1K5PA

Hydrolytic haloalkane dehalogenase linb from sphingomonas paucimobilis ut26 at 1.8a resolution
Total Genus 107
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
107
sequence length
295
structure length
295
Chain Sequence
SLGAKPFGEKKFIEIKGRRMAYIDEGTGDPILFQHGNPTSSYLWRNIMPHCAGLGRLIACDLIGMGDSDKLDPSGPERYAYAEHRDYLDALWEALDLGDRVVLVVHDWGSALGFDWARRHRERVQGIAYMEAIAMPIEWADFPEQDRDLFQAFRSQAGEELVLQDNVFVEQVLPGLILRPLSEAEMAAYREPFLAAGEARRPTLSWPRQIPIAGTPADVVAIARDYAGWLSESPIPKLFINAEPGALTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFVRRLRPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 1,3,4,6-tetrachloro-1,4-cyclohexadiene hydrolase
publication title Haloalkane dehalogenase LinB from Sphingomonas paucimobilis UT26: X-ray crystallographic studies of dehalogenation of brominated substrates
pubmed doi rcsb
source organism Sphingomonas paucimobilis
molecule tags Hydrolase
total genus 107
structure length 295
sequence length 295
ec nomenclature ec 3.8.1.5: Haloalkane dehalogenase.
pdb deposition date 2001-10-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00561 Abhydrolase_1 alpha/beta hydrolase fold
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1820 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 1k5pA00
3OG9A 2O2IA 2C5FA 2GYUA 2DCMA 3QBJA 1DX4A 3FBWA 2HFKA 1A8QA 3R3ZA 3AJAA 4GXNA 3ZI7A 4JUIA 4BCBA 1UOOA 1NU6A 3D59A 4O08A 2HDWA 4WDRA 1BEZA 4BP8A 4Q3KA 4GECA 3VXKA 1B41A 4BRSA 1G4HA 3YASA 1YCDA 1QZ3A 1ZGCA 1SC9A 3PDCA 3EF3A 1UT6A 1LPPA 1QFMA 1GXSA 1D07A 1O6GA 3WMRA 1UXOA 2OQVA 1ORVA 4HS9A 5FV4A 1K4YA 1MNAA 3FYUB 1MAHA 5KWJA 1F0NA 4EY5A 4ARBA 3DQZA 3QPCA 4CCYA 5E2IA 4FLMA 4H35A 1Q84A 1DT5A 4PF1A 1YR2A 1IZ7A 1GGVA 3ESCA 4GI1A 5ALRA 5AK6A 2YYSA 5ALGA 3KD2A 4FFWA 4CG2A 5CH5A 1F6WA 2JF0A 4LYDA 3A6ZA 1XQVA 2QUAA 3AIKA 2OAEA 5HF5A 5JADA 5EHXA 5AK5A 1QGED 3F96A 1EK1A 3EQ7A 4HXFB 4LKOA 2VTVA 5IVDA 4C4XA 7YASA 4Q34A 1FFAA 2QUBA 1VZ2A 4YASA 1YASA 5LZ9A 4KE6A 4YK7A 5A7HA 3JW8A 1LPMA 2D0DA 3W9UA 2GZRA 4G4GA 2AJCA 3IVMA 4H7EA 