5IJ0B 4DMGA 2Z09A 2J4DA 4Q7LA 2ONZA 4U63A 1NLFA 3KSZO 3SJCA 4YR7A 3PWKA 1UZNA 3A6PC 3I62A 3TEJA 1CWUA 4D96A 4R98A 2MSDB 4TTPA 3R8FA 3LGXA 4RLHA 4UEKA 4Y9SA 1ZH2A 4EJ0A 1LGYA 1RPTA 3FMGA 2B82A 1ZD9A 1HLDA 3MPUA 4DRXA 1B26A 2W71A 3L1IA 2FQ1A 2FFRA 3JVDA 4R0NA 3F5QA 4MV8A 4ZEVA 1KEPA 2YICA 2W6ID 3BE4A 1GQRA 2V9CA 1IATA 3CX3A 4AZWA 1LVUA 3FH0A 2UUAB 1KEEA 3M5WA 2BISA 3G9ZA 1HFWA 1HT0A 1KI2A 2NZYA 3IMKA 3KVYA 2YX1A 5AVOA 1I01A 4AX4A 2RONA 2C9DA 2YIDA 3T3PB 4YV1A 2WABA 2OBLA 4IH4A 4O59O 4EPWA 5CD9A 4KQ2A 1MHTA 4REOA 3K09C 1TJ4A 2TMYA 1UK8A 1NKVA 1C1DA 2FJ0A 3QY9A 4GBED 5EESA 1AQYA 3M82A 3TH5A 1GKLA 1JDZA 4X24A 2O05A 4KRYA 2XUPA 5HKAA 2ZR0A 5KNDH 1HR0B 1QP4A 5E7JA 4W7SA 2H7CA 1O6ZA 4IR7A 1FTWA 3BFVA 3NIGB 3BK1A 1DQNA 1BD4A 4FFLA 4UTXA 2BY4A 4PHHA 4BCBA 4Q05A 2FMXA 2ZIZA 4DCGA 1G5QA 4L0MA 5LB2A 1T3HA 5AJYA 3ILSA 4GOOD 4Q34A 4FOLA 1USIA 3MW8A 1KP3A 5BQ5A 3EA0A 2QG9A 3ND9A 3LZ6A 3JQDA 3MUFA 4G1BA 1W36B 4B3SB 2GZRA 3VDNB 4NAVA 1WBJB 4L2IA 4MUMA 3OBIA 1F4VA 3WMGA 5IJZA 1RE0A 2ZKIA 4ZO7A 5F2KA 3V4VB 1W52X 2BE7A 1A76A 3NEJA 5CFNA 3RS8A 1GLVA 1WPXA 4MB6A 5LMUB 1G8PA 2G8NA 3RS5A 3DLAA 1ATIA 1BO6A 1J49A 4RS4A 3PXCX 3DWGA 3SSMA 3JX9A 1DJPA 4DDTA 1Z4OA 2W6QA 1LF5A 3NBXX 2OK7A 4G1CA 4J29A 4N12A 4O25A 3H11A 2FMHA 1V71A 1KF0A 2DXIA 2W4QA 3M3HA 4KO1S 2W83A 5F3RA 1ZW6A 4BX2A 4I4IA 2ZYHA 3QXSA 5C35A 3GT7A 2GF2A 2R8EA 3LPAA 4IQ4A 5BYBA 1Z68A 1GCOA 1ZJZA 2BFCA 3H5RA 3R6WA 1K68A 4REQB 2HF8A 4JJGA 2GN9A 3TM5A 4CV2A 4G9BA 4M0KA 1JP7A 1XTUA 5C9ZA 3HCWA 4H1WA 4GI5A 4Q3BA 4PXSA 3S55A 5JH7A 1G63A 3R7WA 5DGHA 5EPEA 1OPRA 1S2DA 5ALEA 5B1DA 2A9KA 2PLWA 4MCJA 3ASYA 3I2GA 3K9GA 4TROA 3T5TA 5I51A 3OCCA 1GSIA 1SU4A 1YBMA 3MNFA 3NDIA 3V1MA 4ZMBA 1PVOA 1UJCA 2QI9F 3QA9A 5A3JA 1WXGA 3EHDA 3FETA 4GKBA 