1IY8A

Crystal structure of levodione reductase
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
258
structure length
258
Chain Sequence
RFTDRVVLITGGGSGLGRATAVRLAAEGAKLSLVDVSSEGLEASKAAVLETAPDAEVLTTVADVSDEAQVEAYVTATTERFGRIDGFFNNAGIEGKQNPTESFTAAEFDKVVSINLRGVFLGLEKVLKIMREQGSGMVVNTASVGGIRGIGNQSGYAAAKHGVVGLTRNSAVEYGRYGIRINAIAPGAIWTPMVENSMKQLDPENPRKAAEEFIQVNPSKRYGEAPEIAAVVAFLLSDDASYVNATVVPIDGGQSAAY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LEVODIONE REDUCTASE
publication title The Crystal Structure and Stereospecificity of Levodione Reductase from Corynebacterium aquaticum M-13
pubmed doi rcsb
source organism Leifsonia aquatica
molecule tags Oxidoreductase
total genus 101
structure length 258
sequence length 258
chains with identical sequence B, C, D, E, F, G, H
ec nomenclature
pdb deposition date 2002-07-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1iy8A00
1X13A 1P9LA 4IMRA 4ZHSA 4M87A 2VWHA 1J6UA 1N92A 4CM7A 3GK3A 4ZRMA 5CHEA 4J9UE 3NV9A 1DFGA 2FSSA 4YRDA 2BH9A 1V35A 2O3QA 3R3SA 3WYBA 1B3BA 5AYVA 4B4UA 2AEFA 3JYLA 3AUUA 4L9RA 4MJLA 4JBHA 2OXIA 4IY1A 3E6AA 1BXKA 1GV0A 3JYPA 2Q46A 4BO7A 2NU9A 3PK0A 2I76A 3TPCA 3PVZA 1O0SA 2Z1MA 3DMTC 3ETDA 1JQBA 1ISGA 3LT2A 2DBVO 1NWHA 2ZJ1A 3GRPA 5AXCA 2OBNA 2X6TA 3HDHA 3VDRA 4NMHA 4WE3A 4YAKA 1HZZA 1OMOA 4NFSA 3K9QO 4NPCA 3UUWA 1CJCA 2E37A 2I5PO 4FFOA 4Q39A 1EE9A 1BGVA 3PGJA 1WZEA 4IS2A 1YL6A 3GQVA 4KTTE 5JE8A 3ZU4A 4FN4A 2O50A 5H81A 4F45A 5A9RA 3TN7A 2ZTVA 5IF3A 1DBVO 5JY1A 1WAMA 4A10A 1JWAB 1UAGA 4UUOA 5DCYA 5JMWA 3ZNNA 3DZFA 4QFCA 3AUAA 1B16A 4EEZA 3ITDA 3WQQA 1ZEJA 2VUSA 1C0PA 1I24A 4DA9A 3HNPA 3QVOA 2Q3EA 4NJMB 3PWSA 2ZK7A 1GEEA 3L4BC 3ZHYA 1E7RA 3ICPA 2Q45A 1QYVA 1ONOA 2PKQP 1ORRA 1U2DA 1LRKA 4BKOA 2PD6A 1BHSA 4CMCA 4B3JA 2V6BA 1NQOA 1P44A 4BO0A 4W7IA 1PJLA 3ZNQA 3AJRA 3K5PA 1YVEI 2VYND 4FJ1A 2AQKA 1U3VA 5JC1A 3GVCA 3RUDA 4XGIA 2VWPA 1PJ2A 2JD2A 2GNAA 2VHXA 5JY6A 3AFMA 3AFNA 2VNAA 3JQ8A 3VVBA 4AJHA 4G65A 3LDHA 3LLVA 3ICCA 3C8MA 3JQ7B 4WCFB 3DOCA 1R4MA 3JQAD 4CQLB 1H6AA 3M2TA 4EI2A 1U7TA 5FYDA 4CM4A 1FDSA 3DL2A 4CQMA 5JDCC 3G3EA 3JQ9A 3UCFA 3GG9A 1CQJA 1DC5A 1HETA 1V0JA 4JGBA 4M55A 2X0NA 1U3TA 2JCVA 3ZWNA 3UOGA 1HL3A 2YUTA 1DAOA 1EZ4A 1T2DA 1KS9A 5IG2A 1GYRA 1N8KA 1FDTA 4I9NA 4UEKA 4U6QA 1Q7BA 2EV9A 4ZQEA 1WMAA 2Y66A 4H7PA 3RFVA 2D0IA 4BIIA 1DAPA 2TMGA 3PJEA 3GPDG 4BB5A 4CR8A 3GH3A 4OKNA 4RGBA 1VC2A 2V6MA 5JS6A 3MJTA 4ZJUA 4YJFB 1ZKMA 3TF5A 5J23A 3DZKA 1UXHA 2B83A 4CM8A 1O94A 3GFGA 2AE2A 2FP4A 1E77A 5A02A 2EP7A 3AY7A 5CEFA 1XSEA 3ZZNA 1LDNA 2Z95A 3VZSA 4ALKA 1ADGA 1BW9B 5F1KA 3GAFA 4CMIB 4B79A 1HKUA 1H2HA 3G17A 1PZFA 4Q3NA 4DBZA 1H2BA 2J5QA 5KOIA 1GZ6A 3OHSX 2F00A 3JQ7A 4R3WA 3P5SA 4WCFA 1KVTA 3C1OA 1B8UA 4IDGA 1QORA 4RDIA 2IODA 2JHGA 4BMVA 2WSBA 1SOVA 4PFJA 5DCWA 1DDOA 4LW8A 3KVOA 4CM6A 4CMKA 2OP1A 2P4QA 3BMOB 4GSKA 4UUMA 1XQ1A 3JQCA 3RJ9A 2PGLA 1AE1A 4AJ1A 4RPJA 1VKNA 1JTVA 3ZWCA 1V6AA 1Y1PA 2XOXA 4BO6A 4XD2A 4GGPA 2ZCUA 4YAGA 1G6KA 1A72A 2JFHA 1D7OA 4JP3A 2O3TA 1XYGA 5L4SA 3RFXA 4CLRA 1NX6A 3MOIA 4WLEA 2IEBA 1EDOA 3KBOA 4S1VA 4LGVA 4TKMA 3ZWAA 4G5HA 3E9QA 2BF7A 4I9UA 1D1TA 3JQ9C 4KTVE 1Z74A 3E9NA 4Y6RA 3SEFA 4JP2A 1PJCA 3RUIA 2I3GA 2UDPA 3VZPA 4CM1A 2CVOA 3H2ZA 4PZEA 4TZTA 2CDCA 2P2SA 3RC9A 1M66A 3BMQB 4BNUA 4DBVO 1VSUA 1Y81A 2AXQA 4RVFA 2VNSA 1KIFA 1MX3A 2RBEA 3F5SA 3NJ4A 3UN1A 5A9SA 3RWBA 2IEDA 1ZJZA 2C7GA 3QRWA 4HNHA 3ZW9A 3ZU3A 2Q50A 4L75A 1LDMA 1A7KA 1NVGA 4D0RA 3RASA 4R4JA 2ZKLA 4XIJA 3UW3A 3AWDA 4BQPA 2ZB3A 2Y0CA 2PZKA 4JIGA 4AJIA 3JQFC 2E6UX 5TQVA 1PQWA 3WBBA 4YR9A 3BTOA 1BWSA 1U8FO 1HDRA 1ZMTA 4G2NA 5EPOA 2VRCD 1U5AA 5L53A 4JROA 3I9LA 2WWRA 3HN2A 3GDGA 3HFSA 4FFNA 4RZIA 5KJ6A 1SO8A 1JWBB 5A05A 3KXDA 2PNFA 3ASUA 3ZU5A 2VTEA 2C59A 3WFJA 5EQDA 4CM5A 4DMMA 1HLDA 4AVYA 4YJGA 5JC8A 3G79A 3NGLA 4YT4A 3WJ7A 1Q0QA 4HP8A 1NP3A 4AG3A 1XCBA 4JXKA 5TGDA 1ZW1A 3H8VA 3X2FA 3G1UA 3PDJA 2LDBA 1DJQA 3DBHA 3INRA 5DZSA 1N5DA 5A9TA 1ADCA 1JLLA 3BTSA 5IFLA 2HMSA 2DBZA 5HBRA 4QXMA 2DBRA 2AG8A 4BUCA 4OXYA 1AGNA 3D3EA 4RZHA 1BVRA 1B8VA 4AJNA 4DLLA 3GG2A 3B1JA 4BNLA 1ARZA 2HUNA 3I3OA 2PZMA 3ANNA 3GMDA 4YJDA 5HS6A 1AHHA 4IDEA 3TFQA 3OM9A 1ZSNA 4FFRA 1SBYA 2B0JA 5G0UA 4KUGA 2FR0A 5DBGA 3V8BA 2PK3A 1SMKA 3ONFA 3RUHA 1OAAA 2DT5A 5JSFA 3F3SA 4R69A 1E7WA 1NAIA 3RIHA 4CUKA 1Z7BA 3ASVA 1BG6A 3IJRA 5CAEA 3WIDA 4E12A 3CZRA 4UVGA 1HDZA 3CKYA 3QV1A 2NU6A 4GL4A 4MVJI 4CM4B 4FFPA 1I3LA 4RJTA 5JCXA 1FJHA 2NTJA 3AI2A 4QUKA 1HZJA 3GNSA 4FC7A 2HJRA 3EVNA 1KY4A 1I30A 4GPD1 4YB8A 3E5MA 3NDRA 3DBHB 1DC3A 1A7AA 4Z3KA 4IINA 1C3VA 5GZ1A 3B1FA 3LK7A 2C82A 1J0XO 4TRNA 1C1XB 2QG4A 3ADPA 4FR5A 4H16A 3TDKA 3O8QB 3R0IA 2HSDA 2R6JA 3OJLA 1I3KA 1XR3A 3RROA 1QR6A 4M8SA 5C37A 3P7MA 5A1TA 1XU9A 2BKAA 1Q0HA 2W98A 3FPCA 2WD7A 1ADFA 1J49A 4LRTB 2ET6A 4UAGA 2NSDA 1U2GA 5TJ9A 1NHWA 1X14A 4D79A 4DLBA 3W1VA 2WDZA 3SVTA 2VN8A 2PFGA 1HE3A 2OOSA 2I99A 4XEHA 2GASA 2OUIA 1K5HA 2FN7A 1UXKA 1EUZA 1TT5B 1N9GB 3GZNB 3I9NA 2JCYA 3WOHA 4FJ2A 2HK9A 2ZB4A 2EHDA 1TLTA 4XWYA 4XZ3A 1NASA 4F3YA 1SCUA 1ZEMA 2PV7A 2BI7A 4D46A 1RM4A 2UV8A 1LLUA 2B36A 2EERA 3QJ5A 3ABIA 4ROSA 4EJ6A 5BQFA 