1JRLA

Crystal structure of e. coli lysophospholiase l1/acyl-coa thioesterase i/protease i l109p mutant
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
179
structure length
178
Chain Sequence
ADTLLILGDSLSAGYRMSASAAWPALLNDKWSKTSVVNASISGDTSQQGLARLPALLKQHQPRWVLVELGGNDGLRGFQPQQTEQTLRQILQDVKAANAEPLLMQIRPPANYGRRYNEAFSAIYPKLAKEFDVPLLPFFMEEVYLKPQWMQDDGIHPNRDAQPFIADWMAKQLQPLVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Acyl-CoA Thioesterase I
publication title Crystal Structure of Escherichia coli Thioesterase I/Protease I/Lysophospholipase L1: Consensus Sequence Blocks Constitute the Catalytic Center of SGNH-hydrolases through a Conserved Hydrogen Bond Network
pubmed doi rcsb
source organism Escherichia coli
molecule tags Hydrolase
total genus 57
structure length 178
sequence length 179
ec nomenclature ec 3.1.1.2: Arylesterase.
pdb deposition date 2001-08-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00657 Lipase_GDSL GDSL-like Lipase/Acylhydrolase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1110 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold SGNH hydrolase 1jrlA00
2VPTA 1YZFA 2APJA 1U8UA 1K7CA 3W7VA 2WAAA 1Z8HA 3SKVA 1ES9A 4RW0A 4RSHA 3PT5A 1IVNA 3HP4A 3RJTA 5CD9A 4JJ6A 1JRLA 1PP4A 3DC7A 4I8IA 4NRDA 3C1UA 4K9SA 3DCIA 5JD3A 1FXWF 1J00A 4HYQA 1BWQA 3DT9A 3U37A 4K40A 1BWRA 4M8KA 1DEXA 2O14A 4S1PA 2Q0QA 5HOEA 4LHSA 3DT8A 5BN1A 2WABA 4TX1A 4OAOA 4OAPA 2Q0SA 5A4AA 4JGGA 1WABA 1ESEA 3MILA 2WAOA 4H08A 1ZMBA 2HSJA 4JJ4A 1FXWA 5B5SA 1VJGA 4DEVA 4K7JA 3BZWA 1VYHA 4Q9AA 4JKOA 3DT6A 2W9XA 3P94A 4K3UA 4JHLA 3SLRA 4IYJA 4XVHA 4PPYA 1ESDA 1DEOA 4Q7QA 3KVNA 1V2GA 1ESCA 4HF7A 1BWPA
chains in the Genus database with same CATH superfamily
1LJLA 1JR3A 2FK8A 3Q9UA 4J9VA 1Z18A 3S2FA 4G0WA 2FOIA 1K7CA 4L4UA 1Z0ZA 2H4FA 3HB1A 2IOFK 1GQ2A 1E2LA 5B2ZA 1YFJA 2P9ZA 4NFHA 4MV6A 4K0KB 4LBYA 1SAYA 4JYCA 1FFXA 2ENWA 3ADDA 1NJSA 2BY4A 2P6UA 1CUYA 1ORIA 1HDIA 1Z47A 5BSTA 1K97A 2B30A 1S96A 4Q7KA 1GQFA 3RD5A 3AFMA 3AZPA 3UATA 1FPMA 1NPDA 3W77A 2ZWOA 1UFOA 4MA4A 1K6MA 3GEIA 2PSDA 4IHAA 3IQEA 4XWYA 2HPVA 4U8GA 4C06A 5AESA 5JARA 1NF8A 5ENZA 5KQSA 1NJ8A 3BTOA 5HKLA 3KAQA 4P1ZA 3UZUA 3Q8MA 1E6EA 2K2WA 2PX3A 3HN6A 4LRYA 4BFZA 3Q3JB 1ML4A 1V6AA 1SQFA 3KZXA 3T1QA 3K05A 3R9XB 4Z2YA 3VOTA 3D31A 1J23A 1YRYE 5IVHA 1FYVA 1VB3A 4MITA 3ZEIA 4BQEA 4CKXA 3GFOA 3NDPA 1XVIA 3TSAA 3UT5B 2I7TA 1G4AE 2X8JB 3UK2A 1ZM4A 4E5PA 4Y2SA 2F59A 5E8JA 1X7GA 2P4QA 5C34B 3IRVA 4Q3EA 4NY1A 2D3TA 1PVVA 5BYKA 4C7OA 3FROA 3ICVA 4MKIA 5BW8A 3KQKA 4A2QA 1V3UA 3KJGA 2ANCA 3TLYA 4JBLA 1H2XA 4OQLA 4RS4A 3WYDA 4BQIA 1RD4A 2B7CA 2CDNA 5AHRA 1FTGA 5J5VA 1WCYA 2BMAA 1L4GA 2GSDA 3DTNA 3V97A 5LA6F 4A5SA 5I4KA 3TWOA 1G2QA 1D0SA 1WY5A 2OCAA 4MWOA 5JBNA 2VJLA 1P1HA 1TNDA 1JW9B 3KBBA 3FDZB 2EX1A 3GB9A 4QGAA 1OU4A 1A2QA 3G5LA 4DXDA 4HQ0A 1MN6A 4KX3A 4WMLA 2ZSFA 1O5TA 1KFBB 3R0XA 4N82A 1JLKA 5IDYA 2R7KA 4CODB 1T0UA 2XTJA 2G0NA 3C8DA 1MEOA 2JFBA 1J0XO 1KFEB 1X80B 5G02A 1F5NA 1S2OA 3KO8A 3I04A 2Q1UA 2BWJA 2XNJA 2Z0MA 2H5LA 1KS2A 2W8BB 4LJKA 3PVZA 3W2FA 1NJ2A 5A7FA 4TXJA 4Z3OA 2BM0A 7ADHA 4LXIA 5F3WB 1CS4C 1ZKMA 5AVZA 3TMYA 4TV9B 1RPZA 3IEIA 4W5QA 1AZSC 2I6TA 1T29A 5J59A 2QORA 3TGPA 1OZAA 2Q4TA 4HLNA 4ZVPA 3WICA 4A27A 1H69A 1ML3A 1ZRMA 3ND7A 2RJ3A 3N86A 4CM8A 1BDIA 3LW7A 2BHRA 2PR2A 3T7TA 3G6KA 3CSUA 3RAPR 5JNLA 3ZWCA 1Y3BE 2UYYA 4BBPA 1HBJA 3OT1B 5IASA 4IIGA 2VNIA 2QG9A 2Z3WA 3DKVA 3VU9B 3AFOA 1AC5A 1NUSA 2D1SA 3ZCQA 3EQZA 4X60A 3AF3A 2DUWA 2R66A 5AM1A 3TJMA 2DQYA 5IKOA 4X45A 2C29D 1GZDA 2I6GA 3W3AD 3PDCA 1K3UB 2X2OA 3BSWA 3DDCA 1YKGA 1FRQA 1Z16A 3QTLA 5A7HA 2Y4NA 3DBRA 2ZYUX 4DSZA 5ALIA 4FLEA 4IMPA 2DULA 4RA9A 3DFUA 3NOOA 3HVIA 4UAGA 3VOBA 5K20A 1MMFB 3HY3A 2QMQA 4P5DA 4OMCA 3NC0C 4O4JF 4L78A 4NE7A 5LZ5A 3SYKA 4AS3A 3GD7A 4EB0A 4RA9B 1KZ1A 3TLZA 3Q9NA 1FE8A 1W87A 2D2VA 3FOBA 4OBEA 3FI0A 2AMVA 1JHAA 2FW9A 1XZMA 2JS7A 1OTHA 2ZRNA 1JQEA 3EODA 1CUJA 5JG7A 4D3DA 2Z2YA 3FN4A 2GZAA 1GPWB 1C1YA 1I6KA 3HA3A 4DZZA 5L9AA 2VDQB 3TLKA 3PP8A 2O1EA 3V1NA 1TU0A 5DBOA 2G1UA 3AZOA 1JG6A 4PLVA 4RZIA 4F3TA 4TL6A 1MT0A 4TS9A 2PIAA 1KY4A 1YCHA 2OSBA 3GJ0A 4LYJA 4KGDA 5FOXA 4KV9A 3WIEA 3LUKA 5J63A 2QM3A 4NCHA 4X6XA 1PBNA 5K3EA 1HE4A 1M10A 3H13A 2QYHA 1M5TA 1P2GA 2JD2A 2IS6A 1YJ8A 2FN8A 2RGEA 3BWMA 1HI9A 2EQAA 3L1UA 3RSLA 1L4YA 3WLMA 2HZBA 4IDOA 5D5QA 1I6MA 3LH5A 5E2AA 1KXZA 1XP8A 3I2IA 4UNNA 4XQGA 3E58A 2IHJA 5EE5B 2DHQA 4PX3A 1PDOA 1RQRA 1USGA 1ID1A 2J6IA 3BZUA 1QFXA 4XWKA 4NENB 4ENTA 2GILA 4RIIA 4OYRA 3ISVA 1PYOA 4IQGA 3CPSA 5BN5A 4HNSA 2NG1A 4AROA 1XPOA 1PS8A 5IX8A 4B3IA 3THOA 4FR2A 5F1YA 1CW2B 4EI8A 1YR7A 2JFYA 3P5BA 4HKTA 1JT9A 1ISMA 4AYXA 3NH9A 3NVMB 4RJ2A 2NADA 4GOMD 4XJVA 1WVMA 4CKBA 5FWDA 1H05A 4CM4B 4OSEA 1SD2A 2HW8A 4B4VA 3KB2A 3K0CA 4A8PA 1W30A 1E63A 3RIYA 5LMUB 1JWLA 5IW8A 1VJ0A 4LWZA 1FDRA 4ROTA 3EPHA 1DHTA 2YQ5A 3E48A 1G5QA 2QTMA 4LV5B 2WIFA 3BORA 4PGFA 3CNHA 4BIMA 1AXGA 2WFZA 3JQ9C 2V7EA 3ND9A 2Q4BA 3JYNA 4RJIA 4B4UA 1IM5A 1XMIA 4O3MA 3A3OA 3KJIA 2HHCA 1W85A 1WETA 1XMQB 1VJGA 1Y3AA 4NFSA 2IDZA 1RXWA 1FZTA 4YO7A 3COZA 4B40A 5ALPA 1RXUA 1O54A 1DT3A 1YBHA 3DKPA 3CB4A 