4EITA 3RRNA 2ZZMA 4HEA6 3KUDA 1SKYB 2AG0A 3I2JA 3MMZA 4LJYA 1LLCA 5EZQA 4BQQA 5G02A 1M34A 5F7OA 4IDQA 3AVYA 1KWKA 1XWFA 1UPFA 4ZVTA 4JOSA 4EI8A 3EXEA 5F1OA 1GU0A 4EG3A 4AZ0A 3OLWA 4KFCA 1VXOA 3IQGX 4NG5A 4BB6A 3MQ4A 3SY8A 3BJMA 4S12A 2QLTA 4B8WA 5LLSA 3SEFA 1RP1A 3TKYA 1LDNA 3IPRA 2I2WA 3KXIA 5TMPA 4HC4A 1Z35A 1S2IA 2FKNA 4PNEA 2W00A 4CKEA 4OY3A 2YBEA 3WC4A 3JYNA 5CB4A 1Q83A 4YDQA 1V1MB 3EXHA 3ZKWA 1JSLA 2CYCA 2OBMA 2OOSA 1O97D 5HKKA 3HI6A 4CM9A 3H4MA 3PQ6A 2C4TA 2PX5A 3R7FA 2VNHA 4HQRA 1L7XA 3G8CA 1NJ8A 3F90A 1ORTA 3I2FA 3B53X 1NBMA 1LA2A 1WZNA 2VSQA 5BN3A 5DCUA 3BS4A 1B8UA 4PR0A 2ZRPA 5C5IA 3DHVA 1SVIA 4L22A 1TZKA 2IEBA 2D7DA 3SKXA 2HPHA 1BFKA 3LQKA 4AZ3A 1NN3A 2XB6A 3CM0A 1EHCA 4IDGA 5BRJA 3AJ9A 3MOGA 2VNSA 4LGMA 4R8SA 5FTNA 7AT1A 1TI7A 3U2QA 4BFTA 1KI6A 5IDVA 2NP7A 1B6SA 1W88A 1U65A 2C04A 3DE0X 2FQWA 3JRNA 4GO1A 2Y93A 3I9KA 4TL9A 3WGUA 1OWPA 4LV8B 4D25A 2VRNA 3K35A 3OD5A 7MHTA 2FW1A 1X1EA 2QA5A 2YUIA 2CMFA 2P6NA 5H4GA 1EJ2A 4RK6A 2DG2A 3MQ2A 3DHWC 4WT7A 2B8WA 2PHZA 1WSBA 4HQ0A 4UPDA 3F1LA 4IIUA 4IMRA 5AK4A 1SU7A 2C83A 5DSTA 4X3PA 1Q7RA 5T4HA 3NIBA 4QYIA 4YJFA 4IEEA 1V41E 1Y6FA 3AVVA 2FDXA 2PVCA 1YA6A 4F1WA 3OUUA 3AHEA 1DC4A 4ZDKA 1LLDA 3M81A 2YVLA 1F6WA 1CCWA 2VXYA 1CY8A 3CLTD 1X94A 3EIEA 4UBMA 3TRDA 4DA7A 3LHKA 2D5BA 3SHOA 3FVQA 3MWGA 3N8NA 1N3BA 2GN4A 4AKTA 3KCNA 4Q7EA 4X3CA 2VDVE 4KAFA 3JAWA 3IESA 4O2BF 4RVHA 1AHHA 4RPLA 1VMEA 4N48A 2ZR9A 3HBNA 2WG0A 3EC1A 3N8IA 4RZQA 1OBFO 3R7LA 2BONA 3RJ9A 4AJHA 4LNAA 1TF2A 1NF9A 4C78A 5BPHA 1ZN9A 4E2XA 3F9CA 3NH9A 1X1CA 2A0YA 4YEDA 3AUJB 3ESZA 3HXOA 2XEXA 5AK0A 2P2DA 1T3GA 2YVQA 3DONA 4IIJF 3C3XA 2A0KA 2XNJA 1JW9B 3HUFA 4KUGA 2A84A 4C0QC 5THQA 2O2GA 3FBGA 4RNCA 1U8AA 4ME6A 1SVLA 2J6IA 2WJGA 4DLKA 3MTGA 1CS0B 5U9CA 