3K73O 4YQZA 3VC7A 2G5CA 3DWFA 1EDZA 2VHWA 3QLJA 4CMHA 1TI7A 1V3UA 4E30A 1YOVB 1GD1O 3FRJA 3I6IA 4FPXA 1GQ2A 3QE3A 3WTCA 3GHHA 1I0ZA 1TB4A 1T1SA 2YQ4A 5ENDA 1YL5A 2X7HA 1E7MA 2Y0DA 5ICSA 3DXFA 5JFOA 4B8ZA 3NDJA 1MC5A 5F21A 1G0OA 3AM3A 4E2ZA 5KCZA 3ROPA 2B4TO 4IS3A 3RC7A 1LRLA 2OGUA 5CDUA 1NVMB 5GZ3A 1KVSA 1V3VA 1L1FA 5DN9A 4TROA 4B7XA 4OO3A 1TEHA 3JD3A 4O0LA 3Q3CA 2AEMA 4NK5A 3ZWMA 5DOZA 1P3DA 1A27A 3LQFA 1U8XX 3AY3A 4F46A 1QLHA 3KYBA 3QQPA 3TSCA 1PJQA 2Y1GA 4EJMA 2B35A 4PLCA 2IZ0A 3HSKA 3OQ6A 5A4DA 3PHLA 4R01A 4IPTA 5G0VA 1IYZA 4OXNA 1B14A 4DPKA 1LDGA 5DT9A 7MDHA 1ZNQO 4PVCA 3GHYA 3PLRA 1X1EA 2EKPA 3OA2A 4PLHA 3RVDA 3WMXA 3C7CB 2X5OA 1DLJA 3RC1A 2BFAA 5IN4A 4JNKA 3MJ4A 3AUSA 3BAZA 2NUAA 1BW9A 1DHRA 5U9CA 3TOXA 5K0ZA 1P1IA 1KVRA 4WECA 3TZCA 3WYEA 1LI4A 2GO1A 4GX2A 2P91A 3JQAA 1PL7A 3DZJA 1J5PA 1DO8A 3HQ4O 3TL2A 5T57A 1KC3A 1Y8RA 2IXAA 2X86A 4DMLA 4ZN6A 3CMCO 5CDYA 1GUYA 2FZEA 2WMDA 3DOOA 5JCJD 1PGJA 4BKRA 3DHYA 3BTUA 1IE3A 4PLGA 4YA6A 3DQPA 4U7WA 3GGPA 3HDQA 2DC1A 4BMNA 1D8AA 4OAQA 1DIHA 4E5NA 1YQGA 1NM5A 4Z9XA 6ADHA 3IOYA 2WD7B 4O63O 1YB5A 1I01A 3NTQA 3GZ4A 3PQEA 2HU2A 4D3SA 4XDZA 3COSA 3OSUA 4UUNA 1UP6A 3C7DB 3U4DA 4IZIA 3GN2A 2YV1A 3EK2A 3GR6A 4INAA 5B37A 4R68A 3D0OA 3A14A 4DREA 1EK5A 4GBJA 8ADHA 4YVFA 4XYMA 3BA1A 5DBFA 4PZCA 2DKNA 4BNWA 5C3MA 4JLWA 5JO0A 1Q7CA 3DMYA 4E0BA 4GWGA 5L7WA 2Q4EA 5A5EA 1A71A 1XQ6A 2X0JA 4S3MA 3Q1LA 1OC2A 1M76A 4P4GA 3TWOA 1IUKA 3CIFA 4H3VA 5A03A 3OIDA 2DM6A 2FSVA 4LSMA 3HB4X 1DIGA 1IB6A 4R9SA 4DYVA 1Q0LA 2BLLA 2CD9A 2J5RA 2VUUA 3OJFA 5ER6A 3W8DA 4NIMA 4NFHA 2E4AA 1PJ4A 1JVSA 4MVJA 3EVTA 4R1TA 5F1PA 3KLPX 5L4NA 4RVSA 2JAHA 3KV3O 1P1RA 4QTZA 2WE8A 2AQIA 3PTZA 4L76A 4I5GA 3DAPA 3BIOA 3KRTA 4PG8A 4YRAA 4K26A 3FNEA 4XGNA 4LN1A 3DONA 4ND1A 2RHRA 3NUGA 4D45A 3O9ZA 4Z6KA 3ZI0A 1U28A 2QZ9A 3E5RA 3VPXA 4DGSA 2EP5A 1WMBA 4BNGA 2NTVA 4KZPA 4J4BA 2QIOA 4BVAA 3I6QA 3IJPA 1EE2A 4GVLA 5T5QA 3DEYX 1YQXA 2D4AA 4OH1A 3PEFA 1LXCA 3PZRA 3QVSA 3U5TA 5IDQA 1V8BA 4FS3A 3W6UA 3MEQA 2J8ZA 1MGOA 3WFIA 2B37A 3NTOA 1X0XA 4B4OA 4D3FA 3AUTA 5L45A 2WTBA 4EJ0A 2VWQA 1ZZEA 2C7VA 3ON5A 3RQSA 4AFNA 4Q3CA 1Z73A 4FSHA 5DDIP 4CV2A 4L4SA 3ZV3A 3Q6IA 4W6ZA 2VZ8A 1R16A 3G49A 4YJHB 1VM6A 3U4CA 2GN4A 2IYPA 3M2PA 1LC0A 2CZCA 1UP7A 3HUDA 4GAEA 4DIBA 3UF0A 3F1LA 4R5HA 1GDHA 1YXMA 1PGOA 4E31A 1VJ1A 1EVJA 1GPJA 1WLYA 3JQBC 4JK3A 2AEJA 3F4BA 1RYDA 4EUHA 3PDUA 3GVPA 3ZCXA 1NPTO 4BMSA 1B3RA 1HWYA 4J1QA 1P77A 3H5AA 1JW9B 2PWZA 1G0NA 2O48X 1WDLA 4W7HA 4MP8A 4HV4A 2EKLA 4Z0TA 5CDGA 1PIWA 4J43A 3HG7A 4GSLA 3QWAA 4QEDA 1R0KA 4WLFA 3I52A 4E4YA 4FBGA 1XELA 2G17A 3WGGA 2VTDA 5DP2A 3F5QA 4JQCA 4ONEA 5A06A 1W8DA 1M6WA 4P4NA 5CG2A 3QIVA 2WYWA 3DHNA 1R66A 5TC4A 4RPHA 3Q0EA 1VL0A 1B15A 3RJ5A 2CUKA 4A27A 2GYYA 4BNTA 4WCFC 3H6KA 1I2ZA 4R1NA 4H15A 1EVYA 3U09A 3A9WA 4MO2A 2PLAA 1Y9AA 2YFHA 1EBUA 1T2FA 1XHLA 1NR1A 1PGPA 1LTHR 3GFBA 1WVGA 5B4UA 1H5QA 1SPXA 1E7QA 3BMOA 1C14A 2OMEA 1K6IA 1Z6ZA 3OJ0A 2JFGA 3K6JA 3JD2A 2Y1EA 4MIEA 1N2SA 2O4CA 2PH5A 4BOYA 1OC4A 4WPGA 3PFFA 2HMTA 2YHIA 3B1KA 3AOEA 2ZTUA 2VCYA 4NZ9A 3K2EA 2QRJA 3P19A 3CSDA 2YDXA 5IXYA 5B12A 1KOLA 3WGTA 1ENPA 4DUPA 1S6YA 1GFSA 1LLQA 4ZQFA 1X1TA 2OBYA 4JBIA 4UUPA 1SC6A 4X54A 2UVDA 4ND2A 1H6BA 1ISFA 2P9CA 3BMNA 3WGHA 1IPEA 4CV1A 4CM8B 3LT1A 4B3HA 1LRJA 2Q2WA 2GSDA 3U4IA 4J1NA 1ZK0A 3DZBA 1UR5A 4DXHA 4YEDA 3CXRA 4EGFA 1GCUA 1PSDA 3AY6A 2J5KA 3EUWA 4JJGA 3V1UA 4R41A 1E3SA 1E1MA 1EVIA 1GUZA 5A3VA 2Y67A 4OOEA 2AG5A 5L9AA 1XKQA 5F5LA 3V2HA 4C4OA 3LZ6A 2W8ZA 4PG5A 3I9KA 4ITUA 3PWZA 1EVZA 3JQFA 1P74A 1U1IA 3OQ1A 5KIAA 3HWRA 4TRMA 3INGA 2HRZA 3DO5A 3H3JA 5KJ1A 1KYQA 4LISA 3WBFA 4PCVA 2IYOA 3LF1A 4DQVA 3RKUA 1AUPA 4Z0PA 3K8ZA 3K30A 1JKJA 3DTYA 3S55A 3HN7A 3LC7O 1CETA 1LC3A 2DPGA 3DC2A 3FF4A 1T26A 2WJPA 1GR0A 3H9QA 1WDKA 5DNAA 3FD8A 2NNLD 1MFZA 3NYWA 5EQFA 5G4LA 4KUEA 1XG5A 1PJBA 3M1AA 1GEGA 4UULA 2GPTA 4YWJA 1J4AA 1LSJA 3W4KA 1A4IA 1T2AA 2WM3A 2J3KA 5ES3A 1QYCA 5GY7A 3ZNOA 1LJ8A 4DWVA 5GZ6A 3EHEA 2GD1O 1WNTA 4PLTA 3TZQA 2PD4A 2HLPA 3H9GA 3KOUA 5A04A 4I1IA 2GRAA 2HMUA 1MXFA 1Y5MA 4B4VA 1F12A 4Y9DA 3FCOA 4QX6A 2R00A 2DBQA 4OL9A 3ORFA 3ZHZA 3ZWBA 1BMDA 5ADHA 4LRSB 1PL8A 1OOEA 3VKUA 1MLDA 1ZK1A 2Y05A 2OO5A 2YJZA 2ZTLA 4BNXA 5I8WA 2NACA 5A9SB 1RM5A 1U4OA 4IMPA 1NQTA 1QMGA 3SC6A 4CLHA 1O8CA 2JHFA 1R37A 3GT0A 3IQDB 1D1SA 1BDBA 2EGGA 4KDFA 4D41A 2V6FA 3CMMA 4NBVA 4G81A 3IMFA 3E82A 1CERA 1UDCA 5COBA 1B0AA 1PZGA 3B70A 1T4DA 2VWGA 4J2HA 4DC0A 4WLUA 2HK8A 3SXPA 5JDCA 2Z5LA 1NFFA 3ZDFA 4M86A 4IQ8A 1Y8QB 3F46A 3Q9NA 5G0TA 4AICA 2ZIZA 5BT9A 3E18A 4J49A 2V6GA 1AN9A 2BD0A 3OJOA 1YQDA 4KDEA 2X5KO 2VYVD 2X5JO 4K6CA 1EFLA 2G76A 3FN4A 1UDAA 4B3IA 3D64A 4LK3A 2C0CA 1RM3A 3UVEA 2SCUA 3GPIA 3QSGA 2X58A 3VOSA 1LLDA 3VPHA 1CDOA 2NVUA 2YZ7A 4RQUA 3UFXA 3NDIA 5TIIA 2AA3A 3TZKA 1UZLA 2GN6A 5CP8A 2X0RA 4JCOA 1RKXA 3BHJA 4OQZA 2CDAA 3WNVA 3JD1A 3U4HA 1YGYA 5L4LA 3IKTA 3PIIA 4NDNE 3T7EA 3F9IA 2NWQA 4KWHA 4MKXA 2GCGA 1H94A 4IGEA 1KEPA 2RCYA 4PG6A 4UEJA 3PLNA 1ULSA 5THKA 3NJ8A 3WSVA 1ISJA 4DPMA 5DBIA 3UH1A 3AM5A 3ROKA 2X22A 1E6EA 2E82A 1MA0A 3FBGA 3MJVA 4AJKA 4XQGA 3QWIA 5C7IO 1HT0A 3R3JA 4FB5A 