4N0PA 4PVDA 3DMNA 3E7FA 3W9SA 2J45A 1SB8A 1U0JA 2XA2A 4JT4A 4U2GA 2ILTA 2X3FA 3WY9A 5I6DA 3O4JA 4BO9A 4JI4B 1KMIY 3U39A 4R0NA 2Q50A 3BJIC 1I7QB 2IYLD 1DG9A 3EF3A 1QUFA 1VI5A 3I2YX 1Q1EA 2HA7A 3BD6A 3PXBA 3S2UA 4CIVA 1QDLB 3U0BA 1UT8A 3C6BA 5LQUA 3H2JA 5K3SA 1KO7A 1ZUIA 3QI2A 2EZ4A 5BMVF 1XDSA 5FWXB 4OK5A 3QX7A 2P9GA 1EWYA 4LY0A 2PRIA 4YCBA 3PKJA 2Y1OA 3T9CA 1W7AA 2OZPA 3IXQA 2VTEA 1OIVA 4UU7A 3VHLB 4TKVB 3W7AA 3USZA 1KNXA 4UUOA 4HD8A 1RS0A 4HUTA 1SHUX 1BVYF 2ZULA 4TTPA 4P3KA 2PVCA 4I9GA 1XD2B 4FHEA 3HWRA 4B2LA 5KNDA 2NP6A 1VJCA 5BURA 3O9ZA 3X1KA 1ADFA 1GNQA 3OLQA 1M7GA 4BASA 1GGKA 1ZOPA 1W4CA 3CSDA 2IWHA 2ZTMA 3OEWA 3QOFA 2XKAA 3B6KA 4N6OA 2OEPA 3QU2A 4XH9B 1FF9A 3A4MA 4B4WA 1VE3A 2QNBA 1W4BA 2GLUA 4YPFA 2O1SA 1QIKA 4DBVO 4BQPA 1REQB 3F74A 3P4XA 3PEUA 1C7RA 1G6OA 4Z86A 2V6BA 2CWDA 4MW6A 1Z34A 3KFVA 2MR6A 1FYXA 2P6PA 3ZHSA 2JKYA 4ROSA 1WL8A 5B3KA 3Q3IA 3GLHA 1DAGA 3IERA 1PTKA 3E1GA 1CG6A 1NFFA 3DFMA 4KQWA 3RYFA 4DLTA 4N7RA 2BGJA 4EHLA 4CEJB 5AW1A 2FR8C 3PHLA 2ZWAA 1JZTA 3GEHA 3JQRA 4G3XA 1WSDA 3IUSA 4AX4A 4FR5A 4FGZA 4IY1A 4S1VA 4BO4A 3IOBA 5B7PA 1SXPA 4C1BA 4MKFA 4OLFA 1PHPA 3RNLA 4IDDA 4YALA 3RVLA 1IHPA 1PJZA 1RZVA 2AJCA 3CX3A 3D6HA 2JHPA 3K32A 3NHKA 3M6IA 5EWJA 3DOHA 1KYXA 4M8KA 1J2TA 3C3CA 3EZ6A 3BILA 1E6LA 1P1CA 1QIHA 8AT1A 1Z68A 4I50B 4IEIA 3AEQB 3L1JA 2BJVA 2YIJA 3BWDD 3QYJA 3FPKA 3A11A 1EFDN 1VA4A 1ONSA 5TT1A 3RGWS 2G36A 2PL3A 3CH4B 1D1QA 3EQ2A 3NP9A 1KY3A 3LT0A 4FKZA 2OHXA 2OKGA 3BJZA 5LP6C 4D3SA 3C8MA 4IIJA 2H07A 1YUNA 3BE6A 5LMCA 3PC2A 4C4ZA 4XPZA 3SR4A 1O96A 3DONA 2X42A 4FD2A 3DL7A 3AR7A 1J06A 4C20A 4O63O 3IPYA 3U80A 2UUBB 4UD6A 2IYNA 1VG1A 4K3VA 5KPDA 3OJFA 1UF9A 1XWWA 1I5EA 3BWYA 4G5OA 4GD3Q 2C4WA 5AW3A 2AEJA 4BVFA 5BQOA 3E53A 4JOSA 4R68A 3TX2A 4A1FA 4CLDA 2QE7A 4WCVA 3A7DA 3OBBA 1JB9A 2ZXUA 1E2PA 1ZD1A 1MO3A 1OWOA 1NNSA 2EG9A 2J7PD 2LBPA 2ZB7A 3KQVA 3OSZA 1M6NA 3R40A 2WVJA 1G7SA 1QFZA 2WSYB 4H7EA 1RLJA 4WCDA 3PNYA 1UJNA 5LBIA 2QD1A 3RB8A 1TKBA 3MERA 3RM3A 4YCJA 4DSTA 4JHLA 1M6VA 5IU6A 4PRLA 4RBNA 3EUEA 2WFLB 2DBQA 1FYWA 4MLCA 1CDZA 3KQWA 4OHCA 4BNNA 3FWZA 1IQRA 2AWOA 2I71A 1UJ5A 5AVKA 1FUKA 4Q4CA 2QM0A 4M54A 2NU7A 4FFOA 4FYJA 2H0QA 2KB0A 3HY4A 2ZBFA 4LNHA 1E4YA 2BKLA 4KR7A 1JWBB 5BUZA 2WVAA 5G4KA 3ETCA 4Y2HA 3KLBA 1DKUA 3PEFA 4Q93A 1Y7LA 4N3BA 1C81A 3L40A 4Q1CA 3INNA 4BQSA 3AOGA 1OROA 3D3JA 2G9ZA 2EFGA 1QXSA 2Q46A 4JX8A 1AKWA 1UPTA 2O2HA 2V3WA 3NPAA 3CLKA 4UBOA 5DGTA 4EAAA 4YUXA 3HDGA 3BKWA 1A5ZA 1OVGA 4KIGA 1U9ZA 4O0LA 3HWX1 3P9RA 4AZWA 5B36A 2EAUA 2VDLB 4ZICA 2E85A 4WZBB 4D9BA 3H9QA 3C5VA 1RVV1 3FZEA 2JLXA 4Z9YA 1G8MA 4LV6A 1Y8QA 3N2EA 2CXUA 2AJLI 1L6IA 2WZCA 3SHVA 3AR8A 3ZWXA 3DOJA 3OLZA 5LLTA 1NLZA 1UAYA 5TDHA 1EB8A 1YL5A 1NYLA 4C0WA 1CDOA 5K51A 4W5JA 4Z54A 4G84A 1DP4A 4K8OA 2VQSA 4LY6A 4MDHA 5MF6A 16PKA 2YHBA 5BUSA 7REQA 2A33A 1UC5B 4MKHA 5C3UA 4G41A 1JXAA 3M4XA 3NWPA 4IIEA 2VNSA 4C08A 2VHWA 1I1OA 5C8ZA 3UBMA 4YRBA 1ZC4A 4FU0A 3TCNA 2MYUA 4H2DA 2K7ZA 2O54A 5DP2A 3K35A 1XCGB 3O7WA 2XCUA 3C7KA 1NJ5A 4GFDA 1PE0A 1ZK2A 2IHYA 4PGAA 5CUQA 5ALXA 5JRZA 1T8UA 3FYUB 3WYAA 2ZTHA 4P34A 1L7EA 3BF8A 3AF1A 2WJVA 2VZ8A 3L7OA 5ALRA 3FFAA 1D6MA 2O7QA 1JQDA 1JQ5A 3OOWA 1XAIA 3UWPA 1HNNA 2YHIA 3LHKA 5G40A 3W9BA 1VLLA 4HGPA 4P35A 1T9CA 4O25A 4NABA 2C77A 3HH8A 3N5KA 3L9XA 4G01B 4JYMA 3N0XA 4YRSA 3CLTD 5BWBA 2CF6A 1Y8CA 3VHQA 1VPLA 2AF4C 2P3SA 4J1NA 4BJHB 1IMOA 1DOHA 1IXZA 1ULSA 3INYA 1MA3A 3TFOA 2FZGA 4GT1A 2MSWA 5AW7A 3CINA 1ZSNA 2ZPTX 3AMVA 3DLHA 3WBBA 5DU2A 3IGFA 2WABA 3QU5A 1YCFA 4MO9A 1YDEA 2HREA 1QH8A 1G2OA 1XTZA 2Q6TA 2GN2A 2XTZA 3DTVD 2DFPA 3FBGA 1WEHA 1EP1B 1TCAA 4WOKA 3BVPA 3H4TA 1ZAKA 3C4JA 3TSZA 4WXYB 3BF7A 1PJ8A 1N1MA 1FLVA 4GM0A 4ALNA 2FFBA 4U2KA 3WWDA 4QSMA 3VPGA 1JSRA 3FBTA 4F92B 2JNWA 3B1WA 1O0BA 2QUAA 1L7NA 1L8QA 4UZFA 2FRDC 1E3DA 2IDJA 1BHSA 2QV0A 2ZSDA 1RAGA 3M83A 1ND6A 3G9ZA 3NNNA 4G5FA 2F3PA 5FCDA 5KOHA 2GWHA 3IHKA 2B2NA 1C1DB 2NPOA 4OQ4A 2WBLC 2Z95A 2ZWMA 1IEQA 5BPHA 6Q21A 1OI2A 4D45A 4DB2A 3ACBA 1HF3A 2JASA 2PD4A 2R4TA 3ILSA 5J2UA 4ZAVA 4PFJA 3TIVA 2OXRA 2ZUVA 3QQPA 2WTAA 5ICFA 3CIOA 2R4UA 2GUWA 1KP3A 2OZVA 2ZBUA 5AHXA 2DFVA 4RPIA 1GKIA 1QFJA 3VGPA 3C1AA 1YR8A 5HJ5A 2BSXA 1GUDA 4OQXA 3KFLA 2FK7A 3M4ZA 1JMKC 1G7CA 1QVZA 2UZ1B 3P9IA 1JR3E 4GPIB 4O29A 1E5QA 4R1OA 1Q0ZA 3UGQA 5EIBD 4W1QA 4LHXA 3EDCA 5JCJD 5DTEA 1RXCA 2I2WA 1VECA 2B7BA 1MG0A 1IBCA 1CR2A 1Z2DA 3VPCA 5A2GA 4S0XA 5DBIA 3Q85A 5K4HA 5L7TA 3VNUA 3PL5A 2YVQA 3LX4A 3L7YA 1M7BA 3EZLA 3REQB 3F8WA 5FLYA 3THRA 5FT9A 4TXNA 3WE7A 3WKBA 3HYLA 4O02B 4PF1A 2D3WA 3BSYA 4RVFA 2G82A 3P0HA 5J9FA 3FJ1A 1RJDA 1M74A 1TZJA 3LE8A 4WJLA 1SCQA 3KJFA 2AI3A 1RXEA 3AEUA 3TBHA 1RZRA 1DJPA 1X2EA 1RI2A 3M0EA 4IZIA 5JZBA 4B3SB 2Q2WA 1T0BA 3HJAA 3GG9A 2I78A 4YJ3F 2VUHB 4DJJA 5E4TA 2AEFA 4N76A 2O19A 4EVIA 1O96B 3TSOA 1ORWA 3AOEC 3IEXA 4ACBA 1TTQB 2B82A 3J7AC 3D7RA 3EK2A 2ZTLA 1V1RA 3EC1A 4HLQB 3WLHA 2W6JD 2C0QA 2WPNA 3F1LA 3OQBA 4ZI7B 1U98A 3DP9A 3ZDZB 5I4IA 3OQMA 1QYRA 5GJVC 3ACDA 4E51A 1M2FA 1BS9A 1SXJD 3C1UA 3R0ZA 1DUVG 1E2GA 1H22A 5IFLA 1U2GC 2QTNA 5T6BA 1A04A 1ZK1A 2TMDA 1DTWA 4LDZA 3RT7A 3HR4A 3OEED 5H80A 3QMPA 3I53A 4C78A 1QDEA 1VE5A 3EVEA 1C14A 