3U13A 1G59A 1LRLA 2IOFA 3OZTA 1G16A 4BQIA 4CXMA 1R0WA 5ADHA 1KEKA 4RV4A 1FVHA 4X1IA 3FPJA 1II9A 2O3SA 3AFHA 1I2BA 4B44A 1SCUA 1XZNA 2OHGA 2YZ2A 4PGMA 5AM1A 1IBKB 3GDFA 3LM8A 2PS1A 4RHYA 2ZTUA 1QBGA 2PX8A 4TMFA 3FX2A 3MC1A 3LG2A 4MB2A 3QVUA 3J81A 3QBEA 3QPUA 3AHCA 4DCPA 3DZKA 4M1EA 4UZSA 3U0VA 1THGA 3M1LA 5BVHA 5KJEA 4EGQA 4PGAA 2WM9B 3OE5A 4RU1A 2TMKA 3ZU5A 1Z4MA 3GAAA 2KS6A 3GUHA 4FS8A 4J2TA 4UVDA 5TQ2B 3LWBA 2IE8A 4HNQA 1U9JA 1W5FA 1UF9A 2QYSA 3MRSA 3NU1A 4J90A 4X5OA 1H3EA 2XMRA 3MS4A 4B71A 4F0JA 3ESRA 3ZYCA 1OA0A 1SPBS 4HSGA 1UOOA 5CLLA 2H0QA 4EOGA 5CG1A 2UAGA 4Z3OA 1NSFA 1SUFA 2NQ8A 4X6LA 1ZYUA 3CGGA 4UAJA 4A9AA 4B2IA 1YK0A 3OPVA 5FWYB 2VQFB 1FUIA 2CD9A 1Q91A 1WW3A 5BQFA 4RORA 2H92A 3PU6A 1TADA 4KZPA 2CB0A 1NW5A 4L57A 3EXHC 1ECCA 1BE1A 1QGDA 1S0UA 1NW8A 2IDKA 2JIRA 2WIKA 3NC4A 4J4HA 3ER9A 4TWBA 1SRQA 1HDEA 3ET4A 1R12A 2RHDA 4IILA 3GG2A 2NAFA 1QP0A 1QXSA 3RWMB 4E12A 1V7CA 1V0JA 3L43A 3MJEA 5FPPA 3UPDA 4A6DA 2DUUA 1E4VA 4E2WA 2JA1A 3W1EA 1CETA 1YZUA 5LZ9A 2RGNC 4QVIA 1KK3A 1PDOA 1T6YA 2AN4A 3GJ6A 4IIYA 4BTLA 3O2NA 1FMLA 4FT4A 4CIVA 1KR5A 1H9AA 1MOPA 3KZCA 1RVV1 2IYYA 3EISA 1TGYA 3T3EA 1Z0JA 3QUQA 1U02A 5B3JA 4I4NA 1XTQA 4Y2UA 3KIPA 4U2GA 1V96A 1EPUA 1P1KA 2WSBA 1NIJA 3H83A 1ZM7A 4KITB 2C8VA 4P4UA 3C6QA 1VYUA 2PSSA 2Z1DA 4MSUA 4XASA 5JHHB 1Q7CA 2HC9A 1FF9A 2QPAA 1RYYA 1V9SA 8MHTA 1OXSC 2FWIA 3WP1B 2O6LA 4LHWA 3IEIA 4FB5A 3NYIA 1XDWA 4N18A 3NVKI 3N7TA 3RBXA 5BN1A 3VKGA 4G85A 3QP9A 4KUHA 1XROA 1XVTA 3O6VA 1NVKA 4K6GA 1OYYA 1H3FA 2XVZA 3BFKA 3G68A 4K3UA 2XYHA 4KSCA 4MXDA 3F49S 1SQFA 3L2OB 2FWPA 3T61A 2YW2A 1USVA 2FVXA 3GLHE 4P84A 4PHFA 1XZQA 3BXGA 4EJSB 1JZQA 4YK7A 3R7WB 3SGLA 4F3YA 2R60A 3OLQA 1J9ZA 3QFSA 1SXJC 1E1YA 3UHFA 4C2UA 4HGPA 1R2QA 3B9QA 4A8JA 3CPJB 