4I8XA 2JD1A 2GLXA 4LMRA 1EBFA 4CODB 3WGZA 1VL8A 1E3LA 2HMWA 4RPKA 5BNIA 5CG1A 2VHYA 2GZ3A 1HF3A 1P1JA 3DMTA 3VH2A 1QG6A 1PZHA 3KSZO 1KY5A 1VE9A 3O38A 4YT5A 3RUCA 5THQA 3FTPA 3DBRB 1HEUA 4WK6A 2P9GA 2YV3A 4IUYA 1W73A 3KEQA 4D44A 5KKAA 3LC1O 2P9EA 3UCXA 2YY7A 3EZYA 4HWKA 4AJ4A 3Q9UA 4EEXA 4YAIA 3BHMA 2EW2A 1F8FA 5HS4A 2QYTA 4YQYA 2Y1FA 3SC4A 5TT1A 1YBMA 3GVIA 5KWEA 4GKVA 4ALJA 4D0SA 4XQCA 2DUUA 3DFUA 1WDMA 3S8MA 4BGIA 1WW8A 4ND4A 2C5AA 3NT5A 3PRJA 3WG9A 3LC2O 1LDYA 1HTBA 2Q1SA 3K92A 4LVUA 4TMFA 1E1NA 1L7DA 1VLLA 4NFYA 4WKGA 2NTNA 2JKVA 3L77A 4CPDA 1XU7A 3MJCA 4J7XA 4QSMA 2DPHA 2BFOA 2Y93A 4J90A 3ZWPA 3JYNA 1GL3A 3FTNA 4XR9A 5T64A 1YJQA 3IP3A 1UXGA 3I1JA 1NFQA 5C7LO 4CMGA 4PLWA 1EQUA 3ROQA 1PEDA 1DRVA 1RPNA 3ZWVA 1KBZA 4W9NA 3D3WA 3H9UA 2BHLA 2I9PA 1W0CA 5CPBA 2EXXA 2YHIB 1U3UA 1QRRA 4QO8A 2VYVA 3VZRA 2LDXA 1IULA 2H1SA 3TRIA 4GWKA 3OECA 2C2YA 1ID1A 2DTEA 5DOVA 1UXJA 4BO9A 5EN4A 3L07A 5L40A 4HFRA 3P2YA 4CQLA 4XIYA 1A5ZA 4WLNA 3V1YA 3FSRA 1I33A 1K89A 4U5QA 3HB5X 1FDWA 4B7CA 1DXYA 4RVUA 4HFJA 4WCDA 4N5LA 2VT2A 3DZIA 4XJTA 1F06A 1TT7A 2XAAA 2A94A 3E1KA 4IQ0A 4MIOA 1Y9EA 4PLYA 4RDHA 3RBVA 5K6AC 4MVJM 2Q49A 3RBZA 3MZ0A 2E49A 4YT8A 3JQGB 1DJNA 1DHTA 1TVEA 3I4FA 1ENOA 3UCEA 4E32A 1ZO8A 4L8VA 4BNVA 3I5MA 3ZWWA 2BI8A 1FDUA 1S7CA 1YDEA 1P1KA 3ZN2A 4AL4A 2GGSA 2IZ1A 1GZ3A 2DTDA 4MOWA 4EYEA 5CDSA 1MUUA 3PGXA 1K6JA 1NAHA 3GOHA 3L9XA 4MPDA 3CTMA 4BO1A 3OICA 3TQHA 3OEWA 2RHCA 1GY8A 3WLFA 2C29D 1M6HA 1DOHA 4A2CA 3ZGYA 5EL0A 1I3NA 1LUAA 3WJAA 1JKFA 1PU2A 1YS4A 2F1KA 1H9AA 2BGKA 3H9JA 4QO7A 1OBFO 4BV9A 1UP4A 5BNFA 3ZU2A 1E1LA 3JQGA 4L74A 2DFDA 3D4NA 4R5MA 4RF5A 3GDFA 3L4BA 3FWZA 4YXFA 1PQPA 1DIAA 1HYGA 3WGYA 5CDTA 3T7CA 4YJHA 3ANMA 1ML3A 1HDCA 2CMDA 1UDBA 1LBEA 1H9BA 1NNUA 2NV6A 3L9WA 1P31A 2ZYGA 4K1LA 4Q9NA 4ZVVA 1HE5A 5F5NA 3S2FA 3MWEB 4OKIA 2QQ5A 4QT0A 5JXWA 2VT3A 1OZAA 1K6XA 2W2LD 1FMCA 3GEDA 4XQEA 3OJEA 2IDZA 1NQ5A 5LCXA 2B4RO 3EY4A 3FHLA 1C0LA 1YE3A 4TKLA 5I7EA 2EKQA 2C20A 2AMFA 2UUOA 1YDWA 2HQ1A 2O3RA 4TRJA 5KNLA 1TXGA 2PD3A 3RKRA 4EZBA 5G2OA 1EUDA 2C07A 3S2GA 1XLTA 3LLSA 3JSAA 1X0VA 3SLGA 3ENKA 4WASA 3DB2A 3GVXA 3PYXA 3TZ6A 3SX2A 1IZ0A 1YBAA 1F0YA 4ZD6A 4A5OA 3VTFA 4GX1A 4OXKA 4ND5A 3FWNA 1ZMOA 2AE1A 5I9MA 5C7OO 4J7UA 4CLXA 2A35A 3D3WB 1W6UA 4NBWA 4U6SA 4NI5A 1ZK3A 5DP1A 2XPCA 2IZZA 1BDMA 4RVGA 5IAAA 2D5CA 4BKQA 3B20A 3KM0A 1YB4A 4NBRA 3JYQA 4YJFA 5ITWA 1T24A 1BXGA 2RAFA 4CMAA 2O7SA 1Y8RB 3STHA 4BV8A 3OIFA 3PQFA 5TNXA 4NU5A 1PR3A 4MVJE 2NM0A 3MJSA 3PPIA 4GVXA 5JYDA 1E7YA 1NXQA 4OJNA 4ALNA 3C1AA 3RUFA 3S2IA 1LDEA 2HO5A 4R54A 3JD4A 4ZICA 3NT2A 1QYWA 4R1UA 1UZNA 3L0DA 3AI1A 4Q3DA 4CLDA 3GGGA 5KVVA 4XA8A 4NU6A 1H6CA 1I10A 3FNHA 3CINA 3DR3A 7ADHA 1IL0A 2GDZA 1PX0A 5FI5A 5EJ2A 3K2BA 2R2GA 4BO3A 3VPSA 4A7PA 4WNCA 3JD0A 3D4OA 3OBBA 4PZDA 3V2UA 2Q2QA 4Z0HO 2PGDA 4B8WA 1N7GA 1IY8A 4GX5A 3DZGA 1SB9A 3JCZA 2P5YA 3AU9A 4BNNA 2HKIA 2EF1A 2NQ8A 3G0OA 1M2WA 2V7PA 4L73A 4DIOA 1LQUA 4K28A 5DULA 1E5LA 2EIHA 2EW8A 3LF2A 1E0DA 4RL6A 4CLOB 5IDWA 3ADOA 4E13A 1IOLA 4FJ0A 4CMJA 3S2EA 1ADBA 3DAFA 3H3FA 1QLJA 3T4XA 2I67A 4TZKA 2PZJA 4ID9A 3W8FA 1GYPA 1GCOA 1V9LA 3BMQA 3C1TA 4TQGA 3W8EA 1YOVA 1HRDA 3E48A 3GRKA 4RVDA 3F47A 3HHPA 1X7HA 4P22A 1JKIA 2GZ1A 2QZZA 3Q2IA 2Y68A 1T25A 3G1TA 3EYWA 4BNMA 2Y99A 4DTIA 1SEVA 4DQXA 3UGKA 5B4TA 2EGHA 3OA0A 1XEAA 4Q3BA 2O3SA 4GLOA 4U8GA 1A4UA 1Y7TA 4ZU3A 2G1UA 2O3UA 1N1GA 4PLPA 4I5FA 3KETA 4HFMA 5EINA 4Y67A 4ZA2A 1UXIA 3NRCA 4W9NC 5JO9A 3V5NA 1YB1A 4L4XA 2CNBA 4GI2A 4J7CA 5G0SA 1E3JA 9LDBA 5A3JA 1AXEA 2P5UA 1LA2A 2WYVA 4RLHA 5JW6A 4J6FA 4PLVA 5EIOA 4DRYA 4D42A 3GMSA 2D8AA 3KSUA 1VJ0A 2WEKA 1ZJYA 3L6DA 4OM8A 5AXAA 4EDFA 5IJZA 1LQTA 2X9VA 2HCTA 5TX7A 2Q2VA 4CV0A 4MVJH 3WWZA 3ZWYA 3UXYA 3ZWOA 1ZCJA 2FPIA 3IUSA 4IDDA 4PN3A 1ISHA 4J1TA 2W4QA 1PS9A 4RO0A 4EW6A 1ZXBA 4GGOA 2Q1TA 3D1LA 5JDIC 2B5VA 1Z75A 3I9JA 3VDQA 5KVCA 1XIVA 5EERA 2X9NA 4OSOA 2H9IA 4IJKA 1BSVA 5JLAA 5L3ZA 4CM9D 1ULUA 3QY9A 1C0IA 5JAIA 2RIRA 2I65A 3IUPA 4YBZA 4BKUA 1E6UA 3OF2A 2O4UX 4IJUA 2BMAA 2DUWA 1T1RA 3D7LA 3GNQA 1I36A 1I5RA 2PKQO 3F4LA 1KEWA 2QW8A 4BHTA 3E9MA 3U9LA 3I9MA 4NJOA 4CLEA 4RCVA 4J0EA 3VVCA 2X4GA 3W6ZA 4CMEC 4E5KA 4Z9YA 4ZQHA 1DIRA 1HE4A 2ZB8A 2ZYDA 5FI3A 1QYDA 3F6YA 1A9YA 1L7EA 1CYDA 3WMWA 5JMPA 3BXXA 1JU9A 3DZHA 4J0FA 2BFPA 3IDSA 5AXBA 4RV9A 3OIGA 1SB8A 1RM0A 2I66A 2WE7A 4BNIA 4RLSA 4I9HA 3GVHA 1NHGA 2A92A 4ILKA 5COAA 4FCCA 3SJ7A 5HWSA 4CQMB 3DBLB 3IIEA 3QHAA 3WB9A 2EEZA 2PR2A 1GZ4A 5MGBA 4R16A 3UICA 5JYEA 3F1KA 4ESOA 3DTTA 2PGJA 3H5NA 4A26A 2WD8A 3FNGA 4JN6B 4NHEA 2FMUA 1PR9A 1R4NA 3I83A 4FGSA 3ZWXA 5EMHA 5H83A 4EBFA 2RH8A 1ZIDA 1HSZA 4BNZA 3A1NA 1QXSA 1U3WA 4DPLA 5I8ZA 3H4VA 4WOJA 1ZBQA 4C7KA 3OH8A 4Q3AA 5TS3A 4WJZA 1I3MA 3K96A 3OETA 1F8GA 4IDAA 2O2YA 3HE3A 3ONDA 3DOJA 1PQUA 4IGFA 3RU7A 3GC6A 2JFFA 3L6OO 5L51A 5TLSA 2ZB7A 3MOGA 4N18A 1ZUD1 1PJTA 1EEHA 1QKIA 4IIUA 1NTOA 3U49A 2UAGA 4ZRNA 3BMCB 4YACA 3R6DA 1T4BA 1JAYA 2RH4A 5KJEA 5JDIA 3ZHBA 3BMNB 4J9VA 3P2OA 3WQRA 2ZTMA 3AM4A 1YONA 4HKTA 4LCJA 2JJYA 5TJHA 3JQAB 2UYYA 4FOSA 3GLQA 2Q4BA 1VL6A 2OZPA 4A03A 4B4WA 5JAZA 1IZ9A 1P0FA 4W82A 5JCJA 3HZZA 1PWZA 3HDYA 