1CUXA 1U3UA 1K5HA 3O8NA 3P26A 5FULA 4IM7A 1JTFA 3KHUA 3VPFA 4DLKA 2NXJA 2E18A 3GXBA 2ONCA 1B8NA 1T91A 4KZKA 1L4EA 3ONFA 3EA5A 2QUIA 1U1DA 4EVSA 3IXMA 2FW8A 1P1JA 2IYOA 3EZ9A 4UM8B 2DKNA 3RFXA 2CDAA 3QRWA 3GXOA 1M2JA 4UVHA 1A9QA 1WQ4A 3WVNA 5LZ2A 1PVDA 2GAJA 3K15A 1R10A 4EFLA 5HOEA 3K09C 1DOAA 4N3GA 3KAJA 3EAQA 4RHFA 4KW7A 5E9JA 5HILA 5HKKD 3NCHA 2FZ5A 3FOZA 4BWVA 2BC9A 1ULHA 1WDLA 2HSWA 3G7NA 2V3CC 1DCMA 1IUNA 3N0WA 4IGEA 5DYIA 3VH1A 2GRJA 2M98A 4NYMR 3OZAA 2DKOA 2ZJ0A 5HCIA 2J3LA 5LQCA 3W5SA 3CX4A 1NNLA 3A9WA 4G5SA 4PFSA 2P9JA 2PGIA 2VPPA 4YMGA 5JXGA 7MDHA 1NXSA 2WU1A 4NCXA 3RJZA 3HZHA 4BATA 5I48A 1AE1A 2TMGA 1PYDA 2ZQZA 4OX9Y 3P2EA 3HTXA 3KB8A 3ZS9A 2C00A 4OUDA 4X9XA 1EFVB 3ECCA 3HGMA 3R2JA 5LA6B 1FTSA 1YULA 2C20A 2F1JA 1H3FA 2PEYA 4Y2TA 3QPUA 3RRZA 3S29A 2QE7D 4IEFB 4CT5A 3DDNA 4X1KB 4MCHA 4R69A 4X93A 5I3ZA 4UU0A 1DXOA 4LZLA 5AI9A 2WYVA 2ODTX 3R41A 4BNKA 2PT9A 4EX6A 1GSAA 1F60A 5MN4A 1W36B 4D4HA 1GLNA 1W93A 2J32A 1IZ7A 3PQ8A 4UREA 1VKZA 4MR9A 5LJIA 2ETXA 1GADO 2H5IA 2GJ9A 2P78A 3UUEA 4UM9B 4A0FA 3Q5GA 2WWGA 5AJZA 4MJXA 2PVSA 3GVIA 4PQYA 1U0EA 2JJMA 3CT6A 3M4YA 4FOTA 2PRKA 4WKBA 1Z5VA 2HBZA 4NZ9A 3UB3A 2IYYA 1EK2A 1KGDA 2GCPA 2XVXA 3ROTA 1A76A 3K8ZA 1IHXA 2PS3A 4GYWA 1F12A 3A06A 1PX0A 1PJRA 4FYMA 4R31A 4XI9A 3ZW8A 4N0DA 4MEAA 4YB8A 1X70A 2BEKA 4FJ2A 1FBTA 3GR6A 3IULA 1EDOA 2GK6A 5TQ0B 3KD3A 3KYCA 3SC6A 4DCOA 3WAGA 1MABB 2PCJA 3N7TA 4AF8A 2ZITA 1RRMA 5E1MA 4YQYA 4CKBB 2EP5A 5J3JA 1D0IA 1K3FA 1Y3HA 5TPWA 3WLKX 1U7PA 3ZTWA 2AZXA 5JROA 4HXEB 4JS0A 4QOHA 1KQGA 3OEHA 4FKMA 1WDKA 2XE8A 1KR5A 2YRXA 1NDQA 3I2GA 2YYSA 1S1CA 3IUBA 4QXAA 4TRJA 4TLDA 3AM3A 3QH4A 3SPXA 4PYQA 3KPWA 4MRRA 5AK0A 4RKWA 2WU0A 4YMIA 3LTNC 5ICGA 2RGDA 1MDFA 1LPSA 5AFSA 4OBWA 2I3AA 4GZLA 4JVMA 1LW6E 2X4GA 1B76A 3E9MA 3IS3A 3QVGB 4BQOA 5DISB 5AKZA 4CETA 4DG5A 4EUSA 1EXVA 4HLDA 5F98A 4PS1A 3K9LA 3UG7A 2PFSA 2QK4A 3KT6A 4YLGA 4DDKA 2VAWA 1RCTE 4N9QA 3TW6A 1TQ4A 5IAOA 2OBFA 4U6SA 2FG6C 4K9DA 4OH1A 3ZWQA 3EPRA 5C5CA 2VK2A 1PTJC 1UP4A 4XR9A 3EYAA 3A2LA 3C5CA 3NONA 2X7HA 3BL8A 4W99A 2NVBA 1SD1A 3ANMA 3KDSE 3TXYA 4XDZA 3VDMA 2A0YA 3S27A 5E6SB 5JH7F 1JFFB 1FVFA 2FUG1 3MJSA 1NNUA 2JPDA 3CE9A 1NG9A 3OZIA 4GX1A 1TCCA 5K09A 1D07A 1NLYA 3ZGZA 2F4NA 4PPQA 4TQAA 3OA2A 1IK4A 1F8GA 3FZNA 1P61B 2NPIA 3DHNA 4FMDF 3RLIA 4RJJA 4EGCB 5AVYA 2Y99A 3EGVA 2J1LA 3LXRA 4JC8A 1ESEA 2A3NA 5DM70 4C0XA 3NBZC 3NGXA 1BX3A 3QXGA 5JRDS 2F9MA 4LF4B 3LL7A 1Z6AA 1P6XA 3KVOA 3GRZA 3OETA 5HDQA 5K4GA 3U09A 4QQRA 4INAA 1VLQA 5EIBC 3HHEA 3AHIA 5EP2A 3BTSA 3JXEA 3FFXA 4RMIA 4ZHQB 5AVTA 4RULA 2WMDA 1QZTA 1Q0PA 1HGXA 4KUGA 1GGVA 3AIIA 5F12A 2B4QA 2I91A 5H02A 4GMHA 3ON5A 4QT4A 2QW1A 5BR4A 3FCYA 4MMXB 4PSAA 4YYEA 3M8KA 4AP5A 3EDRA 1E7WA 2WIJA 4E03A 3NIWA 5JHGB 1ABEA 3ABZA 1KH2A 3M70A 5IVKA 3FAZA 4DSNA 3GUCA 8OHMA 2XB4A 4NNOA 2FEKA 2QRVA 3N2NA 3NHBA 4IFEA 2VT2A 1ZXXA 5BWOA 1OH6A 4F60A 3HRKA 3K70C 1FU8A 1YB1A 1RMTA 3OPQA 5KEIA 1QTRA 1F2VA 3PWSA 1H4VB 2YN4A 2H2AA 3HBMA 3QA3E 3MPOA 4TV9A 5HFNA 2QYOA 4TKLA 4K46A 2EFJA 2WIAA 5LBTA 4DAEA 4DXHA 2IH2A 4CM8B 1ZD9A 1Z2PX 1C29B 3FHOA 3C39A 1X2BA 4NK5A 4I9NA 3R76A 1KXJA 1MJHA 2FH5B 4GPBA 3TL6A 1P44A 2BBSA 2GD6A 5I45A 1D1SA 3ACCA 3NIBA 1OAOA 2NXEA 2EW1A 2I7VA 4X66B 2VKTA 3WL5A 4EG4A 4BGVA 4WCFC 1XQ1A 5H83A 4ZHSA 2PSSA 4FDVA 2IDKA 1RKQA 2FKNA 4HB2A 4I4IA 5IXYA 3I2JA 1P2UA 1OH7A 4DUGD 3DLCA 3KSRA 4HAUA 1XQVA 3F5FA 3H83A 3MJEA 4JQOA 2Y1CA 3L4EA 2ID9A 3F49S 4OM7A 5CT6A 4E4YA 4UEOA 3FH0A 5EI5A 2VYFA 4WBNF 4TRMA 3GMTA 5IK2A 2BGUA 1V37A 5CD9A 3GFPA 4HH0A 1VBMA 4J43A 1U7DA 4OLJA 1KYWA 2L82A 3DWIA 3M6AA 3Q7QA 4G1VA 1PJTA 4YJ3A 3GJ4A 4ZRNA 4XSGA 5EWMA 4YONB 4AUEA 3BRCA 4E1BA 1I01A 2WG2A 3V4RA 3SF8B 1A4UA 1H0HA 4ARZA 2V9ZA 2COKA 2WJZB 3EULA 4LC9A 4MS3B 4MWGA 1W2HA 4U2DA 3ZR4B 4W1RA 1RZUA 2EL9A 5J23A 1TFRA 3PITA 3A6ZA 4RV9A 3ESZA 1PWEA 1VI2A 1N75A 2DWQA 1U1GA 4KO3S 4GYYA 4LBZA 4GBJA 2EHDA 2BLNA 4KNVA 5EIAA 4CKWA 1C2YA 4G0VA 2Y0EA 4UBLA 3SBDA 1K92A 2FRXA 5BV2P 1OLSB 4GRIA 3EXG2 1ANKA 1VPTA 5IT9A 3KYDB 4GC5A 3LSTA 3E84A 1KMHA 5C8XA 2EU8A 2VRCA 2XUZA 3GHYA 4OHZA 3TZEA 3U37A 3KC2A 5BV8A 1GCOA 1U2GA 3LBAA 4C7JA 3VNAA 3FUWA 3L93A 1S3FA 5JO9A 4IVQA 4UTPA 4WRRA 2QTWB 3A3KA 2RHRA 3CW9A 1X8XA 2E5FA 2RK3A 1GR1A 2Z2JA 3ZKWA 3GGSA 4C07A 5JI2E 1VPWA 1A8QA 1F4LA 4L3VA 4LE1A 4ENPA 4RK6A 5FKJA 3W8FA 4EYGA 2FJ0A 3O31A 1M5UA 1JQBA 1B0ZA 1SXJE 1XRNA 4L51A 3AM1A 1CRLA 2V96A 4H4EA 4KV7A 3AUUA 2CJPA 4QUJA 2C9OA 5FR1A 1P9RA 2GYWA 2ZUWA 2O0MA 4O2AA 1YS2X 5CB6A 5JD6A 3SJ7A 1YBMA 4I9HA 1JEJA 4MUJA 1G7TA 2VO1A 2ZVPX 3KYDA 4P7GA 3WJAA 1K6EA 4EZEA 3COWA 2AIRA 3QSGA 5L3QB 1K8QA 1XT6A 2JGFA 3B13B 4CDMA 1KYQA 3ENKA 1F51E 1DAKA 2OBBA 2PWPA 2ZE8A 4G86A 4L28A 3H3FA 4BNYA 4ENRA 5LQAA 2QHXA 4CM9A 4ILKA 4RU1A 3C8UA 5JFOA 1XAGA 2ZJ3A 4NS4A 4R2JA 1ZNYA 1YRLA 3ZY4A 4CLEA 2ZETA 2I4NA 2Q5JA 3PFIA 1IZ9A 3KXKA 2YIDA 1Q7CA 3GQBB 2CUTA 1V95A 4H1TA 2V6FA 4H7FA 4YUVA 3THYA 1LUAA 2RJNA 1PFUA 3B6IA 3BAZA 4B3HA 4F45A 2JGRA 5CB4F 3R5XA 1L2TA 2HQRA 2AXEA 4NPHA 3FLEA 3WMFA 5JO0A 5EYPB 4UE2A 4D3ZA 4MUXA 1O2DA 2I6QA 1KPIA 4GKVA 5B1EA 5FLXA 2FW1A 4YXWD 2XNKA 1N4DA 1VZ3A 3O4VA 2AOXA 3Q5DA 4JKYA 3QWAA 4U9UA 2IIBA 4B32A 