2YHAA 3IQEA 3NETA 5AVJA 3ZKAA 3OIUA 5JFGA 4LI0A 1C7ZA 3M5PA 4Q9KA 1R6DA 3Q3IA 4UEWA 3AHFA 2FOIA 4X62B 4MZXA 3C8DA 1G98A 2HMSA 4P2BA 3HRKA 4DPLA 2ORED 2CHFA 5GPBA 3ZE7A 3MMXA 4ZEMA 4JLUA 1I32A 1JR3E 3CH5A 1NUUA 4FMDF 4NYIR 4C1NA 1S2OA 4DVGA 2Y1EA 2PV7A 4R05A 1G2QA 4QYWA 4I3GA 4KXLA 1NLYA 1R6XA 2A7XA 1ZNZA 1MDFA 2VDRB 2DTXA 4UUBA 4I5DA 4YALA 3V1LA 1FSZA 3CE6A 3I52A 4BUCA 4NYJQ 5JVDF 1B0PA 5BSVA 3C1AA 1JU3A 4ZTUB 2WVAA 1RBMA 2H85A 4MV3A 4YLYA 2PU7A 5JS6A 4EQZA 3FCXA 1GPYA 1TCCA 2O8BA 3ETGA 4PEVA 2ODPA 5K3OA 3VV3A 4EFKA 3VGJA 4GPTA 1JH9A 1F1BA 1R10A 4YROA 2QKYA 1W5TA 3OMXA 2RHTA 2VAVA 4O0LA 4Y9TA 4DRYA 4F86A 4Z53A 3MUOA 3R40A 1U0EA 2Y0CA 1PNTA 2IYRA 3OFKA 3K05A 1H23A 2AXPA 2G0TA 5CH8A 4M1KA 3C43A 5ENDA 2G72A 2HW8A 3TNDA 1NV9A 1UBGA 2MSLA 1AUVA 2JGJA 2J59A 2VSXA 2ZCVA 3BTUA 3EZLA 4LDJA 4W5OA 1T26A 2ZULA 1AK9A 3SHFA 3CF0A 3HTXA 4KNWA 1VE1A 2OV1A 2EX4A 2JI8A 5AW5A 1XPUA 4G5HA 4L9RA 4A2PA 2NXCA 1KYIA 4JODA 3TRHA 3BMOA 5AI6A 4QAQA 3TL6A 2CZQA 7YASA 5AJWA 4H7FA 1KSFX 1EJ6A 2F1RA 4FFNA 4WNCA 1GZ4A 1T8YA 1USUA 1R0XA 1X77A 2P9HA 3QLVC 2V8OA 1EM8B 4IHKA 1TCBA 3GFBA 1YMVA 3H8WA 1UXGA 3Q6MA 4FFSA 5HFAA 3IT2A 4D81A 2AA3A 2WJYA 4L28A 4MQMA 4R9UC 4JXZA 2R84A 4RSGA 1T2EA 1FP7A 1YUBA 2QENA 2A3NA 3OU2A 4X3OA 4KNVA 5JDCC 5TPZD 3TX6A 1CUIA 1ZEMA 2GCIA 5TQ0B 4Z9YA 1X2EA 4F9GA 1OILA 5F9MA 2OBYA 2DFTA 3OKPA 4CLOB 2XNCA 1ZIXA 4WZAE 3O3OB 4EKDA 3WRYC 1IZ9A 3NHUA 4BVKA 1CF4A 1P2DA 4LX8A 2AN1A 4A3SA 5T57A 3BH6A 3ONWA 4XFDA 1V3TA 2BYTA 1ODSA 3A6KA 1EWYA 4FD2A 2AXNA 3HCCA 1KARA 1LQUA 1XMXA 2PZMA 2BMVA 4HDNB 4AM8A 5CB6A 1SD1A 2FWJA 3C7AA 3C3JA 4C3UA 2EWMA 3D4LA 3TUIC 2GTHA 4X6YA 1LVGA 1XB2A 3U4QA 4NJEB 3PUKA 5DWDA 4J3FA 5L95A 1E61A 1FXUA 1G9SA 2QVXX 3F96A 3IODA 1P73A 2X8AA 1JAHA 3GEHA 5CYPA