2X23A 3K31A 4U0JA 1FXSA 2UUPA 2EJWA 1GPDG 5H82A 3FBTA 4AJJA 3KHUA 3BHIA 2PA3A 1HDXA 3PXXA 1LX6A 4J91A 4NR0A 1ZH8A 3PHJA 4OSPA 3EGOA 3AK4A 3DAGA 1EK6A 4BO8A 2HJSA 5KJCA 3PZBA 4CUZA 4XRGA 1DC4A 1G1AA 3WYCA 1YJ8A 3H65A 5IXSA 5T6BA 3PHGA 3WWYA 4WOKA 4CV3A 4KQWA 4NK4A 1LDBA 4BKPA 1FK8A 1U9JA 3MJEA 3RAJA 4Y6SA 4PIVA 3OP4A 3RUAA 5KVQA 5HM8A 4XX0A 1RWBA 4IQGA 3OFSA 4CJXA 4FFLA 5IZCC 1WXDA 1JA9A 1YRLA 2FPPA 4W4TA 1NPDA 4GMFA 4YTEA 3PWKA 1HDYA 1VSVA 2VZ9A 4NBUA 1MXHA 5C5IA 3GY0A 3A06A 4YRBA 3W4IA 1WP4A 1GQQA 3U0BA 2CY0A 3KEOA 3ANLA 3N74A 4FQ8A 1LEHA 4CM9A 2VOEA 1UJMA 3DFZA 3WLEA 1ENZA 4XYBA 1VKOA 1E92A 5BSEA 5IZCA 3RUEA 3WGIA 3PI7A 2DVMA 2X0IA 3VZQA 3ZNPA 1V3TA 1LLCA 1E7SA 2CDBA 4EUFA 3I4CA 4OIMA 2Q1UA 4PRLA 4BNJA 4PLZA 4UVDA 2ZYAA 1JN0A 2DTXA 2PTGA 2W2KB 2J3JA 4EUEA 5I7VA 3JQDA 1K3TA 4LMPA 1N9GA 3PYMA 5T67A 3OMLA 4XYEA 3V1TC 1CEQA 5DCUA 4NG5A 1DPGA 1NVTA 4DL9A 4YAEA 3RU9A 1VI2A 1O9BA 3PFWO 1KERA 1WZIA 3GZNA 4F6LA 4R3NA 1DIBA 4HY3A 1I2CA 4MVJP 4XKJA 5G0WA 5AOVA 1B8PA 1H0KA 3KYDA 3WX0A 4NQZA 1MFPA 1NQAO 2JD0A 1DFIA 1F17A 4CL8A 3GAZA 5A5FA 1ENYA 1ZVMA 4ZQBA 4IIVA 4P4LA 2FR8A 4KP7A 3IP1A 4OMUA 1MG5A 1XWFA 4WLVA 4IXWA 1HSOA 3MWDB 3PHHA 1PGNA 2O7QA 3KB6A 3SJUA 4AJOA 2VHZA 4UEOA 1Z45A 4TVOA 2DFVA 2WYUA 4FDAA 1T2EA 1Q1NA 5JBIA 1YL7A 3O8QA 1MC4A 1ZK4A 1Q7GA 3PJGA 3JYOA 4DLAA 2CVQA 1C1XA 4AJLA 1LSOA 4KMSA 4RVHA 1YO6A 3GF4A 4MVJF 2P68A 3WS7A 2IXBA 3RSHA 4XR4A 2VZ0A 2Y1DA 2W90A 3E03A 4N54A 4E5PA 4YPOA 1WPQA 1BXGB 2C54A 1C1DA 3L4SO 1KVUA 3PQDA 5KKCA 1M67A 3CZMA 5AVOA 3IL2A 2ZQZA 3GA0A 5FFFA 5CEJA 3RBXA 3WXBA 1KETA 1UH5A 1EMDA 4I5EA 4C7JA 5ITVA 3DDNA 2EG9A 1NBOA 4D3DA 3H5RA 2JL1A 3OEYA 4UVHA 2A9FA 2BRUA 1RJWA 4TSKA 4E21A 5CFZA 3C3XA 1O95A 1MB4A 5L7YA 4OGWA 5JNLA 5GMOA 2GUGA 3TNLA 1C1DB 3PJFA 4YDRA 9LDTA 3IS3A 2ZCVA 3GDOA 3KYDB 2AQ8A 1D3AA 4BO4A 4CR6A 4J16A 2IRWA 4J3FA 3QP9A 1R0SA 3ETGA 1GQYA 2CF6A 1H6DA 2NQTA 1I2BA 1YBVA 1WWKA 4BO5A 4E5MA 1X7DA 4UVIA 4XB1A 2W2KA 4XQ9A 5AXDA 3GN1A 1B7GO 4DIFA 1DC6A 1Z7EA 4BNYA 1FF9A 4GQAA 1BRMA 2VQ3A 1NPYA 2Y0EA 3NX4A 3LU1A 4TVBA 4RF2A 4XDYA 4Y6PA 4WEOA 3HDJA 3D5TA 1DEHA 3CEAA 4GH5A 1P1HA 1O89A 2Z1NA 2QRKA 2FOIA 3ONEA 4JBGA 4RPGA 4HXYA 3QA9A 1P45A 4J1SA 5I9LA 2QRLA 3AU8A 5AQ1A 2HDHA 4D43A 3VHRA 1PS0A 3EW7A 4R51A 2YFQA 4J4HA 1JVBA 3M1LA 3FNFA 3CPSA 3VTZA 1E3WA 5DF1A 5ER9A 4A0SA 5IDXA 2GN8A 5KVSA 2O3JA 3T4EA 4I08A 1Q2XA 4LSWA 3EDMA 1UZMA 3VAZA 2BELA 2XXJA 1SZJG 4RF3A 3PIDA 2EJVA 2Y1OA 4R9RA 5TSDA 5IDYA 2NADA 4CL3A 1UAYA 4JJIA 2XF8A 2G0TA 5G4KA 5I7FA 4IDBA 3FI9A 2H5LA 4U0KA 3H7AA 1NR7A 3GEMA 3AI3A 4IXTA 1QYXA 3M6IA 1HE2A 2A4KA 1QV7A 1O6ZA 4E2YA 3TZHA 5B4VA 4IDFA 3SLKA 1ONPA 3HADA 1IHXA 4JX8A 3A4VA 5T8KA 8LDHA 3UKOA 4ALLA 1P0CA 2JCXA 1Y5RA 1JAXA 3EZLA 1SNYA 3ITKA 3VKVA 4TRRA 1CF2O 1DRWA 3IAHA 4OHUA 2C2XA 1U7HA 4BGVA 4E33A 3TL3A 1PS8A 3ROMA 1EUCA 2DLDA 1ISIA 4F6CA 1KVQA 4M49A 2NU7A 1OI7A 1YH3A 4PRKA 5TF4A 5BSGA 4CM3A 2NVWA 4DYDA 1LSSA 1PGQA 2FR1A 3BMCA 2GZ2A 1NWCA 3QW2A 3QVTA 5IZ4A 4L4RA 4NBTA 1GV1A 1JDJA 1EFKA 1VPDA 4XCVA 2VOJA 3I23A 3L6EA 3NT4A 3PP8A 4P38A 4TWRA 5ENVA 4E6PA 1QP8A 1YKFA 4YT2A 4O59O 5L95A 4J4TA 4MP6A 5IN5A 2GN9A 4M1QA 3JQ6A 3HFGA 1MG0A 4M54A 2BGLA 1FDVA 2DAPA 3H9EO 2VRBA 4II2A 3GNTA 4HX5A 4O1MA 4A73A 2NLOA 1SOWA 5U1PA 5I7SA 2R00C 4CMIA 1HYHA 3KYCB 1R4NB 4E2WA 5LDHA 4LVCA 1PJSA 2AQHA 3U62A 2PY6A 4Y8VA 1AHIA 5CPFA 2D5AA 3DBRA 4FFMA 4OOFA 2VHVA 4BO2A 5CEEA 1PWXA 4GX0A 1ZSVA 3TJRA 2VUTA 1I8TA 2O23A 4MVJG 2I6TA 1PJ3A 5MDHA 3DBLA 1E3IA 1VJTA 3EAGA 5TT0A 3Q2KA 4MVJD 2AW5A 3SBOA 3IKVA 5HA5A 4NNJA 3VH3A 3ENNA 1KC1A 4LCEA 4XYGA 3QWBA 3KO8A 1DB3A 4EITA 3ST7A 2DQ4A 3X2EA 1Y6JA 3KYCA 4IJWA 1SEPA 1U4SA 2G82A 3GUCA 4CR7A 2HRBA 3N58A 1VRWA 4YAJA 1HLPA 2X8LA 4FC6A 5COQA 3V2GA 4N5MA 4ZGWA 2ZJ0A 3EC7A 4CUJA 3C85A 1BXZA 5F1OA 2D1YA 1DRUA 3ETEA 4MKZA 3WSWA 4FOOA 4ALMA 3DHEA 3QVWA 5ILGA 4RQTA 2X1HA 4M89A 3D4PA 4FD3A 4UVEA 4B7UA 1XA0A 3KUXA 3ZW8A 3KTDA 4MIYA 4QFDA 3WDSA 4IBOA 3LYLA 1E3EA 2TMDA 1MV8A 4K9DA 4BB6A 3WNQA 2OP0A 2Y1CA 4Y98A 5ILOA 3NAQA 1XGKA 3AOGA 3TFOA 1Z82A 4IZHA 4N7RA 3WR5A 2FHSA 1GYQA 3WTBA 4CQMD 1LSUA 2OL4A 2BGMA 4NJMA 2FPGA 2QHXA 1D4FA 1E5QA 1P33A 3JTMA 1BVUA 3AW9A 4O5OA 4IDCA 4YCAA 1M75A 2EWMA 3RD5A 1HXHA 1Y8QA 3CE6A 3VH4A 1QSGA 4WUVA 1R6DA 4JJFA 3RI3A 1LNQA 2YV2A 3HJAA 3MCVA 4L0QA 1NFRA 5B1YA 3C24A 4BNFA 5BNTA 4HUJA 1NYTA 3RFTA 2QYSA 2GERA 1KEUA 3VH1A 4XRRA 4PG4A 1HDGO 4CMEA 2B69A 4QECA 3O26A 5G4KB 3BZUA 2ILTA 1OFGA 2QX7A 1ZFNA 5EESA 3FPLA 1GADO 4MKRA 1A9ZA 4FIZA 1C0KA 3S1LA 4FGWA 4YJGB 1KEVA 5LC1A 3ULKA 1YWGO 1X7GA 1E3WB 3KLMX 3LT0A 4XYLA 2YW9A 1B26A 1IPFA 2CFCA 3N7UA 2PKRA 5BR7A 4Z9FA 3CUKA 3C7AA 1SAYA 2J3IA 4MDHA 2YDYA 1GUFA 3VPFA 4AJEA 4BGEA 2CSUA 3R1IA 3INTA 5FWNA 1CIVA 4O6VA 2YQ5A 1ONNA 3B6ZA 1HDOA 4BQRA 1PTJA 3WQSB 6LDHA 1T2CA 4MINA 1XDWA 4CLRB 2J6IA 2O2SA 4RPLA 2I3AA 3NGXA 3UHAA 3H2SA 4FW8A 2D3TA 4RF4A 2OHXA 3TOZA 3FR8A 2OFPA 4E5YA 1H93A 1ISMA 4WGGA 4XGKA 2DU8A 1QV6A 2Q99A 5TRTA 1E1KA 2HK7A 5JAQA 2NU8A 4YYZA 5KTKA 1AXGA 1W4ZA 4HBGA 4W99A 3NTRA 4KQXA 2P4HX 3BTVA 2VYNA 3OQBA 4BNHA 2VRCA 3QWFA 5I9NA 3PYLA 4CLOA 3UAGA 1N1EA 1U5CA 4PLFA 4D7AA 5K9ZA 