4ZVQA 3QU7A 3GJ6A 3C4QA 1G6Q1 3ESCA 3K0EA 5DWVA 3ZCXA 3ZV6A 1DQZA 2VN8A 4R1MA 1S8AA 1SO8A 2VJMA 4H31A 4BQNA 4EQ6B 2I54A 3CF0A 2XA1A 3LNTA 2QS9A 3L8MA 4J90A 2A5GA 4X61A 3UICA 3W2EA 4COOA 3AP2A 2HHLA 5CEFA 3T3PB 1CJBA 2QRLA 3VZQA 1H4SA 2VYCA 3STYA 1H0RA 3QPBA 1MORA 5L4SA 3GGOA 1LS6A 3VBEA 4D4LA 2UVPA 1V48A 2BF4A 2W0MA 3ENQA 3LKVA 3OJEA 3T0GA 3DTVB 2GNPA 4WACA 1XVUA 1AA9A 3K0KA 1JEYB 3TINA 1ITZA 4HMPA 3VR4A 1XRRA 2BHSA 2X7XA 3GJ5A 3AM5A 3E03A 3HI6A 3LUAA 2CLCX 1CF2O 1JA0A 2GM3A 2J3MA 1SQ5A 2QVBA 4K88A 4QPCA 3QLTA 1EEHA 1CXZA 1BW9B 1GGNA 2G9VA 5CK5A 3IIKA 4YT5A 2CV2A 2OZKA 1TZ2A 1HTBA 1Y1LA 1N6PA 2L69A 5EG5A 3I12A 4M49A 5G0VA 5U4QA 1NXXA 1F4PA 1GDDA 5JD3A 1NE2A 3EASA 2UZ0A 3D0KA 9GPBA 1Q7BA 3WLNA 1Y8AA 4FGSA 2C4MA 3B9QA 3OQVA 3QHPA 4M0CA 2QQGA 5HRCA 2D6FA 3IUQA 2AXQA 4PG6A 3G0BA 4CMKA 5BWCA 3X3HA 2VPWA 4CQMA 4EATA 4UNIA 2WC1A 1MJ5A 1YDHA 3F2IA 4HO1X 3EC7A 1KEEA 1GPUA 1EG2A 2YJ5A 3ILHA 3VR1A 5IT4A 3EGOA 3GGCA 1AZLA 4YPVA 4NHOA 3I32A 1OV4A 4QDJA 3RPEA 4E2XA 3NHUA 1M9NA 4R8SA 3UCXA 5JQGF 1WOYA 2P41A 4XR4A 4RAOA 1QPBA 2ADFA 3GRRA 1II9A 4Q1EA 3CEAA 4L76A 4E5SA 4ZZIA 3ZOKA 4MUGA 1P6QA 1RYZA 1T5IA 2E6UX 4E6EA 2A8YA 1ABBA 4DR3B 1UBNA 1EFTA 4JEHA 3THWA 3WIBA 1QP4A 1FLAA 3U4IA 1ZMRA 2HLDD 4A16A 5DNUA 3COPA 1EDZA 2VBIA 4RF5A 1UZUA 3SHFA 3VO1A 5L95A 4BWFB 1U02A 2XNDD 1L5ZA 1X15A 2IIVA 3AEUB 1J42A 3BE4A 2GHIA 4H7IA 5T4FA 3SSOA 3JWHA 2H3HA 4A0QA 2V5AA 3K2BA 1OAOC 1P9OA 4IS3A 2RHWA 4DNFA 1GZSA 3VYTB 1UUFA 4TTJA 2PXHA 3G1WA 1I7PA 2V4MA 1UEIA 3GGDA 4ZO7A 3S1LA 4BUCA 2W43A 1XDBA 4JLAA 1ZCZA 1N7IA 4EQZA 1XEXA 2JGNA 3K1YA 4XUEA 1M34B 2DSNA 3FLBA 1NJ6A 4GVLA 4DN6A 4M86A 5BW4A 1I4OA 1DLJA 1Q1BA 1LVGA 2X9NA 2AN5A 2QB5A 1ZHOA 4MJLA 5DNWA 4A92A 3NTUA 2OCYC 5DM2A 3UHJA 1B16A 2B7LA 3MT8A 3X1JA 3D2LA 1DEOA 1IB0A 3B2NA 3L79A 4XWAA 3EN0A 1D8TA 3CEPB 2UXDB 4IR7A 4B5LA 4RPHA 3THSA 3RKSA 4KMSA 5E3IA 4LUCA 2RHTA 3FTDA 3DVAA 1JHXA 1YF3A 4PZLA 1GUBA 3ZE8A 1GNSA 3I37X 4X92A 4YRAA 5I9LA 1PUXA 2O5RA 3IO3A 3ZTYA 2VFAA 4KI7A 3EIWA 3WWEA 4DMKA 1D6SA 4HWGA 5CT5A 1M2NA 4D9GA 5REQB 1MV8A 3RLFA 1Y81A 1PLLA 3F47A 2C5LA 3AB8A 1ZWLA 2WAAA 2Q3HA 4MTCA 1RIIA 2HO4A 4HLUA 4QARA 3RNOA 3W4JA 3WOVA 3DL4A 1YUBA 3WNQA 1R0BA 3JQFC 2FPMA 1XLWA 3W7BA 1WBJB 1Z28A 2O3TA 3BIJA 3EEIA 3G7UA 4GECA 1RWVA 4PSKA 3PC6A 4GP9A 3BRQA 3N1UA 4LTDA 2JLCA 3VSAA 1B23P 2Q8PA 3OY2A 5LQDA 4C7VA 3SWWA 4J1TC 1Q0TA 2P5UA 4CLXA 2JBAB 1D6NA 1VHWA 3OUTA 2PZAA 4OI2A 1OFVA 1JXMA 1UZAA 3GLQA 1AH2A 1R4NB 1ZL2A 2NN3C 1USVA 3IR5A 2GF9A 2AHOA 1BJTA 3KJNA 4M8SA 3LYAA 4RXUA 3W3AH 4EFMA 1C3EA 4UEQA 4X20A 2H00A 2XLBA 1XHFA 3DZ8A 3H0CA 4K86A 4NARA 5KAMA 1R74A 1U28C 2G5TA 1FNCA 3L7MA 2FPGA 4FI3C 1GSOA 4PCUA 5FTNA 3GUUA 2XE4A 4G9GA 4GI1A 2PLAA 5EE1A 3EY9A 3JQAD 1ZQ1A 4JI2B 1NFRA 2WPDA 4WNAB 4ZV7A 2W48A 2QE6A 1OLUB 2NYUA 2GKOA 3B1FA 4RKYA 4KQFA 1A27A 4R8LA 4YQEA 5C7YA 2OO5A 5AVUA 3I92A 2R85A 4FXPA 5B7QA 2FE1A 1IHYA 3HKBB 4WADA 4ECEA 2C2ZA 2CB0A 4DWOA 4URVR 3UYLA 3L4JA 4JYBA 1N6NA 2RI0A 1KARA 2FUG6 5CM9C 4EABA 2DHEA 1QGYA 2HU7A 1T6YA 4GKAA 4OHRA 4YAIA 1G8FA 1C8VB 1VYVA 2JI7A 3HJTA 3U3RA 2GPJA 1Z13A 2X5OA 3L8CA 4WLEA 4YP5A 1V4BA 2EJUA 3UNXA 4N49A 3G0OA 4YIKA 5BQ3A 2NO0A 1O89A 2RJOA 2QQFA 1W5EA 3VNSA 2O2DA 2PQMA 2ZRMA 2V97A 3BA6A 4ZO9A 5FUVA 4P93A 3RVDA 3SY8A 3ZVLA 1HYQA 3WAJA 1M2HA 3WGYA 2W98A 2QNRA 4JNCA 3H87A 4DARA 3O82A 2HJSA 4ABYA 3SN6A 2ZR8A 1E59A 4BNIA 1CIJA 5I7FA 3T5AA 4OQZA 2FEOA 1RPNA 2YIVX 2XMRA 1RADA 3DV0A 2HQBA 5IP5A 4PM4A 3CZ9A 5FBHA 2C9CA 1EGMB 4S2EA 3P4UA 3EXIA 3B1ZA 4EF6A 3SR3A 4BO5A 4FIDA 3K5PA 3E7XA 2XW6A 1J4AA 1SVIA 4NYIQ 1HEIA 3GARA 1JZQA 5HDBB 3N8DA 1JAIA 3ORQA 3U1VA 3VR4D 4TYWA 2JH9A 3WC4A 3LP8A 3W2IA 4IXDA 4CKCB 3O95A 3O3OB 1QH1B 2VUIB 5ADUS 1UKVY 2CT8A 1GUYA 3MINA 4R2XA 2OCBA 4R2LA 3WBKA 2FAXA 4JY7A 5A1TA 4J76A 4RZ3A 2WMYA 1ZD4A 3C2QA 5LD2B 1NATA 2O8NA 1YH3A 3AI7A 4L5AA 1F20A 3G2JA 3K70B 1IY9A 1CEQA 4Q19A 3UHPA 3VR0A 4BE4A 1T2VA 1ZGZA 2NTVA 4KHZA 2JZNA 2H4JA 4KIFA 3VR6D 2Q9AA 2ZS8A 3CKLA 3GYGA 4TZTA 4HGRA 4DIMA 4E2ZA 4F71A 4DR2B 1F38A 3MCWA 4Y8VA 3RSFA 4UJ5A 1VKNA 1T8RA 3LLSA 3Q5EA 4MVJP 2Z2IA 1G8AA 3EJWA 4D0RA 4DL9A 1ZD2P 4ZV9A 3RFCA 3FJOA 3PK0A 4MV8A 4JSYA 3WRWA 4YCMA 2V7BA 3G0DA 3IQHX 2XCIA 4HQFA 1KQPA 1QGOA 2AVDA 4LRWA 5KHAA 4Q7MB 4DIUA 4Z51A 2GEVA 3AY6A 3EB9A 4QUBA 1T6NA 4HEHA 5EEGA 2D1QA 5EKTA 5BN3B 3LCCA 3DAGA 2NU9B 2P1DA 2MWMA 4G37A 4MIEA 4YRMA 4ANFA 3VHXB 4YUZA 5FI5A 3RI3A 5ALZA 3B9BA 1AHNA 1W4RA 3WDSA 1DQPA 4R71A 1UOPA 4JOBA 5FBRB 1FS4A 3Q87B 1TQHA 1EAYA 1ZGCA 1ZVJA 2Q4RA 2QDXA 5HIKA 4MYDA 4Q6BA 3M49A 4EX7A 2P9QA 2SBTA 2VAVA 5I3CA 1I5RA 1ZM3A 4KODA 4NSNA 4WA8A 4TV8B 2QRMA 5DULA 4F6LA 5IWCA 3LD9A 1LFAA 1ZMTA 4B5KA 4MUBA 5EKUA 2QRJA 2JHAA 2Z5GA 3Q7RA 4WZZA 4LDJA 5KBYA 2W2QA 2HJHA 4AZ0A 3AJDA 1YA8A 1JZSA 3NCTA 4K81B 4EG5A 1NTOA 3FUTA 1T1GA 4J0KA 1FRFS 3HRIA 4NG4A 4NJMB 1NKVA 3ONWA 4HXYA 2CNNA 1T6XA 2YVLA 5CVJA 1ZGHA 3ZWDA 1UBRS 1Z0AA 4D25A 3IQXA 2UZAA 2QN1A 1GKYA 1EGVB 1N3BA 5KHLB 4LWQA 5KC8A 2OK7A 3W1EA 1WNFA 1WB6A 2I3DA 2A67A 4XPIA 3CNBA 5CJJA 1XIVA 1Z75A 4ZC1A 5L6LB 3J80A 1CQXA 3DVRX 3LBFA 4ENWA 3E4DA 3ETGA 4HVTA 1Y4AE 2DE0X 2G4LA 1FW8A 2ZRFA 2AT1A 3NBFA 4X64B 4C3VA 1Q0HA 2VH5R 3DBOB 2P9HA 2R2AA 3FF4A 1JLLB 1OUMA 1EK1A 3LYUA 1NNEA 1U3GA 1ZK4A 3MWLA 3FCXA 3SBOA 4LKOA 3FCOA 3RW9A 4E46A 1KI2A 1CS0A 3ZCPA 3DOFA 2M32A 2DWUA 4R3UC 5HUJA 1U2SA 3AETA 3INGA 4MUHA 1QF9A 4UPDA 5COQA 4IF6A 1HXHA 3WLOA 2W7TA 1XXHA 4BFYA 3VR2A 4IMRA 4FR0A 2VNAA 4HNHA 4DQKA 1VOTA 1GEGA 1EVYA 1UC8A 4OQNA 2CNOA 4ND1A 3PXGA 3G0HA 2C2OA 3CR7A 3GCWA 1KAHA 4I0WB 4JQZA 3GJ7A 4LISA 4QRIA 3IOEA 3GLGA 1PNRA 5MDHA 1RYBA 4QPNA 3RHSA 3JYHA 2OCIA 2BR3A 3BDIA 1U28A 4DUYB 2X0DA 5EJ6A 5M04A 2A7XA 2PKRA 1RWPA 2IXTA 2QTCA 2V8BA 2XIQA 4QD3A 1U65A 3R5TA 3ANXA 1JDSA 4RPJA 1L4MA 4MKRA 3PPXA 4HTFB 2OR3A 4PYRA 1TUEA 2PWAA 2F67A 2P6OA 3VKVA 2PJUA 1XZPA 3AQIA 3LXXA 4KQ1A 3NBAA 1Y7PA 2YV4A 2OO5C 2ZFUA 5B1SA 5I4BA 4F4DA 5DZSA 2O2EA 4M55A 4CEHB 3OZXA 1Q11A 2G5PA 3RC1A 4RJKA 4ND4A 3ZE9A 3DW3X 4MWBA 5KREA 1E9AA 1DX9A 3BX1A 1CHDA 3DZIA 3RUEA 2F9FA 5FPKA 2V7XA 1X42A 5TVKA 5CVCA 4BB0A 4E70A 3D6JA 2JA2A 4YJDA 3U7QA 1YL7A 1I2DA 1SU7A 5LP6A 4BPBA 4HNUA 3L0YA 5GQSA 4GICA 2AUTA 2PX8A 1VLHA 1BCSB 3HU2A 2E4AA 4RK4A 3L4KA 3ZCRA 1Z4NA 3HCOA 2RCNA 6AT1A 4NCBA 4OGKA 3LFHA 4OJMX 3FWHA 1OYYA 3AHGA 4PONA 3TTUA 5AD1A 1U7WA 2IZZA 2YICA 4K9RA 2JG3A 4CF4A 4JVOA 1VZ2A 1XZGA 1LPBB 3ZY5A 1UIMA 2H6EA 4FE3A 2VZ0A 1KETA 3GJYA 1QF6A 3MXOA 3IVXA 4EFNA 2CJYA 3L0SA 5EWJB 4V1CB 5ECDA 2Q7XA 3FPAA 1L8LA 2CVFA 1WUKS 4WBNA 1IXSB 3K2QA 2AFIE 5I47A 3UJCA 3UW3A 1LJUA 3MJ4A 1K2VN 3PL1A 2RHGB 3UENA 3R9KA 1WMDA 1J25A 4IX9A 3OT5A 4RANA 3T52A 1GPMA 1UDXA 1TC1A 2DQ4A 3GVPA 4P98A 1I4TD 1YI0A 3EG5A 3O2JA 2QM8A 3TIIA 5JV5A 4ENSA 3IX7A 1W8IA 3FPEA 5C7OO 4XB1A 4DA9A 1KIFA 1QLWA 1QZ3A 2ODWA 3BBLA 4H9GA 4OAQA 5CITA 4QLAA 1EYZA 5EUBA 3AEQA 1ZH8A 3RVPA 2OPBA 4D4GA 1T1JA 3MILA 3VZBA 2OGTA 2VTVA 2XVYA 4MX8A 4OHVA 4F85A 1XZ8A 5KTOA 2JFZA 1UPUA 2XGMA 5HRAA 4I6EA 1DFIA 5K1ZA 4QRHA 3GLUA 2HH9A 4D96A 2VF2A 2GLXA 1K8YB 3LVFO 3OX2A 3PXCX 2ZCUA 4OHUA 3UC9A 2H5JA 1JQLB 1FDOA 2PYZA 2QX6A 3P2OA 2ORWA 5BSEA 5TF0A 1YQUA 2FMHA 3CWQA 1QMGA 3K0SA 1L3CA 5C35A 2JFFA 3T7AA 4BX2A 1M2VA 1D2EA 2VWPA 2QDKA 3TS1A 1U1IA 2F17A 1TFUA 4HWOA 2EDAA 3MAJA 1XDDA 1M2VB 3OEHD 3QI7A 1DAFA 1T9BA 1F2DA 3A28A 1E4EB 1UXHA 5CA0B 3NHMA 5G41A 8GPBA 2Q2OA 1G2PA 2O0JA 4WXPA 5PGMA 1II0A 2VIIA 3FGNA 2X7JA 3JZMA 5B57C 3KPYA 3OCJA 4LOAA 3B6JA 2R47A 1XF9A 4TV9F 5IAGA 4AJLA 3HN2A 5JUWA 5TQVA 2LRHA 3DNFA 1BD3A 1U0FA 2IXDA 2VA9A 4BU0A 3TQIA 1ICIA 1AOXA 3ANLA 1DZ3A 1PSDA 1CERA 4RL6A 1M67A 4W5HA 1NQTA 4FYWA 4NL4H 4QYIA 3ZU2A 4DKXA 2XOEA 3FTEA 2OY0A 4ZVRA 4JN6B 3COSA 3R5FA 4MP8A 2Y92A 3OM0A 4XJSA 4F86A 1YI1A 5BR7A 1JH9A 4KK4A 3ZHOA 4U7PB 3JPYA 3BN3A 5EMLA 5ABPA 4TLAA 1CUFA 1XQXA 1ZG3A 2HGZA 3MTJA 5CIWA 2HMWA 3AR3A 3A4IA 5DXFA 1KAOA 1KTIA 1DRKA 2X0KA 1E7YA 1Y6JA 3O9MA 3PNBA 4NZOA 1QAOA 1OA0A 3KHKA 1ZISA 4ZFNA 2BGGA 5AXAA 3KT8A 3K4QA 2ZUUA 3QEKA 4G85A 1ZSVA 4MZDA 2F43B 3NDIA 5EJ5A 4R7TA 1AF7A 1SUIA 1RHMA 4UFNA 2AMJA 4C7OB 2LDXA 4PICA 3NASA 1J22A 2C3UA 2BGLA 2Q0HA 2P67A 4M1MA 2LD4A 2R97A 2BMJA 3EQ8A 2Q7OE 1I0IA 2BMEA 3GUZA 3ZGXA 4EGAA 3LGXA 3NHAA 4NBTA 4X65B 5GGYA 5FQOA 3D4IA 4BP1A 2ZBDA 4XWGA 5JS1A 2PWZA 2BR4A 3GLRA 4LN1A 5ITWA 2ZXEA 1W85B 2PUJA 4K2AA 4DG9A 2FZ4A 1SCUB 4N39A 3PEVA 5GONB 3UEOA 5HZMA 3JVDA 1BWQA 5IAEA 4Q4DA 3W6PA 4NOKA 3DG9A 3S8MA 2I2AA 3DW1X 1IZ8A 3OZEA 1D4OA 4GMFA 3F67A 1JDTA 2QQ5A 2RH5A 5DRTA 3GP8A 4DANA 3SG0A 2G04A 1GZ5A 4KH1A 2H7VA 3I5YA 1IU9A 1KI4A 3PA8A 4AJJA 4N40A 3JZIA 4JI1B 1FFYA 3KOXA 1Q21A 2G4VA 3CNLA 4X24A 1XMXA 3RASA 4C43A 3HCPA 4A8HA 3C87A 3E1SA 2FPIA 4E5MA 2PUCA 2HDNB 5JBQA 1IRIA 2BFBB 4GEKA 2QUKA 1G6KA 1P5ZB 2XGGA 3EFOA 3JQAB 3SZUA 4U9IS 2LXNA 4NESA 4ODIA 3AF4A 5DI3B 1E69A 3OEEA 4GLLA 5EJ2A 3KUXA 4BNLA 1A9ZA 2MSEB 3NDJA 3P4YA 2R3SA 4MI6A 5AQ1A 2YFHA 2QTAA 1Z74A 3ND8A 4LSZA 2Z3ZA 3JD1A 4YDHB 4JIMA 1FMFA 2J8ZA 1Y4ZA 3DFIA 4QL3A 5I7AA 4JJGA 5U1PA 3ZNQA 4BFSA 4XIJA 5C4GB 2XCLA 3NFRA 1HK7A 3BMOA 4KLNA 1TEVA 4MW7A 4FCCA 4C6HA 1DIBA 4YMHA 3QYPA 2AV6A 2OK8A 4MH0R 1VMEA 5CXXA 5IKMA 5H4HA 1G7RA 3D7NA 1H8EA 1SWVA 4KDCA 4RIGA 5KSPA 3UWMA 4WGGA 4DCJA 2B2XA 1ZIXA 2R6GA 3TW8A 4IJ6A 4P08A 4AY2A 1WHTB 1GZ6A 3U1BA 5DLDA 1FU7A 1DAIA 2XR1A 2QRVB 4OCZA 3HUDA 1M7HA 5IZCA 1PS0A 4ZCTA 4MPJA 1RPTA 1AK1A 4YBZA 2GXUA 2R62A 3BFKA 2V7WA 3AW9A 2Z8ZA 5H3HA 4BNFA 4PLWA 2CCKA 4QQNA 2G08A 1KK3A 2JIPA 2YXPX 4WLVA 3F71A 4WBNB 3DZBA 4E2WA 1E1RA 1E1RD 3UMCA 1W1UA 5EHGA 3M5CA 2B4KA 5MGBA 4B3MB 1T3HA 2H1FA 5IEBA 2X0JA 2V8OA 3E3LA 3IAM6 2PMDA 3VVBA 4IOLA 5IVIA 1EFHA 4L75A 3PRYA 3SQXA 4NPAA 1PUJA 5ALJA 4QODA 3BQNB 3UMSA 3KOOA 3MAGA 2HU5A 1C9JA 4PAOA 4F6CA 3OQPA 4OLAA 4A3SA 1XPJA 2LNDA 4RY9A 4B6GA 2DHRA 4B43A 1JBQA 1BFDA 3Q8WA 5H5JA 4LF8B 3UPDA 3GLGE 3WL8A 1EXWA 2GI4A 4CYMA 2V4ZA 1U0SY 2WV9A 3GRFA 4KWCA 5KQMA 3ZCVA 3QSYA 1U2EA 1IOWA 2HK7A 1G42A 2GEUA 4QREA 3QG5A 2WZDA 2VHCA 2CUKA 3D5QA 3H6KA 4E1AA 4NQZA 1RKXA 3N6RA 4EUFA 3DSRA 2CXSA 4FHGA 5LN1A 1HDYA 3MOIA 1TOAA 4L8YA 5IMSA 4CN9A 5CA1A 4RMGA 3TMKA 1N8SA 1SUDA 4U8HA 2PKEA 2WKQA 3GLKA 1E2BA 3QQ5A 4POOA 3DXFA 3DJYA 3F9RA 3KALA 2C1XA 1P9NA 2JKVA 4LWOA 4YT8A 5IJ9B 1XA4A 3KJQA 2BDTA 2XQGA 3DZDA 4H7JA 4D4IA 4GWKA 3HJFA 1BVUA 2D5LA 2G40A 1BJRE 3WMRA 5JS2A 1Z6ZA 2Y1GA 3FFWA 3PTLA 4Y9SA 1DBQA 1JAXA 1YZ3A 4ZYUA 