3LSYA 1X15A 3NKLA 2GF2A 1N7HA 1CQIA 1TT5A 1UUFA 2X9GA 3JQBA 4WNIA 3RC2A 4II3A 4J2OA 3JQEA 4WEQA 4KOAA 4AJ2A 2B4QA 4CMBA 3ZV5A 2Q1WA 5BSFA 1ZK2A 4BL5A 2W2LA 2NVBA 3GEGA 1ZXLA 4Q3EA 3ZHXA 4HNGA 4DQUA 3KZVA 2FWMX 3O4RA 1TA4A 4E3ZA 2FZWA 1E6WA 5FEUA 3E8XA 3QVXA 3O03A 2YHUA 3WICA 2H63A 2PH3A 2V65A 4GLLA 4E2XA 2CVZA 4ALIA 5KJFA 1P1FA 4AJPA 2PZLA 2GR9A 2ZATA 3I9OA 1RYEA 2AHRA 1R12A 2ZQYA 5BSHA 4URFA 1PZEA 4RORA 5JPIA 3JV7A 5HRUA 1BTOA 3LVFO 1R15A 4MP3A 2C5EA 4XB2A 4IM7A 2H6EA 4GKBA 4PGFA 3RCBA 1R4MB 4QQRA 2YYYA 4BNKA 2OORA 4UREA 3WGOA 2B5WA 3JQ8B 4DC1A 2BFMA 1LU9A 1K0UA 2JAPA 1ZSYA 4KUHA 5L7TA 4BGUA 4P8RA 3NEPX 3ZV4A 1O5IA 2HMVA 3WIEA 4NH4A 1B2LA 3VPGA 3MTJA 2XXBA 2HAEA 4GMGA 4OYRA 4PVDA 5U4QA 5K6AA 5ICMA 2IE0A 3AOEC 3WGQA 1I32A 1HYEA 4R1SA 3FR7A 3GUYA 2POQX 1DFHA 5HTOA 5FF9A 4I5DA 3W4JA 4ZQGA 2CF5A 3PHIA 1R0LA 3LT4A 2E48A 1DLIA 4Z3DA 2D59A 3GGOA 3MTGA 2FRDA 3EMKA 4HADA 1K2WA 1F14A 3PJDA 5LDGA 3U3XA 4WLOA 3BYZA 4DVJA 2NVUB 3QWHA 2D2IA 2J3HA 1CWUA 4K6FA 4XJSA 5JAMA 3ZH2A 4IJVA 3KSDO 1GAEO 1MP0A 5F3RA 5T8KC 1GTMA 1PL6A 4PG7A 2FY8A 4KWIA 4ND3A 1IHYA 3Q11A 4N5NA 4HFNA 4BS9A 1GU7A 3IC5A 1DSSG 3CH6A 3A28A 3D5QA 3DBVO 3ZV6A 1CRWG 1EQ2A 4OQYA
chains in the Genus database with same CATH superfamily
1JNYA 1P9LA 1U8EA 1CZOA 1I4OA 2R6FA 4IMRA 4M87A 4Z9BA 1J6UA 3UQZA 3MWEA 5TEWA 3W6NA 2XNCA 3OQPA 3GK3A 4P3PA 5HIAA 1K2VN 1NJSA 2XV1A 1KFKB 2PLWA 1DFGA 3NV9A 4YRDA 2BH9A 1V35A 2O3QA 2OCDA 1B3BA 5AYVA 3NNSA 1A8HA 1T6XA 2ON6A 3AUUA 4DM4A 3LUJA 2VLIA 3EVFA 4ENUA 2OXIA 1XRNA 3V4SA 2A86A 3LDFA 3B6JA 1BXKA 3JYPA 1Y7PA 3R77A 4BV2A 2YJNA 2QUJA 1O0SA 2VYFA 1WZ2A 2PFKA 4UE3S 1BU5A 3VR2D 4BBPA 1F51E 3VMMA 3BORA 1I51A 2VBCA 2L19A 2ZJ1A 3ZOZA 4BLTA 2Q41A 2XUIA 2BBTA 3R5KA 4XSHA 4IL5A 3VDRA 2XBMA 1L2TA 3E58A 4YAKA 1VE3A 4D9MA 3URMA 4NPCA 2GBPA 1O87A 2E37A 1G5PA 2I5PO 4U7HA 4ZCIA 2B8NA 2ZU0C 4FFOA 2CBXA 1VJCA 2IP2A 3E84A 2RGDA 2B1GA 3WAKA 2I7CA 4IS2A 1FBNA 5JI3E 5IJ0B 1BN6A 1E2IA 3U7RA 5JH7F 3L7CA 4HGQA 4OMFG 3MRXA 4FN4A 5JRZA 2EFDB 3MUNA 3B2EA 3TN7A 4BJ6A 5DCYA 2GEDA 1O9HA 3N7AA 1JHMA 3AUAA 3KWFA 2OM2A 2B94A 4F2DA 3HA5A 4XSGA 2VUSA 1PR5A 1C0PA 5AKZA 3CUTA 3D7MA 4ZK6A 1W30A 4LC0A 1VLJA 5AK5A 4LHWA 3L4BC 4KE9A 1E7RA 1P7WA 4JLBA 2VS1A 1H42A 3ICPA 1W36B 2JIQA 1JHOA 1YR8A 2XMGA 2Z30A 3MGCA 3QU5A 1HQCA 1KK3A 1WRBA 2N46A 4IWXA 3KHTA 1DZ3A 4LY3A 4TS3A 3CW2A 3QUAA 3QG1A 4S1TA 5HKLA 2GJ8A 1PJLA 4GVPA 3LPNA 2J0EA 5LMUB 1EP1B 1W85A 2FPWA 3AJRA 2HU5A 3E0XA 1ADJA 3PTAA 1AVTA 4D6XA 5BOSB 2XVYA 1XCJA 4UU0A 3D7NA 1FSZA 1KRHA 1U3VA 3JWJA 2DY0A 3OPYB 1YA6A 4XGIA 1UBKS 4URWR 5HQ3B 1K6MA 3TE7A 3OKCA 3WYNA 3A3PA 3AFMA 3AFNA 3VVBA 4X66B 4AJHA 1Z83A 4G65A 3C7TA 3TQSA 3LDHA 1TAHA 2P3LA 3ICCA 3JQ7B 3JQAD 4PQYA 4REOA 3H4IA 3X1WA 2NU6B 5FYDA 3SOZA 3SX4A 4QKQA 1G59A 2RK3A 2RI6A 3G3EA 2BBWA 3C3BA 4NS4A 3UCFA 3VTKA 1CQJA 2V7EA 4ZOLF 1HETA 2RGBA 4CCAA 4JGBA 3PNVA 4LXGA 2DQSA 3UIEA 4EH1A 2GXUA 2Q3LA 1RWPA 5JU6A 2XUOA 3UG6A 1F7UA 2H5IA 1T2DA 4UNQA 3BRQA 5DXAA 3I62A 4B35A 3K5HA 1H2EA 4UEKA 3EVDA 4U6QA 5C9ZA 2TMKA 4KQJA 3LY7A 5FR1A 2VK1A 4W1RA 2Y66A 1RCTE 2Q62A 3ZW7A 1JX6A 2ZRHA 1DAPA 2XUAA 4E5VA 2Q7DA 2ZTSA 4BBAA 1PNOA 3CRW1 3HJTA 3SX0A 1GG9A 4OKNA 3TM4A 3E7WA 1T34A 3N3BC 2FG6C 1G5TA 1YA8A 2QQGA 5JS6A 4YJFB 4UMDA 4ND8A 2E4XA 4OP1A 4X95A 3DZKA 5C2JB 1EFVA 2B83A 4YAWA 4U2CA 4NOLA 4YJ3A 5D3ZA 4D25A 5ALVA 1DQNA 2NZWA 3OTOB 3LXRA 3KD2A 3RE1A 2WHQA 3FOFC 3I45A 2FP4A 1E77A 2XWQA 5A02A 3AY7A 2W2MA 3MIIA 1VJRA 3KQWA 1E3DA 3AL3A 2Z95A 5E6SB 4ALKA 5HOEA 1ADGA 1F6BA 1BW9B 4CMIB 1HTWA 2QD4A 3RAPR 2BEUA 5EIWA 2HL6A 2VA8A 3CZCA 4YJ2B 1DGQA 1H8HD 2XEDA 3ZXXA 4HG2A 4Q3NA 2J5QA 5MFZA 1T6ZA 5JJLA 3M3PA 3OHSX 4D8XA 1RYMA 1X39A 3LM8A 2XZPA 3SQDA 3H17A 1ZOPA 4MV1A 4HGZA 1PYDA 1B6TA 1O94C 1G66A 4RDIA 2IODA 2JHGA 2ZSJA 4RW0A 1SOVA 4MW0A 4PFJA 4ZQIA 1AJEA 2JZCA 1EFUA 2WIAA 4ECAA 4EIWA 3IESA 1YS1X 1GLVA 2P4QA 1GZDA 4RZQA 2FCAA 4QOHA 1ZM4A 2RC5A 1GUDA 1GUAA 1UBMS 3RJ9A 4E5DA 1EGHA 2PGLA 3FFTA 3LK6A 3TGWA 5B6PA 1L7RA 1RBZA 2C97A 1JHQA 1VKNA 4LNHA 3RS2A 4R7GA 3ZWCA 5BVGA 3GLFE 2QXTA 1ZMRA 5HUQA 2ZCUA 4YAGA 2X0DA 4Z3OA 3FYTA 4Q4JA 1D7OA 2VEOA 5FKJA 3IQZA 5BYKA 5L4SA 2QENA 3RFXA 2BRUC 1IY9A 1NX6A 3GRYA 4AN0A 1A9XA 4YI5A 1VIYA 2DGDA 2IEBA 3VAZA 1TZCA 4BLRA 4LGVA 3PGVA 4TKMA 4JYPA 3WNBA 2A1UA 4I1OA 4WY5A 4MCAA 4G5HA 4UZSA 2MOKA 4I9UA 4QUGA 5K51A 3ND6A 4LYGA 3E9NA 3GJ5A 3RU2A 4JP2A 4I4CA 1OXKB 2BE9A 5DVZA 4IVNA 2UDPA 1NBHA 3VZPA 2CVOA 4YDQA 4NMXB 4OB6A 4CE6A 2JHCA 3B1VA 5IC6A 2XOEA 1MPTA 4YRTA 2AK2A 2XDQB 2NSYA 1RABA 2AXQA 2REBA 4TSRA 4BC0A 1ND5A 2JPDA 4RVFA 2PM8A 3WBJA 1H2FA 1KIFA 2PG3A 2WNHA 4HWSA 1XX6A 5AKKA 1MX3A 2YIMA 1FFWA 3NJ4A 3BL8A 3RWBA 4HDKA 4C14A 4ENQA 1ZJZA 1Q3KA 3HKCA 4HNHA 2PL9A 3IQWA 4L75A 3BQMB 1LDMA 3DOHA 3AEZA 1HI9A 4JBNA 5LUBA 4K8RB 2QTAA 4JQOA 4EPVA 4Z54A 1ZJWA 1T0HB 3JQFC 3GEPA 4Q0MA 3WBBA 2OD7A 3BTOA 3EXAA 1SHLA 3IUBA 3KUUA 5C8YB 4G2NA 4RHCA 1YFKA 3OU7A 3OZAA 4PQFA 2WQZA 4PWYA 1N2EA 4Z8YA 3N2NA 4U2FA 3FMIA 3PPXA 3HACA 1A8QA 2L2QA 3BSFA 2R5WA 3GQBB 2XUJA 3OZGA 4HB3A 4JROA 5EIAA 5IMSA 5CJPA 5JD3A 4A8JB 5K99A 2PE5A 5A05A 5A5GA 3IMEA 2BKXA 5I4BA 4M9ZA 