4MDEA 3LS2A 2IITA 2X9QA 1L4FA 3QX3A 1THTA 4CI9A 1UMKA 2QD5A 2QLLA 3SP1A 1TIPA 3HWWA 4D9NA 2NAFA 1IUOA 1WNTA 1XMVA 3ETDA 4FEGA 2OV1A 4TTRA 1EA7A 3EGIA 4OGGA 2ID7A 5G3YA 4N4AA 4DF3A 5HP4A 3RYIB 4Y18A 1PQWA 2BFCA 2VCEA 4X8OA 3N2IA 2YS7A 4JODA 4A8JA 3NAGA 2D1YA 2IYAA 2BKUA 4B79A 5BSKA 3WFJA 1K88A 5HOQA 3R4VA 4A03A 121PA 3KZKA 4BP3A 4OA5A 5EZ6B 1N25A 2DHCA 3CO0S 4B17A 5BSMA 1G9XA 5E1DA 3A0RB 2ZIXA 1D4ZA 5KQRA 2Y1LA 2FQ1A 1AN9A 3ZHCA 2Q3EA 4NCNA 3RYHA 2AOTA 4MQEB 1E6KA 2YCLA 2ZSIA 2VXCA 3AVOA 3GP3A 4JUFA 4X84A 3PUXA 3ZYZA 5HTOA 1H5QA 1RJWA 3Q2KA 4OFZA 4ABTA 1S2DA 4X8HA 1DV1A 4GYKA 4PZCA 1IY0A 4XWOA 1B6GA 3CTMA 4R0VA 1MUUA 5TV2A 2R84A 4R7ZA 4BVJA 1RE0A 3U4QA 5LU8A 4R6XA 4U7HA 1G17A 3PNLA 3JQPA 1BRTA 1Z4KA 4WNAA 4ML3A 4MB2A 5AM0A 3ZK9A 4KQMA 2OHHA 1QPZA 1VMKA 1CTQA 3EISA 4QYMA 2HLNA 1QQ6A 5IM4F 1ESDA 5JFGA 1IM8A 1XJ0A 2XQKA 3AETB 4TMXA 4KAAA 3ZWVA 4AICA 4B2YA 1CRPA 4GX2A 3SSMA 4BPRA 2RKOA 1YVUA 4YTEA 1WRBA 2EGUA 3UOWA 1H3EA 2BRUC 2QP4A 1U2TA 4DA7A 1XRMA 2QX8A 4DE5A 1I94B 2XBLA 1JHPA 4QXMA 2POQX 3BSFA 3TQOA 2ZU0C 1QH8B 1BYIA 1QIJA 1NN1A 3SXUA 4P7JA 5J1SB 1X7ZA 4OK6A 4ZA2A 1R8XA 3ZUPA 2WSSA 4S1OA 1OI7A 5I8ZA 3AVXA 1F0NA 1A9YA 4N3AA 2R8EA 4J49A 3UFXA 5JJLA 3VKGA 3H0EA 2Q29A 3A27A 4DLBA 5KOJA 2JAUA 3NATA 4WSOA 3BTUA 2EZ8A 2W70A 1DRVA 1IN5A 2I1LA 3A6KA 3C6QA 1VHLA 1Q74A 3CJRA 4B87A 2FHPA 5LOVA 4GHWA 4R2IA 1T5TA 4DIFA 3A36A 4OB6A 2CYBA 1MH1A 1E0DA 1TE2A 1P62B 5DCWA 1OGYA 2WJ4A 2CVPA 4ES6A 4TLEA 2O0KA 2YVAA 4DY4A 1KEZA 4F5EA 1V5WA 3PIDA 3V3TA 3O03A 2LR0A 4Z4QA 5H16A 4E94A 4RTLA 4FUTA 3KZ1E 1LWNA 2P4EA 1PJAA 1W4LA 4IXMA 4WZAB 3RC7A 3KKZA 3CFYA 1QYXA 1I7LA 4WEQA 3OKFA 2WP0A 3OJLA 3BJMA 4AJKA 1Z38A 4Y2GA 1PLJA 3SDBA 3ZKAA 2AX4A 1Z2EA 4NR0A 4A6XA 1QB7A 1EUCB 1J00A 4C5CA 4QM6A 1CRQA 2J0VA 2JBAA 2ZJFA 4KAFA 3FOEC 2VWGA 3N6VA 4PX2A 2J9GA 4M0EA 4WDRA 4KYUA 2AW3A 4XGIA 1F2TA 5BN3A 1KS9A 5CDFE 1SZCA 4KJXA 3NX4A 4HOYA 3EFBA 2PUDA 5CGQB 3QVKA 3N76A 5ALNA 4A6DA 4N5MA 4BMZA 4QHYA 4RACA 4CG0A 1TF5A 1RQXA 3U19A 4QICA 2J9YB 3TZKA 1YCDA 1C7IA 4EHKA 1WIWA 1U1CA 2H1WA 2I2XB 3B1YA 4M0PA 1J8VA 4O5AA 4TV8F 1Y5RA 1S7GA 1WXWA 3ZE1B 2O2JA 2UV8A 1SCNE 1Y3CE 3DNPA 2M1XA 4MPRA 3L7NA 1FVHA 2JIMA 4YQZA 1XMSA 3EJ6A 4J0DA 4D6XA 2QX4A 2VK1A 2VZEA 2R79A 4HWPA 4N8DA 3KSZO 5K3CA 2QI9F 3EUWA 4HEA1 3CMCO 4NAUA 1MGOA 4H0NA 4KMRA 2IQ5A 4MRVA 3WLFA 1NUQA 4TXHA 4DA8A 4GI2A 3V7UA 3MGAA 4LIPD 2EXXA 4GM4A 4FC6A 5BSUA 1T43A 3PQ2A 2VF4X 5FWNA 3VZRA 1G8KA 4GX5A 4YK7A 1AGRA 3MC1A 3KYJB 1O57A 4KSYA 2C7GA 2AMYA 1GZVA 3K0AB 5JT1A 1XTVA 1A5AB 5C9ZA 4EWLA 1C9YA 4LSMA 4ZXPA 4F97A 1KOGA 4HDOB 4KFUA 1MFPA 4MHOA 5HQJA 5M3BA 4KU4A 4MVJH 5AI0A 3GFFA 4D82A 1KYTA 1T0IA 1F2TB 2UYQA 3C8HA 2QY6A 1UPFA 3G6WA 3H2ZA 2I99A 3CTPA 1DFHA 3QFRA 4HFMA 3U6BA 2JDID 4GDFA 1YASA 3DMGA 3I1IA 4IICA 2I7XA 1EDEA 1TW3A 2VDNB 3VR5A 4YMTA 2O2IA 3B70A 1Q3KA 1N2CA 3H17A 4QBIA 2WJ6A 5LUBA 2VPIA 4P0PB 3MJTA 2AK3A 2KYRA 3B8EA 4IQ0A 1LI5A 4L4RA 1EJ0A 1USWA 3F5DA 1NWCA 2F00A 3EGEA 5FOWA 3KIPA 4BQRA 2ZQYA 4PSVA 3W04A 2CLDX 4NDNE 4ARSA 2WSSD 1QOQB 5LOVB 1WXIA 2JJ8A 3ZX4A 2FUKA 3ZNPA 1VB5A 2V7GA 3BAFA 4PYJA 4DJEC 2UZ4A 1Q57A 1V5EA 2NTJA 4LV8B 2P91A 1USUA 1KC3A 4BQFA 4L22A 4RH3A 4MZXA 2BZ0A 4N1AA 1UR5A 2R96A 3EARA 4LOKA 2IU0A 4E31A 1D03A 4O4IA 3PE4A 4Y7CA 4CQMB 3D59A 1BCRA 4ME6A 4ND7A 3VA7A 4HYYA 3OKCA 5K4AA 3C43A 1TCBA 3JQQA 1YJXA 3H1PA 3QFCA 2P3OA 1KZYC 1LA2A 3DNMA 2V7VA 4BO6A 4F2DA 4JX9A 1QORA 2J41A 5BNZA 5IF9A 1E4OA 1JMVA 1RWQA 2QSZA 1Z4LA 3OT4A 3B53X 2HTFA 2QRZA 3DZKA 1F0YA 2NVWA 3BD7A 4WZ6A 1YDGA 3A4LA 3RAFC 4UTXA 4I8IA 4X0EA 3N7UA 2VF5X 3KOWA 4FCWA 4R2MA 3ZWBA 5KS2A 1YXMA 4TWBA 4RLFA 3GAAA 1SXGA 5E6RB 2OTCA 1PK7A 4L2IB 4MI9A 1LNQA 5HS6A 1WZIA 3MGGA 3H9GA 2MMCA 2PSJA 1W88B 3P9NA 3RTBA 4C2AA 3DV2A 4WESA 4L85A 3GLHE 3OM8A 1H85A 4ZVTA 2O2ZA 3HP7A 5F5LA 5SYNA 2F3TA 3SEFA 5KNBH 2XCRB 3JYLA 1ZRHA 3M6UA 4PWYA 1VHTA 3D0OA 1FFAA 5DPMA 4BB9A 5HWSA 1S5PA 2UU9B 5HA5A 5EGSA 3T7IA 2ZWPA 2P0AA 4MW4A 3NWOA 4RZQA 5DNVA 2P2SA 4FT4A 2VP9A 2X3UA 4MVXA 2C7OA 3E2MA 1II8B 1SJ9A 1GZ4A 4U6NA 4ZHQF 3TOVA 4XIIA 1N7JA 4QUIA 2O7NA 2EF1A 3LUJA 2XXJA 3PD0A 2HSGA 4X6UA 5A06A 4F93B 1FNSA 3L04A 2TMKA 5LQMA 4P58A 5AUQA 5K8UA 2YJNA 2OD7A 4NBSA 3UV6A 4WKOA 3TD2A 3T3DA 2JARA 1LDYA 1GGJA 1JH8A 2HMTA 5GV7A 4BMNA 3BGSA 4MA0A 3D3NA 4GPEA 1V8DA 3JZAA 4EJ0A 3L02A 1PL0A 1N8TA 1XCOA 4JJ4A 2C59A 3H7AA 4LCJA 3I8SA 4KCGA 4LI0A 1X14A 4QOJA 5DGDA 3T4UA 4B4KA 1HEYA 4DEXA 4H17A 2PKXA 4TVSA 5ADWA 2C3OA 1O95A 3HVHA 1N6IA 4D4KA 5HJ7A 3THYB 2X5NA 3RU3A 5KYUA 5F7ZA 5JAPA 1AMUA 3I2HA 3FTNA 3NIGB 3QKTA 4WNYA 5HF5A 5ALKA 3P2YA 2ATXA 3PPIA 1JYEA 4MAAA 3GLFE 4WKCA 3ED1A 4MW5A 3D6VA 4F5DA 4BIIA 2CFSA 1E9CA 1KZHA 1GRRA 1KDRA 2WM3A 1OZGA 1Q0LA 4CQJA 2QPOA 4Z7OB 1BEUB 4H7PA 5H59A 2G76A 4Q34A 4WK0B 4ZT5A 3ZIUA 4AUKA 4D99A 3SZMA 1ZN9A 3VV2A 4XTCS 3KEFA 2W2OA 4JLKA 4CG3A 3ADPA 4TL9A 1R4AA 1ZN8A 2J07A 4D8VA 4YCLA 1M0EA 1IXRC 1A8PA 1JDVA 2FR0A 4MS4B 3C41J 4AK9A 2L18A 2XMPA 1T3SA 1NMSA 1KWGA 3OQIB 4XTRA 3FJYA 1Q0RA 4BV3A 3VC7A 1SH7A 1ZW1A 2Q4DA 2XXAA 4ZGGA 1T1RA 1MOSA 5EWMB 3F78A 1Z8DA 2C58A 2FRDA 3TUJC 5EHZA 2DPXA 2ONZA 4JUBA 2IYFA 3BHIA 2AFRA 2GFQA 3AK4A 3B3QA 4CF6A 1J20A 2XYGA 2GHTA 1E2HA 1Q77A 3PCXA 4FGKA 2AN3A 1P2TA 3N2ZB 3C85A 2A1IA 3EWAA 1T8SA 3CS3A 1ZK3A 1OE0A 1L5NA 1EM8B 2AYXA 2D1TA 3IHTA 3FOFC 1RRGA 2BUBA 1OLSA 1GUZA 1V11A 2AF3C 3NALA 5DM0A 1J2EA 5JOQA 5ALQA 4P81A 1M8JA 3ETJA 1ECGA 1XJWA 4TQ9A 3Q72A 3JR3A 2A9VA 3IBCA 2J5XA 2Q6VA 4PS0A 3FX2A 3L46A 3QYAA 4G0XA 4BP9A 1IZYA 1RJ9B 4XLZA 3WTBA 4U2EA 1AK2A 3OWHA 4RKQA 4EEKA 1W49A 5HW0A 3DEJA 5E2BA 1IPFA 3NP7A 1TU3A 3IJRA 4ZK6A 2X23A 3X0DA 1GILA 3GPIA 2OFPA 1RHQA 2NZ8A 4GSYA 2QIPA 3L5OA 5B1HA 2CYAA 3K6RA 1TO2E 1URPA 4PBTA 1RJFA 3EMKA 5AJTA 1RZRD 3CMMA 4HXGA 2PVPA 3Q3CA 5C5IA 4H27A 3GBVA 2ZRQA 4PX5A 4TVKA 5JVDB 3AY7A 3QTBA 4KDRA 4F72A 2PV0A 1XCBA 3JQGB 3OMWA 1DG3A 2R1TA 2XUPA 1GPKA 1QKJA 1EXNA 3AHDA 1LQTA 3R1IA 2BEWA 5A5FA 1HE2A 4AURA 3M1IA 3CLSC 3KB1A 4YRKA 1QS0B 3CVVA 4XB6B 3PT9A 2Z43A 1T5LA 2YNMC 3VR5D 3QVMA 3WNBA 3B3JA 5KVSA 2PKQP 3OP4A 4PPGA 1RQNA 3ER6A 2FB9A 3HL4A 4HAYA 2FPIB 1R8JA 3IQZA 4G2TA 1YGYA 3AESB 4BBAA 1HQYE 3EWIA 3PJGA 1P81A 1BAPA 2TECE 4KPEC 4DOMA 4YAEA 1FJXA 3RGGA 2EIXA 3RVKA 2HSJA 2XF2A 5JJIA 4LF5B 3TTSA 4IDBA 5CHEA 3MYRA 4F5ZA 1RAHA 2GCOB 4YV0A 1NU6A 3I34X 4MK4A 3T3EA 4BEJA 1QZZA 2PQ0A 4PNHA 4LW8A 4JMLA 4MICA 1A7KA 1ISGA 3FYHA 1U0LA 2Q5FA 1MOPA 2E49A 3K71B 1P2FA 2ZM6B 1YR2A 3SLRA 1GTSA 2RSLA 3ZUGA 1C8LA 4IIJF 1MXHA 4WA7A 3N28A 1MPXA 1PN3A 2YASA 4FFNA 521PA 5KPJA 3GMDA 3N5CA 3DMPA 1XNRB 3NZEA 1E9BA 3O47A 4L8VA 4F9EA 4ZAFA 4F04A 5KNDD 2P5SA 3P0JA 4AFNA 5ER6A 3A31A 4B3FX 2CF5A 3U4AA 4HWRA 4H7KA 4JHXA 3UJ8A 3T06B 3TI9A 2XF8A 3PZBA 3GROA 4OXXA 5EFZA 1Z2OX 1HLDA 1Z0KA 1SM4A 5CDUA 1UL1X 2AVNA 2H06A 1IZ0A 3A4VA 3UXMA 1SWWA 5EMJA 3HABA 1SIBE 4DMUB 1FDIA 3R6GA 3UK7A 1EQ2A 1SVNA 1DS6A 5TGDA 3IV6A 5AKYA 4XEUA 4D9IA 3ZLBA 2IP4A 1PIWA 4ZYXA 1HC7A 4MGIR 3WGJA 1NLUA 2D7DA 3LBYA 2MCFA 2PUBA 1AJEA 4Y6QA 1ZH4A 3SICE 1P4GA 2IHZA 3OQIA 1ZU4A 3CRNA 3CZ5A 4Q3LA 2W4IA 3DEFA 2JVKA 5H1YA 3VNBA 3HBJA 2EL7A 4R98A 3V4VB 3R7SA 3NLLA 5ER9A 5BWMA 2H4WA 2KX7A 4I4TF 4YS6A 1HQCA 1JSCA 4UW9A 1GU7A 4RK5A 3O26A 2IH4A 1NN0A 2IPAB 3QF4B 3PGMA 4BCBA 2XVMA 3ZBUA 3ZXYA 2ZI5A 4QQ8A 3VJRA 1MP0A 3FDXA 3TCXB 3SJBA 2HQ1A 1ZW6A 3KM0A 1W4ZA 1Q84A 4KE6A 4NZMA 5AOAA 4LYAA 3SZRA 2GVDC 2JHFA 1FDWA 1SELA 3G8BA 3V2IA 1SBNE 2VJNA 5BN5B 4Y2XA 1NLMA 1FRVA 1WUJS 5H9WA 3DOUA 3PTZA 2PIDA 2WFAA 3VYVA 3CY6A 3OE7A 4JZYA 5F23A 2EATA 2FFRA 4KYTA 3HXMA 2Q41A 2GF2A 2YYAA 4QU8A 3N7AA 2G1PA 5T41A 4R0MA 5AR1A 2V5VA 1IJEA 3GCDA 1CB7A 2MTBA 3DOEA 1HOXA 1FK8A 3R5JA 4B8ZA 1ODKA 4WK4B 2GCOA 2DU8A 3BB1A 3C4VA 3KEGA 4JMPA 4HG2A 3OE4A 4M99A 3IALA 421PA 3FETA 1P0MA 4GSLA 5HIIA 1KE2A 1RI5A 3LWNA 3B38A 1S9DA 5BRJA 2P77A 3LQRA 2OC9A 1JG4A 1HDOA 3N8NA 5AVJA 1L7PA 2FFJA 4XVCA 1FP2A 4UC0A 1CY2A 2Y0CA 3ANNA 1R9JA 2BUAA 2WM8A 3MB5A 1XE3A 3LF1A 3H3XA 5EE3A 5GJWC 5JMWA 2IUEA 1ZN7A 5K0LA 2C2MA 3ZHBA 4M8NE 4URHA 3TDMA 4RHCA 4TTAA 5E7IA 2G8LA 1ADGA 3P9PA 4L9SA 1N2GA 3II6X 4GE0A 4BRUA 1XJQA 2BOVA 4RTKA 4BZPA 3BSSA 4L2IA 4DEVA 2FOXA 3L7DA 3H99A 3U7EB 3WP0A 4AC9A 3CUYA 1QR6A 4BB6A 2SICE 3KT3A 5IFKA 5BMVB 4WOCA 2E7ZA 3MNFA 4GW3A 3HMQA 3UGKA 3IBFA 3ZBQA 4RM2A 2FLWA 3EZFA 3JSXA 4ND8A 4B84A 4C4OA 1E1YA 4J0QA 2BRUA 3HFSA 3KJHA 3OT1A 5BV7A 5F9FA 4UM5A 3P0IA 4LZWA 2J6BA 1DARA 1XK6A 1O94C 2WV7A 3TLEA 3SDZA 1JNYA 1Z0DA 1XYGA 3BK1A 2DFTA 3UCFA 1I3CA 5TMEA 3U3XA 5CW1A 3D2AA 4FJ0A 1X1RA 4WLOA 4LHYA 4B31A 5GMOA 5K8LA 1EK6A 2CK3A 4FFLA 6NULA 2I67A 4B4DA 1O4WA 2CLMB 3MJHA 3O4HA 2G4CA 3C7TA 2ZZNA 2XODA 1IG3A 3SF0A 1EMDA 3F1KA 5CT4A 2Y71A 1P2BA 3CQ9A 4MGKR 4CM7A 1DDGA 3R7DA 3CU5A 4H77A 1CF9A 4R3WA 4ESOA 4OXYA 1QHFA 4EHBA 4BX9A 3DYVA 3R9XA 1KK1A 1E61A 4CM6A 4UQPA 2JB9A 5A6SB 2NUPA 2DLCX 5JNSA 2N42A 3MCZA 2HJ9A 2C95A 4RGBA 2O8DB 2RK6A 2DUNA 1DJLA 1N2BA 3N70A 1MEJA 2DLDA 4IXTA 1WB4A 3QPCA 3F4LA 1OH8A 5LQRA 5KX5B 2Y05A 5D7BA 2I9PA 3DVSX 1V16B 4LFAB 4DUZB 4IVNA 4LTMA 1RAIA 5KVAA 1WHSA 3D1VA 2GBIA 2AR9A 3V8RA 5K8TA 5JCOA 3MGKA 2IS1A 3M6LA 2YTZA 1N0HA 3SS8A 3G02A 5EPEA 1PEKE 3OM9A 2JCYA 4L74A 4L5YA 1JLHA 1WR8A 2BFEB 5JHHB 2Z9BA 4K9SA 3FG9A 2C2KA 2FN7A 3BXEA 3H3JA 4CKCA 1R1DA 1Z6GA 4D42A 1TDJA 1RWNA 1ZRNA 4CXMA 3KQTA 1OY1A 2H2HA 1UOEA 4RVGA 5D1HA 3MINB 4HDRA 3FSEA 5IJXA 3NVDA 3HM9A 1LK7A 2IUSA 1I3KA 3CT4A 3SEZA 6LDHA 1WMAA 1G21A 3F98A 2W2XA 3IQGX 1IAQA 4YRFA 2DBVO 2Z5VA 5EQTA 2WWVD 5MFZA 3RAEC 4C21A 4DPMA 1NW4A 1IIBA 3QFHA 4GPTA 3PNSA 5ICCA 3GRPA 5IZ4A 4P82A 4LYFA 3BXFA 1W47A 2PLWA 2YMPA 4FINA 2YWCA 4G8DA 4HQRA 3WHKA 1ACMA 1MPTA 1ZOSA 2GZ2A 2HI0A 3MCAA 2GN9A 4R6WA 5AYVA 5K3AA 4YPOA 1XDGA 1YR6A 2GJSA 2ONJA 4HYEA 2I34A 1T34A 1T25A 1NUPA 4D4MA 5D5PA 3X1YA 3HB4X 3PE3A 5ERGB 5ECGC 1S9HA 1YV9A 3CF6R 3H1BA 3E4CA 2AUMA 4FDLA 4G24A 2Y77A 3FY4A 1U11A 5AQEA 3WJ1A 2AJ8A 2JI6A 2ZQ5A 3MSCA 4BBJA 4I66A 1KWKA 2AL7A 1QK5A 1XHEA 2B1RA 3OKPA 2RMKA 4AX8A 2G88A 1II8A 4FX5A 2FV8A 2GASA 2JLVA 4JGIA 2JAHA 4KGVA 3LLUA 2ADOA 1QK4A 1CQIB 1K68A 1QONA 3EXEA 3EEOA 4B7XA 3W8RA 5T4HA 5G53C 2YL2A 2GEBA 5MFPA 1G3RA 1QC5B 5DRYA 3V4OA 1Q1NA 1KO1A 5LA6A 4MHSA 4AG5A 4Q9KA 1OB2A 2Q2NA 1HO3A 1XRQA 4IH4A 5DOZA 4AZ0B 2XECA 1OLUA 2X58A 2YJ3A 1NDHA 4E5YA 1VIAA 1U31A 3VTZA 3ER9A 1GM5A 1K1EA 2EHJA 3ST7A 4V0LA 3HKEB 4ENUA 2Y1XA 3IFSA 1E1QA 3VZDA 2HB6A 4LKRA 5HMMA 