5DLQC 4YFYA 2HA2A 4IH1A 2XOKD 1KQOA 3WFJA 1EFCA 3ZZ0A 1O0CA 4AECA 1LWOA 1RZRA 1Q6YA 2FH5B 2EGUA 1HLDA 1IAQA 4YJGA 3ZCPA 3G79A 1T4MA 3KZNA 4R84A 3PXUA 1SD2A 2R8OA 4HP8A 3WJ7A 3WC4A 4TLBA 5J43A 5HFNA 4CBVA 1NJ6A 3FCUB 3X2FA 4AY2A 1EPUA 4FYYA 4TTIA 1Z13A 2XD4A 1CE8A 1DJQA 1HEIA 1KI8A 4IVPA 2R48A 4AMGA 3TUIC 1JIXA 2H52A 5DYTA 4FTWA 5EHIA 4C6SA 5A7GA 2O05A 2OC4A 5AO9A 1DQPA 1QHYA 3H11B 1GJRA 1PW7A 3SU8A 4BUCA 4OXYA 2X8JA 5AW5A 2C31A 2DPYA 5LYJB 4G9EA 8AT1A 1VFNA 1OIXA 4ZZ3A 3GG2A 4JSTA 5H1YA 5C34B 2G5TA 2HUNA 4BNLA 4C1BA 3ANNA 1QDEA 3CB4A 1LD3A 4RHUA 3K9HA 2PWBA 4YJDA 3GT7A 4AJ9A 4YC7A 2DEUA 1RJFA 1TLFA 5HS6A 2J0UB 5HJ2A 2IU3A 3TFQA 3ZC3A 4OMDA 3EZ7A 3G0DA 3O2SB 2W2PA 2G9NA 1BYIA 4D3YA 3TLGA 2WWHA 3FOWA 3WL5A 3WHLA 1OAAA 1JHDA 1B41A 1XVUA 2VA9A 4UCFA 4F21A 3FPHA 1SKUA 1B00A 2WJYA 4KNWA 4XGRA 5DRYA 3Q5GA 1KAGA 4CUKA 4JXXA 1Z5NA 4B34A 3IJRA 2OESA 5CAEA 5HF6A 4E12A 1HDZA 4CM4B 1NRXA 4NPHA 1E2UA 5LFAA 4DLVA 5JCXA 1GP2A 4O02B 4EG8A 5JEEA 2CLIB 1U8CB 3HYRA 3PC8A 4HNTA 1I30A 3PD7A 1WQ4A 3O3MB 3NDRA 2VP9A 2QTZA 3HJRA 3RW9A 1B93A 4IAOA 2XIJA 2W71A 2DH6A 1J0XO 1W88A 1EESA 1C1XB 2F9FA 2CNWA 3H2YA 4FR5A 1KYXA 3TDKA 1NNI1 3SBEA 3ESAA 3R0IA 3OESA 4EGCB 2UZ0A 1T5IA 2YS6A 3DYIA 3RROA 4H0NA 4LX8A 2R8RA 2JJ8A 1WETA 4EY5A 2BP7A 1DAMA 4HH1A 3LMKA 1IQPA 4KGXA 2OT3B 4X1IA 1R9MA 2WD7A 1J49A 1ODCA 2VSQA 1FW8A 1QO0D 3MINA 4UPDA 4IUCS 2NSDA 3BGWA 4BRSA 3CUSA 4JCCA 5D5HA 4UNRA 2VJMA 1X14A 3BE6A 3L18A 5E6UB 5EHGA 3W1VA 3SE7A 1FTSA 2VN8A 5HR5A 3NCTA 3AFIA 2PFGA 4C7BA 2AOUA 1XNRB 3S3TA 2ZRFA 1EK2A 1M8KA 1P7VA 3EPPA 3HVHA 2GASA 4WOBA 1IPHA 1U8YA 2VG8A 1T3GA 2ID7A 3QKTA 4Q00A 4ZZ2A 3T34A 1EK1A 1K5HA 3MTAA 4NG4A 4RYLA 1EUZA 2H0AA 4C5CA 1A5SB 1OVMA 2H1HA 4I3FA 1HL7A 2W9XA 3SNKA 2GN1A 4XZ3A 4D74A 4HI0E 4JBXA 4Q19A 4DM3A 2W2VA 2QZPA 2PV7A 1ZEMA 2XT6A 3PFKA 3IDFA 1UM9B 3DV0A 5BT8A 1OKKD 1EP2B 4H1VA 2B36A 4RD2A 4CKZA 4AKIA 3GP3A 2RAVA 5BQFA 4YQZA 5JALA 4HWTA 2VH2A 2D0PB 2ZT5A 1U04A 3QLJA 4OAPA 4CMHA 2Z2XA 2FFJA 3FVQA 3HSYA 4E30A 4CIYA 4DMCA 1G8PA 1WKBA 4OHRA 1JHPA 4Q9HA 3SN6A 4R8MA 3EVAA 5IM4A 5GM2A 5AKIA 3TH5A 3EGXA 3R0XA 3DDCA 3NB0A 2C5FA 4LGYA 1IN1A 3ERCA 1DO0A 1E7MA 2AW3A 4UNSA 3A6GA 2HZ7A 1PKXA 4RD4A 3ZK9A 3OAAD 3RVQA 4E2ZA 4G0UA 1NUQA 1DU4A 3I5YA 1WMEA 3AIKA 1JL3A 3CRZA 4IS3A 4QOJA 2OGUA 5CDUA 2PSFA 1KVSA 4NE9A 3EW9A 1V3VA 2VJNA 4PE5B 1L1FA 1OH8A 3O1IC 4TROA 4PSUA 2CFRA 3EA4A 4PY2A 4KYVA 2WWVD 2AT1A 3PXEA 4S04A 4O0LA 4AP9A 4PYLA 4NK5A 3ZKAA 2AG0A 2QTRA 1A27A 4OP2A 5CB8A 4JT8A 2BF4A 4F46A 3AY3A 1UIRA 1UAAA 4BN5A 3HB0A 3TLZA 4BCBA 5CYOA 1L7NA 2C9CA 2YV4A 3B1YA 2Y1GA 2HZBA 2B35A 2ZJ8A 5A4DA 4MCJA 3GL9A 4BVFA 3FUXA 4G1EB 1CNFA 4OXNA 1D03A 1LDGA 2R3SA 2PDAA 5DT9A 4L5CA 4OD0A 4PVCA 1B43A 2G08A 3CR8A 3ZS8A 3PLRA 2O8EB 4PLHA 2LBPA 4EL0A 4F92B 2ZBVA 4BQQA 1N0WA 2YWHA 2FFBA 4RMJA 2E1RA 3B36A 1E4EA 4QYWA 4EZEA 2NUAA 1BW9A 1TEVA 2OCKA 3LH5A 3MN1A 1QQ6A 4TKZA 4V1CA 3LQ2A 4E5SA 1P1IA 3B7WA 1P8AA 2BFCB 2HRDA 1G8JA 3G02A 3GRRA 1LI4A 2PSSA 4YCBA 4ITRC 3TZCA 1S1MA 1Z68A 3WDMA 2RG7A 2V7QD 1HYQA 3W1EA 1V26A 2QJWA 3UEOA 1BMTA 1R0YA 2MHCA 4QAQA 2D1RA 4DR4B 5IHPA 2EFJA 121PA 1XVTA 3C3JA 4PQRA 3RIEA 2AZDA 1KC3A 2IXAA 2FRDC 2X86A 3LLCA 4G5SA 3VR6A 3WDLA 1EIWA 3FPSA 1MH1A 4EKYA 3UWPA 5KTSA 3GLIA 3A32A 1MAAA 4BKRA 2WABA 1UFQA 1OYVA 3BTUA 3ZJTA 1DI0A 1NLFA 4JJAA 4LZOA 4DDUA 1Y3FE 2XYVA 1NM5A 4PRZA 3IOYA 1Z07A 1FY2A 2X3YA 1KI7A 1YB5A 4IP0A 5E2BA 2YJ3A 3NTQA 3AY0A 3EZ9A 3G7NA 3KDPA 5CLQA 5LZ2A 1S2MA 1G38A 3U4DA 5KDDA 4GUAA 4IZIA 1QYIA 3BXHA 2YV1A 3EK2A 3GR6A 3OX4A 4INAA 1KQPA 2AJBA 2FDRA 3QBTA 1NVEA 5CXXA 2FB9A 1NI4A 1NYRA 3LBIA 3A14A 2WJAA 1YJBA 1CLEA 4DREA 4JUDX 4GBJA 5I7UA 3AV0B 1XMOB 4XYMA 3ECSA 4V3BA 5K0JA 1AQNA 3UZUA 5AW2A 3I2IA 2AX4A 3VKGA 3C3DA 5E4FA 1E8MA 1ZJ4A 4MUBA 2PH1A 5JO0A 1YQ9A 2GSWA 1Q7CA 1WPRA 2L42A 2YVUA 4DR2B 4Q02A 3KR2A 4UTZA 5K0TA 3IIKA 1XQ6A 5BOSA 4JT9A 1I14A 2YHBA 3ADKA 1IUKA 2WZQA 4M8LA 4HDQB 4XJVA 5FNZA 1TK3A 3COWA 4GXNA 5CJJA 4LSMA 1O0BA 3GLGA 3INNA 3ESZA 3HB4X 1I80A 1RHQA 3HJGA 3IEPA 3G2LA 3ISJA 4DYVA 4R8LA 2WVJA 2Q4TA 1TPYA 3W05A 2VUUA 1Y82A 3T5DA 3W8DA 5GP1A 4Z4QA 2HHAA 1CZNA 4NIMA 4NFHA 2F3RA 1PJ4A 5HMMA 3STTA 2G9ZA 5F1PA 3ZHCA 1TJ3A 3DDSA 4DCJA 5L4NA 1MJFA 4XFDA 1P1RA 3FVVA 3ZCVA 1U6JA 3UHFA 4HB0A 2AQIA 3SIRA 1YTLA 3HCEA 4HS9A 4UU8A 2B92A 2P0YA 2Z5GA 4QPCA 4WESA 3T5CA 1OYYA 3I9V6 2WKSA 2B0CA 4QU5A 3QBJA 1SXPA 1HOXA 1EX9A 3AVQA 1NI3A 2WINI 1YF3A 2MYTA 2GQ0A 3AUYA 3O9ZA 4ARVA 1U28A 3OZRA 3P96A 1UADA 1CR2A 1KK2A 2KE5A 4JD5A 4TTJA 1A9TA 3VPXA 2LD4A 1F4VA 4J4BA 4N5DA 4C0KA 4UCXA 4GVLA 1GA1A 2MSWA 3QG5A 4R0NA 1RFLA 4H35A 2OZEA 5KUTA 4OH1A 4C4SA 3PZRA 4ZALA 1PWYE 3VDXA 2NP7A 3THSA 5FNVB 2ZS9A 3SR0A 3MEQA 2J8ZA 3RADC 1DBWA 5JATA 3WFIA 1SZDA 4B4OA 1GL9B 4TZ6A 2H07A 3AUTA 3N2KB 3EMDA 3RSQA 5K8LA 5F2KA 5CW1A 1JWLA 3VHQA 3TMYA 1SC3A 4NSNA 1Z73A 3KFXA 2KYRA 4FSHA 2D0DA 3C98A 2ZBGA 3T3OA 4L4SA 3ZV3A 4GP7A 1UJ6A 1U1CA 2VNHA 2YVQA 1W5TA 1VM6A 3IEKA 4MGEA 2GN4A 3R7AA 5B1IA 4KV9A 2IYPA 3IFSA 2CZCA 4D92A 3H3XA 3HUDA 3IUNA 3NIFB 4R5HA 1GDHA 3PBKA 4JH0A 1KBOA 1PGOA 3MWGA 4LSZA 4ZO4A 4E31A 1QRUA 4YJ3F 1GPJA 4PZYA 5IDVA 1TVCA 1XRJA 