4JEIA 2PRZA 2VK4A 2XWSA 3I2FA 2HN9A 3UAVA 4EA7A 3U7FB 2DM6A 1XDWA 5H81A 4QBGB 3A04A 1TCUA 1HE3A 1I14A 2E4WA 2O52A 4QOFA 2R6CA 3STUA 5DGCA 1UDAA 2VPTA 1QTQA 1XK7A 4UQLA 2PM8A 2XITA 4PZZA 2QRPA 1DX4A 4XYEA 4KPUA 2OBLA 1THZA 3JWEA 1U6JA 3T3IA 3R44A 4KDFA 3HL0A 3O4IA 4B7AA 1Y42X 3ZY3A 4WJZA 1PW7A 4KQEA 1MOZA 2G17A 4X7RA 4RELA 2HPHA 4QZVA 3LM8A 2CVQA 1FFCA 1WW8A 4N3CA 1ZDMA 4HDMA 1NA5A 1I80A 4FX2A 3LY8A 2OCXA 4PG7A 2QN2A 1VQ1A 3F4KA 4PXYA 4AM8A 4B8WA 1SVWA 1CEEA 2VAMA 3HKCA 1I10A 3HBAA 1CB0A 3HU1A 3NJ4A 1D9XA 1M33A 1NX6A 4HN9A 2QGNA 3V2GA 5IF3A 2X6RA 1LH0A 1QFSA 4QOSA 1S0UA 1SBZA 3TLXA 1SXHA 1Q20A 5AKEA 4O1HA 1UK9A 3L5KA 3GVXA 4N01A 4I3FA 3SS7X 4CUKA 1ZM2A 2BR5A 2PT5A 3QVVA 2F1HA 1JSZA 2B1GA 1ZH6A 1N7HA 1W48A 3D8RA 3VO2A 1B0UA 4ND5A 5DXAA 5LJLA 1QRSA 2CL7X 1AQUA 1X38A 1WPQA 4ZYTA 3KWMA 4EENA 2WQ7A 4ZVKA 2B9EA 3NC4A 1F5SA 1X9IA 4BEBA 1MC8A 4RTPA 1T8WA 5E1OA 4IF4A 2FSPA 2FPSA 4V0NA 1PQPA 4FZ3A 4UHKA 4C4PA 1RLIA 2BPOA 4RTOA 3F2VA 1Z7YA 4GZ3A 4HP8A 4E88A 2GQ0A 1KQNA 1NQWA 3X2EA 3NHPA 3QBEA 2HR1A 2GA8A 3ZZTA 3ECAA 3JPWA 5IM5A 3K0AA 1M1UA 3ZV4A 1KVTA 3ICWA 3NBYC 2G09A 4JYZA 2BONA 2AFHA 1UBLS 3OI7A 4G4JA 2YDYA 3IQIX 3CKKA 2O8EB 2EOAA 3A8TA 1ARZA 3KR0A 4Z9XA 5JDCC 1APBA 3HN7A 2P2NA 2I87A 1QB8A 2J4FA 1C1DA 4WXEA 2CUZA 1ZLYA 2IV7A 1DO8A 1YKSA 3KQPA 3KZNA 4LCBA 3VSEA 2OECA 4CTMA 5KDOA 4QU9A 1Y6FA 3CVJA 3BK7A 1PCXA 2HGSA 1W44A 2RCYA 2NZWA 2LVBA 3QEJA 2M6KA 1VG9B 1W75A 3PWKA 3LFUA 3DWFA 4RIEA 2C03A 3K0BA 1QYWA 3K9NA 3MLAA 4BWYA 1G66A 2BE7A 3TPFA 4HY3A 5IBRA 4E21A 2WFLA 1VL8A 4MSUA 5FO1A 4HFRA 3I8XA 5ERYA 3EGXB 3THXA 2J0SA 4FS8A 5K3DA 2QTGA 3SJAA 4Y2VA 3UGJA 1EFKA 2DFNA 4BNXA 1HSOA 3K4PA 1M8FA 2MHCA 1MHPA 2CBXA 2X6QA 1B73A 1DQRA 2HOQA 1Q0QA 1UPBA 2BCGY 2I4IA 2XADA 4JT8A 1M2OB 1M1NB 2ISCA 4XGNA 2D7CA 4KHPB 2GJAA 3U9SA 1QU2A 1KI6B 3LIPA 1EXDA 4CL0A 1B6SA 1JGTA 4RABA 3M6VA 2Q9CA 1KEVA 5F2NA 1R50A 2WA2A 3HB7A 4KIUA 3CF2A 5LZ8A 1IONA 1LSJA 2QW0X 4CFSA 1VP9A 4BAZA 1QG6A 4J2TA 2VF8A 3T3NA 5C2JB 4IRXA 2JLSA 2WYIA 2HSZA 2PX4A 1NXWA 3DCYA 1G38A 1UWVA 2XWPA 4GO1A 3E7DA 3C3BA 4H3SA 1I3LA 1SC3A 4D5GA 4KN5A 1BS1A 3H8VA 3BE8A 4F4HA 4ZEXA 3FTCA 3S2GA 1P18A 3PUYA 4HNRA 1TF7A 1MZPA 2K87A 1VJ5A 2FWNA 1UKZA 2YHUA 3RH0A 2VDUE 3OPXA 1J70A 4QDZA 5KIAA 1RSZA 5AUOB 2FXIA 2P0YA 3VYRB 2PGJA 2Y66A 4XQEA 1O6CA 2AG1A 1CZKA 2GNAA 2OXEA 4UEKA 1UPAA 3KTFA 4ZQBA 1JHOA 4R2KA 1T1IA 5LM3A 4DYVA 2BKVA 4LXUA 1QHSA 2PGLA 1TZMA 3AO0B 1E9RA 3E81A 4PAWA 3T34A 3UT0A 4DILA 5ICSA 2QXTA 4L15A 3CH6A 3RJMA 2QX9A 4A8JB 3FPJA 2OCGA 3LYHA 4PYOA 1GTJ1 1BE0A 4MDFA 1G20E 4WN9A 5LYJA 3S6JA 1NVTA 4PIVA 3ZW9A 4HR7A 4I1YA 4DUGA 4FFVA 1JT2A 2J08A 3WRXA 2FPPB 4FN5A 1HYHA 4D9JA 2NT4A 4BLPA 4JDPA 2G0TA 1TK2A 2P4HX 1PZHA 3W3AA 1NI4A 1UXJA 1ZLXA 1NHGA 2Z1DA 3K1AA 4UMVA 4YACA 2M6LA 3WBFA 1TK9A 2WJ3A 3G0GA 3GFGA 3UXHA 1UC9A 2PT6A 3ICCA 3CONA 4LHZA 3U9LA 5AIBA 2FUNB 1ODLA 2EWVA 3QE2A 4O2LA 4WJKB 1UXGA 1ZCBA 2BFBA 1D2HA 2OZEA 2I5PO 3G8AA 4CKEA 4RTSA 1YCGA 4JP3A 3KR9A 3GLTA 1TK3A 4WXHA 1MA0A 2C5EA 3RS8A 1T2UA 3ZV5A 4EY4A 3SC3A 3DCJA 1YACA 1XKXA 2W2KA 3AEXA 3FAKA 5DYWA 1XZKA 3LLVA 4X3CA 2VF7A 1F8XA 5B55A 2FG7C 4E3WA 3A6DA 2MSKA 4PSDA 1CJMA 4F9GA 3HYCA 1GQSA 2AKAB 3NOVA 2IL1A 3CGWA 3E7PA 3MLBA 1YQGA 3IHLA 3MQFA 1OXKB 2PMFA 1FSFA 2GWRA 2HRDA 3S2YA 4QG3A 4YMLA 4B3RB 3N8KA 3CRW1 4FBGA 1V16A 1N2SA 1QIEA 1DKOA 1T2CA 4QYXA 3NI2A 1IWPB 1IWBB 5HJ2A 4Q37A 3JYPA 2ZAOA 2P2DA 2A9OA 2IJGX 2IP1A 3ZKWB 4QVIA 1LD3A 1PS9A 2DP4E 3DEIA 3LT1A 4Q3AA 5A6SA 1YIOA 3QY0A 3K7EA 2OFOA 3UXYA 3O74A 1ULBA 2YFYA 3LQKA 2AN1A 2C31A 3I83A 2NACA 5CVVA 4CKWB 4XLTA 3HJCA 4AI6A 1U7ZA 1CZUA 2NO7A 3F8SA 5IDVA 4CLHA 3DZCA 3OKAA 4QO7A 1P3Y1 5E95A 2AMLA 2HF8A 4N5IX 2GJ8A 3IE2A 3LQYA 3LC1O 3UPTA 2F1RA 3JAKA 4BMYA 1CUBA 4P22A 4H0CA 1A98A 2GYUA 1E3JA 3GK3A 2FN3A 4F84A 4PAGA 1I3NA 1PZMA 5DTMA 2AQKA 5CA0A 2ZCVA 5LQSA 4M53A 4KNWA 4MV3A 2A0KA 1JJIA 1CRZA 2H8KA 2FMFA 4ZZ0A 4ZT7A 3WLTA 1LDNA 3ONVA 4IQ4A 1LQUA 3A10A 4CKZA 2ZIZA 2ZATA 3F4BA 5D87A 1QNFA 4YA6A 1Z4IA 2DWPA 3AESA 3PWZA 3BMCB 4L9WA 1GN9A 1UBEA 1BO6A 1X39A 3ESDA 4MPTA 2XY4A 1KNQA 4AB1A 5DT2A 1CP2A 4KXLA 4GOOD 4R9NA 4W9NC 2DH6A 2P9YA 1YC5A 2FW6A 3WGLA 3NT2A 8ABPA 1YWGO 5IPFA 1UT6A 1H2WA 1OWNA 3CUVA 3JQGA 4RE6A 2Z9DA 3ILVA 1Q12A 2EKPA 3ZNOA 1XGKA 4DJDC 5FPSA 5FBVB 4CV0A 3AEKA 3LW8A 4EKIA 4ARCA 5BR8B 2G9UA 4ZANA 1ZOLA 3O8LA 3A58B 3SZOA 2HIGA 1K5GA 3ASUA 2CJXA 3JVEA 4IINA 3TQTA 4B81A 4C6TA 5CFZA 1Q92A 1XAHA 2NTYC 2FSIA 2OBYA 2PSFA 1XXHE 3D4LA 3IQFA 3MCVA 5AIAA 4ZQIA 4ZTBA 2B3DA 2B0CA 4UARA 4EMTA 3DFFA 2H0AA 2DT8A 2EJTA 2O8BB 4KXUA 3N2LA 5FEUA 2ZZMA 1NJFA 2H54A 4TYYA 5K6AC 2QMYA 1GD1O 3HQ4O 4RD4A 2N3ZA 3PUKA 2E9SA 2E48A 2IHNA 2NP7A 1EWKA 1SVSA 3I04M 1PR0A 5AW9A 1Z2NX 1OXSC 3CB2A 5JJ5A 1GAXA 3FOCA 4P3XA 1DXYA 2NO1A 1N9ZA 2VQ3A 2ZKIA 3WKCA 5IAKA 3GY0A 4EL5A 1H1LA 2XI4A 4EMUA 1Z4PX 1SKYB 3LOQA 5A5GA 1YRAA 5KNDH 1UFVA 2R1VA 3MWDB 2FJPA 4G1BA 4P7KA 3TNDA 3W05A 4B6SA 2IS4A 4FEAA 5CLJA 4U1RA 1KC1A 3RU9A 4Z4EA 2JI4A 1L4UA 2HRZA 1P4SA 4OQFA 4RY0A 4BFXA 3EXFA 2BMWA 3TQQA 5TPWB 3W8DA 3WK7A 1U5BA 3R23A 3ROKA 4CG1A 3CVXA 4CR8A 1ODJA 1NURA 2EBWA 4Z49A 2GNOA 3RS4A 3ZBPA 1MLDA 1L7XA 3AUJB 1XZLA 4KTTE