4RE6A 4RLFA 1K7CA 1K7FB 2AEJA 3F4BA 4OU4A 3KPVA 4M6WB 2HPVA 3P0JA 4PZZA 1M1YA 1DQYA 1U1GA 3FYUC 3AHEA 2UYCA 1A5TA 4K6KA 3QU9A 3FYCA 1IWOA 3UHOA 1N5LA 3A6KA 2DPLA 1FDRA 3AEQA 1JW9B 1G0NA 4LK2A 3EEIA 2C5GA 3E9EA 2OO7A 3D1VA 4Z0TA 4JLDA 1MDBA 2XA2A 5JS2A 5K01A 5IT0A 2D5LA 1HBJA 1ECPA 1R0KA 1QHFA 3ED5A 1X3SA 4LJ4A 4UE2A 5JSKA 1Y33E 1THGA 1S3GA 3G82C 3R3XA 5BWMA 5ICCA 2HNAA 5C46F 1QTRA 1LCIA 3F5QA 3UK2A 1C7RA 3M4YA 4G23A 1PNVA 4JQCA 4ONEA 3NIGB 2H85A 2AKAB 2WYWA 4OLHA 1TNDA 3MSCA 2W6IA 4B31A 2XCOA 4FZVA 4M9SA 1C9JA 1B15A 3AZOA 2P8JA 2CUKA 2HWKA 4H2DA 4A27A 3D0RA 2Z3VA 5CH5A 5K4GA 2H1RA 1V4VA 1L8XA 3DJYA 3G5MA 2QL6A 3MRSA 4DPKA 4KE7A 1I2ZA 4EVIA 4H15A 1QK5A 5IARA 3U09A 3V4LA 1RLOA 1Z6YA 1N6PA 1Y1SA 1Y9AA 2FEOA 1ZKDA 2QQEA 4LZWA 2A2ZA 1SBIA 2H7XA 2XGJA 1NR1A 3B3AA 3RLIA 1WVGA 2V54A 4D9KA 4DVGA 5JROA 3BMOA 4R7ZA 1C14A 2AOWA 4WBNB 2OAQ1 3EXHB 2OMEA 3HJBA 1G6OA 1PFUA 3BCUA 1OGIA 2JGFA 2JRCA 2V9ZA 3SHOA 2Y3IA 1AUXA 3JD2A 5JCOA 1VDMA 4MIEA 1OTHA 3QPBA 4WERA 4C2AA 4YDSA 4RY9A 5B2ZA 1KJZA 2ZSBA 3AOEA 2ZTUA 2VCYA 1GRCA 3EH2A 3H84A 1ACJA 2QRJA 3CSDA 4NZ9A 2A9VA 5D86A 4IMIB 1J2YA 1BE6A 3F9RA 4HX2A 3R8XA 4JJ4A 1KOLA 1YRWA 2VQFB 3AR2A 1S6YA 1ZA2A 4CL2A 3VDNB 1LLQA 1ZD5A 1H85A 2CEKA 2VF8A 4R98A 1SVWA 1XCGB 4NHOA 4JBIA 2H3EA 1X19A 4UW9A 3L0OA 5BWCA 3TCNA 4ND2A 1RW4A 4R1PA 4QSHA 1ISFA 1U2PA 4MW7A 3U3OA 1ZUHA 3K72B 5GVSA 4IIJA 2ZP1A 2A88A 3STYA 4CV1A 4DNXA 4EUEA 2VPYA 4EG0A 3NVKI 1UCFA 3CN9A 1Z29A 1LRJA 4E2FA 3I34X 3ONVA 4JI8B 2DF8A 2GSDA 5KB3A 5HP4A 3KVRA 3K5WA 1OE0A 2HF2A 3K6RA 4ECEA 5K8JB 1QBKC 1JLMA 4YEDA 1C30A 2YCBA 3CXRA 5G53C 4RA6B 1GCUA 1PSDA 3AY6A 3EUWA 4JJGA 2AJDA 2HCRA 4DV1B 4R41A 3U3RA 1WCV1 2QPAA 4QJ4A 1EVIA 1GUZA 3A4IA 3QHPA 4F9EA 2Y67A 3SQXA 5L9AA 2GZSA 3NDBB 2VSYA 2YIDA 1Z5VA 3GELA 4DLRA 2LCIA 1U81A 2ZSHA 1KPHA 1EFPA 3PWZA 3TIGA 1ISPA 4Y2HA 1AGYA 5KIAA 1RKQA 4X64B 1CCWA 5H4GA 5GV7A 5EIBD 3OEED 3H3JA 3KQHA 1KI6B 4TWIA 4YCLA 4MV5A 1AC5A 3WBFA 1KYWA 4KQ6A 2K4MA 4D0NA 1E18A 2CFSA 2IBTA 5KREA 1T26A 1U0JA 1YZHA 4Y0NA 2DJIA 1QRTA 3RV4A 2H4ZA 3H9QA 1WDKA 3HYNA 4OJMX 2D7DA 2FEMA 3F7NA 3ZLTA 1EGVB 3DTVA 2GEVA 2O07A 2PR7A 5G4LA 2X1LA 1Y42X 3G89A 1QIFA 2BTOA 4RXTA 1VXRA 4WKNA 1KP9A 2IOHA 2CB0A 3M1AA 4JP5A 3RO7A 1P19A 3DMHA 3TG2A 2BFNA 1GAXA 1DWQA 1V6CA 2ATCA 2GTIA 1ZM3A 2ODQA 1A4IA 3BJMA 2OPBA 3NHYA 4ESHA 1M5TA 3FETA 4HDMA 4WDQA 1QYCA 2IYFA 3TLXA 3KZOA 2DPXA 1LJ8A 4G89A 4JOSA 4DWVA 2DFPA 1WNTA 1RE1A 3C8DA 1GGEA 4PANA 4PLTA 5D8DA 3AF6A 1RRKA 2QLNA 1P4RA 5AKJA 4YRGA 1TRHA 3HY3A 1JPUA 4TN5A 1JPVA 4YBRA 1SBQA 3PCRB 2X4LA 3BXPA 1JUDA 1PX2A 2HMUA 2MYNA 3EISA 3OUUA 3T3GA 3FCOA 5AHOA 3NETA 4J29A 4AS1A 2DBQA 4OL9A 5KYYA 2QN7A 3ETLA 4LJ6A 3GLTA 3ZHZA 2Z58A 4DV0B 2HLDD 2HH9A 2IYLD 3R0JA 4IXMA 4UFOA 5JMOA 4G41A 1MLDA 4COOA 2FJPA 1RQPA 3ES9A 4BNXA 3MT8A 2IOQA 3K0AB 4MWSA 4R2IA 3R7WB 5JZOA 2YWEA 1SA0B 1VLZA 2O2IA 5A9SB 1RM5A 4E1AA 1L7PA 3PUKA 3I5XA 2WJHA 4G0WA 5AVSA 1O8CA 1KY3A 2YMMA 1R37A 1RRFA 1CUUA 2XE7A 3BDAA 3IEIA 3IQDB 2R79A 4UBNA 4KDFA 4AB1A 1JMVA 1Y1RA 4N8SA 4D41A 1USUA 3C0KA 4KX5A 4NBVA 4KPUA 5IABA 1EKXA 1J09A 3F6RA 4B09A 3E82A 1DTSA 2BCGY 4AO6A 1PZGA 4LNUB 2B1QA 4MTCA 1T4DA 2PYIA 4I4LA 4F9TA 3R76A 3KU4A 4A6EA 1ILWA 2QTMA 4F4DA 2RHTA 5BN1A 3SXPA 8ABPA 3ZCSA 1XCPA 1P5ZB 4OUKX 3ZDFA 1GNSA 1L8AA 3Q9NA 3UK0A 4LF7B 2WPNA 1GNTA 2C84A 3F2VA 3BXZA 5G0TA 1CZKA 4AICA 4ZKDA 2KWIA 2NV0A 5TQ0A 1P9OA 3A6EA 4KN5A 2BD0A 2DR3A 2OV2A 4KDEA 3R9XA 3EFHA 2YINC 3AESA 5K6TA 5AVJA 4URYR 4K6CA 3O83A 2GBFA 4GF5A 5KS2A 3VGPA 2A8YA 1VMKA 3ZHSA 3H97A 4HNAA 2B9EA 3G6KA 2SCUA 5BQPA 1LLDA 4V38A 2HDNB 2VZEA 2FJUA 3QUCA 3M6XA 4OQ4A 2NVUA 5CX4A 3WQBA 1IN6A 1EJ6A 2QNIA 2YZ7A 4RQUA 4UARA 2BMFA 5TVKA 3NDIA 1Z2DA 3W5VA 5FWAA 3TZKA 1BYUA 1XDGA 1NRJB 1PFKA 1UZLA 2Q5LA 3C2QA 3IOMA 4H6WA 3RVPA 3T9BA 4BLVA 4PC7A 1SXJA 4EY6A 4IDNA 3K16A 4OQZA 5EI5A 2OAGA 2GCIA 2XT0A 2XVZA 3PIIA 4NDNE 1MTZA 1IZ8A 5DBHX 2NWQA 5IBCA 4MKXA 2IIVA 5J1SB 4QXPA 5T4EA 3ZI7A 5KYTA 4UEJA 4WN9B 3WBKA 3JATB 1Y1LA 1TU3A 3F3MA 1ISJA 2FQ1A 4H27A 4KPGA 4F12A 3EQ9A 1FFSA 2SECE 4WH0A 1YKSA 4KQGA 1JIJA 3W2FA 1MA0A 2R2AA 3MJVA 4MW6A 5DWQA 2E4UA 5C7IO 4MYCA 1HT0A 2R5FA 4QDKA 2JD1A 1JV2B 2E6KA 3U6BA 3EGDB 4YUXA 4B5KA 3SHFA 4YQFA 2G7ZA 1S9DA 2FMXA 5BNIA 3PUVA 2VHYA 2GZ3A 2FFAA 1HF3A 1KO7A 1TD1A 1P4SA 5E6UA 3PKIA 5G3YA 1D1PA 4J3NA 2B34A 4ZMSA 2ZUBA 1VE9A 4U2EA 4YT5A 5FBZA 1Y8CA 4PCUA 2HFKA 3DBRB 1HEUA 2PUEA 4K9MA 4WK6A 1XVVA 3IURA 2YXNA 1E9SA 1LF0A 4D44A 3KHSA 1VHLA 5FBQB 3ELYA 3B6EA 3EVGA 2BP7B 3MLAA 4TSFD 5FB3A 1QO0A 3EZYA 5FIUA 3L1JA 3VMFA 1B1CA 4XVRA 5EAIA 5H7XA 2IYTA 4Q4CA 3BHMA 2EW2A 1XQXA 3AKYA 4YMLA 4BNNA 3G2OA 2QDXA 1AKWA 1W9MA 4R2JA 2Y1FA 1A95A 4ZCSA 5TT1A 2O1XA 3OLWA 3T7TA 3GVIA 3R3WA 1N3LA 2A9OA 2NZUG 2QSZA 1VYUA 4GKVA 4WHMA 2BZ1A 4C04A 3OQIA 2WTUA 1WDMA 4OLFA 4H3HB 4GEGA 4BGIA 4M38A 3WKEA 5EJ6A 1IVYA 1LDYA 1A76A 3ZQ4A 4HPJB 3T9CA 2CJPA 1E1NA 4TZ0A 4MQEB 5KU7A 2NTNA 3L77A 1X1SA 3ELDA 4CPDA 1KAHA 4J7XA 1Z0JA 1KDPA 2YRFA 3N28A 2DPHA 3A8TA 4J90A 4YRQA 1JSZA 2Y77A 2JRLA 3FTNA 1SUSA 2JGRA 3CLUD 3NVMB 2XODA 3HC7A 4JEUA 5T64A 3A6LA 1F9EA 2DJ5A 4PNEA 5L3QB 3IP3A 2V7WA 1UXGA 1SCJA 1VECA 3I1JA 1YTUA 2RFLA 5TF0A 1EQUA 1TYAE 1JF8A 2GBIA 2ZT6A 3AR6A 4FBLA 3HA7A 4RH1A 5BSRA 3T3IA 1NW4A 4UUQA 5D87A 3R8FA 3OHPA 1V8FA 3QFSA 3BGIA 1WABA 3V55A 4M7PA 1GTRA 2C4TA 3QUQA 3ADCA 1VI5A 2BHLA 2A3RA 3DVAA 3FXAA 4OQLA 1XD8A 1KR5A 3FB1A 4U7FA 3SM9A 3V80A 2AVDA 4D56A 5CXQA 9GPBA 3O2NA 1TMYA 1IULA 1K4YA 2H1SA 2LDXA 2GEJA 2FLKA 1JLSA 1CJTC 2AG6A 2Q4RA 1ZNWA 1UXJA 3G8CA 5DOVA 3L07A 4JWKA 4G8DA 4OQEA 4BFWA 3QJYA 1H8ED 2Q27A 3P2YA 1OREA 4HFRA 4YXWA 621PA 3WK7A 4XIYA 1LPOA 3M3DA 3PD0A 1I4EB 1I33A 1U2DC 3GRZA 5D3KA 3QPWA 3OURA 1ESEA 4PBSA 1E2PA 1TEXA 1PFVA 3UANA 4B7CA 1XZLA 2CYAA 4C05A 5JISA 4WCDA 3ZCTA 3G0CA 3DZIA 2JGLA 2XAAA 4RDHA 2PUAA 3OLZA 1Y9ZA 4MIOA 1PT9A 3F49S 3R9WA 2Q49A 4QUHA 3RRNA 3DD5A 3MZ0A 3CX7A 1RXVA 1TZJA 4B0PA 3FKQA 4N41A 2H4YA 4HZUB 4EA9A 2O8CB 4J94A 1RQ7A 1DT3A 3T3DA 1DHTA 5K2MA 1BA3A 4OL0A 1PYGA 3STUA 3HXQA 3AEUA 1T2UA 4E32A 1YMVA 4A1OA 4N9QA 1RYFA 4D3ZA 3ANYB 4L3WA 1NNSA 1ODJA 3OCWA 4LE0A 1ZD1A 2FKAA 4X61A 3BZBA 2VHQA 4Q9AA 4YP7A 1YDEA 2FLVA 1MTOA 1P1KA 1W76A 2G36A 2JVJA 3EN0A 2G3YA 1OIWA 2DTDA 3ILXA 2JZOA 3OZVA 3WL8A 3RAEC 4MPDA 4UD2A 2WKQA 4IJ5A 1JDVA 3OICA 5EUMA 4URVR 3OEWA 2RHCA 3L7MA 4PC6A 2ONYA 2P9YA 4LNUA 4YO7A 2XGMA 4LVOA 1DOHA 5B5SA 1WD7A 3OY2A 2NSLA 5LJIA 4RTSA 4NCBA 3V9AA 4B6SA 3JAMA 1FZTA 3RRFA 2W37A 4F6RA 3PC3A 4TS1A 2F1KA 3FVTA 4PX9A 4DUZB 1W25A 1Z08A 1ZWKA 4BV9A 4EKGA 3S8EA 3QNWA 1SM4A 3ZU2A 1E1LA 4RIEA 3QSYA 2ZBRA 4L74A 1P4JA 2DFDA 4HNRA 1LPBB 2M2IA 3R0VA 3AHHA 1UBTS 5EE9A 2RB4A 3HB7A 1OZHA 1ZUNB 1G19A 2BW0A 2A84A 5CYFA 1SUBA 2ONCA 3QLVA 4PYKA 1Q1BA 4YXFA 2O2CA 5F1YA 5IULC 3L8HA 4KYIB 3EXFA 2RBGA 1A9RA 1U7DA 3Q7IA 3I1FA 3E35A 2F64A 3MBOA 1UDBA 1ACLA 4HAUA 1NNUA 2IPOA 4KPYA 1QGZA 1CJBA 1Y80A 1P31A 2A1UB 1V8ZA 3ZYCA 4EB6B 4P32A 4Q9NA 4QG7A 2YRXA 3O8LA 4ZVVA 5DHFA 5F5NA 2QQ5A 1NQVA 3DXYA 3GBPA 1COWA 1KRXA 2QT9A 3FA2A 4MDEA 1SVNA 3CKKA 1KHHA 1E8NA 2WHXA 3IP9A 4IHKA 4QTUB 5DX8A 4N7BA 4I1SA 2IVZA 4BFLA 3OJEA 5J58A 1UKEA 5HK8A 1VDZA 4RAOA 2B4RO 4NU8X 1Z17A 4KFTA 2Q6LA 4H18A 5CT4A 4ZDJA 4IKOA 4MV9A 5DLEA 3O31A 4TKLA 5I7EA 2C20A 4Y7DA 3CZ9A 2WT9A 3MXOA 2HT6A 3PG5A 4KLCA 2ID9A 2O3RA 2PD3A 1PNTA 3G2QA 2BH2A 2NXEA 4HZGA 1ZCFA 1UFRA 3PX7A 1XLTA 4ZO9A 4F8YA 3FAZA 3JSAA 4M1MA 3H0EA 4N8DA 3SLGA 4FFVA 1J97A 1TX4B 4WASA 3NAZA 4NKRA 3OQOA 3DB2A 1IK4A 3GVXA 3PYXA 2XSZA 4KDRA 4OUDB 3TZ6A 3CF4A 5KNCD 2GETA 3LW8A 2GJAA 4CU5A 1KP3A 1YFJA 1EFPB 4OXKA 3LRTA 4C4PA 1N5OX 4DV5B 4H31A 16PKA 3P9CA 4PC3A 2GWRA 3GLKA 1F6DA 3Q10A 4EVSA 5C7OO 3D3WB 4IQ4A 1ZIOA 4U6SA 1C7ZA 5DP1A 2HMAA 1V47A 1BDMA 4B6JA 5IAAA 2D5CA 1RZVA 4M0KA 2G0NA 3KM0A 3T52A 3JYQA 4YJFA 5JUWA 1ODKA 2P4UA 3S1AA 5EIXA 1ABEA 3O0TA 1T24A 2Q0QA 2IW1A 2R7NA 1BXGA 1GNVA 2JFYA 3OZFA 4OBEA 1KZ6A 3D3NA 4Q66C 1XZBA 1NZFA 1Y8RB 4MQ6A 1LPNA 3C1UA 4NOMA 4EYQA 1TYZA 2WIFA 3STHA 4Y6GB 4BV8A 1U0FA 2G1KA 3ELBA 1U3CA 4DTCA 4EJ2A 3AHDA 3U1VA 2WVGA 4MVJE 3B3JA 3MJSA 4FLMA 3BSWA 4O4HB 4OXIA 4AG5A 5IC4A 4US1R 3ELWA 1E7YA 3JVEA 5JYDA 3A1UA 3D81A 4P58A 1SKYB 2R68A 3C1AA 5BR4A 1I7NA 1OT5A 2ZETA 3CEHA 1ZXXA 4ER5A 2LKDA 2OAEA 1F0NA 3KUCA 4EG5A 1GDDA 2J9ZB 3E4DA 2PL3A 2L18A 1GTG1 2WF5A 3T3MB 1UZNA 4Q3DA 5CGQB 3T5GA 4CLDA 5K8IA 4XA8A 4MVYA 5JXHA 1H6CA 3A1VA 2GDZA 2AN4A 5F12A 3ITNA 3K2BA 2R2GA 3AKEA 1JEEA 4BO3A 2A0KA 4WL0A 1I7SB 3UOAB 1G4HA 1L5ZA 1L7AA 4WNCA 1FVXA 1UWCA 2FPMA 2VKTA 5T3YA 3TNFA 1GILA 1FJXA 2IHNA 4WBNA 1E9BA 5DSXA 1ZI6A 3V2UA 4KGZA 5EKSA 3QOXA 4JL5A 1JP7A 4L0DA 5JTUA 2PGDA 2DYKA 2EYUA 1Z4NA 2O2GA 1IY8A 1KGDA 2WHEA 3GV0A 1W85B 3HY4A 2P5YA 3AU9A 4PZAA 5AM5A 2X40A 1Y3BE 3ENWA 4ZEWA 5BSMA 2BJVA 1ZCBA 2J46A 3AR9A 2QRGA 3WK8A 2EF1A 2ZSKA 2PAAA 1JDUA 4UU7A 3WO0A 4DV6B 3ZEIA 2FPLA 1CRQA 2JIBA 3EOZA 2IYWA 4IFEA 4LF5B 3RRBA 2WAXA 3NV7A 5AVYA 1T9GR 2EIHA 3NTXA 4RL6A 4BEWA 3P0EA 4Z4CA 3SCZA 5IDWA 4G0MA 4IO0A 1CYEA 4EMSA 1GXSA 1VHJA 4Y9RA 1M0SA 1CUGA 2CCKA 4CMJA 2CE7A 3H3FA 3PEUA 2YV5A 4LRUA 4P5PA 4MI3A 2HBRA 2VFAA 4L85A 4MV0A 5ALPA 2O19A 2NZYA 3SXUA 3AFGA 2QUBA 3GFSA 4KBGA 5I01A 3USCS 2ATXA 2RGNA 4ID9A 1CUZA 1GYPA 1V9LA 1YE8A 1TM3E 2GTHA 3HKDA 4RVDA 1K27A 1F20A 1L4NA 1X7HA 5D85A 2GZ1A 5JAPA 1T25A 5DNWA 3TW0A 4DTIA 5FUMA 2QM7A 4HK4A 2B3DA 4Q3BA 3HPRA 4M6WA 5F52A 4ZTUB 2PMDA 4FIDA 4O4IB 3RABA 2W2NA 1DZIA 3BCRA 3ESYA 3NWEA 5E2IA 5EG5A 2QN9A 3SFVA 3X43A 5IKMA 4OXRA 4WA7A 5TS2A 5J4HA 1EM8A 1OBCA 2G63A 3IP7A 4QRIA 3ZGXA 3VSEA 4HFMA 5EINA 4Y67A 3LDUA 1G8YA 1DWPA 5AH0A 5GJVC 1UXIA 3KKQA 3NRCA 5JO9A 3Q88A 1MGPA 3KB1A 5SYNA 3V2IA 5AW7A 3U6KA 4AIIA 2O8NA 4L4XA 4GMHA 2FZ4A 4UTXA 4GI2A 4J7CA 4WZAB 3RR2A 1TQ4A 3B60A 4YJ2F 3T9DA 3IDZA 1OSNA 2FG7C 3CT4A 9LDBA 1AXEA 4K88A 2CLKB 2XA1A 4J6FA 5EYPB 4G25A 4PLVA 4NH0A 1USIA 1DQRA 1PR2A 3DP9A 2JEYA 5K4AA 3N2KA 3B5IA 4BNDA 1RKVA 4IO1A 3IHLA 3ROKA 2M1XA 4JLPA 1IU9A 4BMZA 2SNIE 4ZI7A 2A7QA 2JH9A 2P75A 3IQFA 5C5EA 1RRGA 3UXYA 1IRIA 1SUAA 4IDDA 2TRSB 1LX7A 5LN1A 2IYVA 2XMDA 2ERXA 4F97A 4NP6A 1PS9A 5FP0A 1ZXBA 2YXPX 4GGOA 1Q7RA 5CA0A 3T7SA 2B5VA 4TT3D 1Z75A 2PN1A 3IVAA 3RSFA 3VGJA 4DWJA 1NBMD 4F3CA 2H2HA 2B1RA 4OJKA 2I7TA 1DX9A 3DXZA 3QIAA 4M1EA 5E7IA 2FPUA 1YZLA 1WXEA 1QH0A 4P5DA 3KC2A 3BREA 4M37A 3DMFA