2JEYA 3WA7A 1ZD3A 2WHRA 3V1MA 3SWWA 4A23A 4HRXA 3FLAA 3VVLA 3E3AA 4QLAA 1DT3A 5K5EA 4HZGA 1AQLA 2WU3A 3Q0TA 4IO0A 3KWJA 1LPOA 4L72A 3STYA 3NWOA 1CUZA 4MYDA 4UHCA 2I3DA 3V9AA 5FUMA 4JYMA 4KE7A 4MQLA 4UHBA 3O95A 2GBIA 3R3WA 4ZREA 3G02A 2BFNA 4KAAA 4DTCA 2QXUA 5LKRA 1U65A 2V98A 4BC0A 2DQZA 1XZLA 1EXWA 3SX4A 2J4FA 2VAVA 2XE4A 3AILA 4BTVA 4ROTA 3D7RA 1Z68A 1CFJA 5LP1A 1UK8A 1J06A 5LZ4A 4C89A 4K6KA 1F8UA 1CUDA 4B6GA 1QIIA 1XZDA 2EDAA 5AM4A 2WJ6A 3WWDA 5AKJA 4PO3X 4C4ZA 4S0XA 3BE8A 1OCEA 4WFIA 2VJBA 3I6YA 4UHEA 1EVEA 3G0DA 2CEKA 5CH3A 3CN9A 3D2BA 5HQ3A 1BCRA 2QMQA 1QIMA 3C6XA 3KWFA 3IUMA 5EIAA 1KU0A 3L1HA 5T4EA 2ACKA 4FHZA 4UFNA 1SCIA 1VKHA 4N8EA 1QONA 3LLCA 1Q0RA 1LPBB 5T4BA 5CXUA 2HU8A 4X94A 1C4XA 5EHQA 4C6HA 3RM3A 2JGKA 1VE7A 2PKYX 4X6XA 1IUPA 3FNBA 3H2GA 3PF9A 1XKTA 1CUHA 1CUWA 5AICA 1TIBA 3DYIA 3E0XA 1QLWA 3WZLA 2Y2VA 5AM2A 2W22A 4F60A 1XZCA 1LBSA 4INZA 5JAPA 1R1DA 4DMCA 5JZSA 1LPAB 3H19A 1E89A 3W9BA 2BUAA 4FLEA 5D6OA 4LYEA 3IDAA 4BDTA 1BS9A 1UKAA 1VOTA 2YH2A 3O4GA 4LXHA 3B3QA 1ZI9A 2R11A 2GBCA 5ALMA 2ES4A 4LIPD 4Y2VA 1JFRA 2VJDA 5FLKA 2I03A 5DNVA 1XFDA 3OOSA 1CIJA 4H77A 4AB1A 5ALJA 4B81A 2WTMA 3DS8A 4B80A 2ONCA 2IITA 4UHFA 4X7BA 2XQGA 2DHDA 1AUOA 4TPKA 2QZPA 1QOZA 1YAHA 3WK9A 2XUKA 5JASA 4BE4A 2C58A 1CV2A 2VT7A 4TVKA 5I9IA 4PSCA 1TCCA 5E4TA 5ALWA 4YX9A 2WJ4A 3BXPA 5JZBA 3HLKA 5AIAA 4ZV9A 5YASA 3WL6A 1G66A 4PV7A 4CFSA 1CPYA 4FDMA 2Z8XA 3RARA 2HA4A 3PI6A 1ODSA 1UKBA 1H22A 1NX9A 1TQHA 3QMVA 5BV7A 1S8OA 1W75A 5ALPA 4CG3A 4QDTA 2WTNA 1E8MA 2XUGA 3F98A 1ZIYA 4Y2UA 5AO9A 1SCKA 4ARAA 4B0PA 3TGLA 2XUOA 1DX6A 5ESRA 1THGA 2BGRA 1HL7A 1B6GA 3D2AA 1UK6A 4BYMA 4N8SA 3R40A 2O2GA 3LIPA 1XRLA 4KYVA 4X85A 4DNQA 1K6EA 2QS9A 5FPPA 4MQMA 3P2MA 3R3XA 4J0IA 3H0CA 3I2GA 1UWCA 4QWWA 1P0MA 4QLOA 2R8BA 1RP1A 1XZKA 1A88A 3I2KA 5FOQA 5CTAA 3I1YA 1ZJ5A 5A7GA 3FYUC 1GKLA 2WFLB 2QR5A 1CVLA 3LIIA 2NW6A 5LZ8A 3WZMA 4CIBA 3GUUA 3L1JA 3WKDA 1TKRA 1H23A 4ZXFA 2H7YA 2EDCA 4QEKA 1GKKA 3EQ9A 2OGZA 4BVLA 3DYVA 2W6CX 1QFSA 3ESBA 1XLUA 4OU5A 1IVYA 3N2ZB 3WIOA 1VJ5A 1XROA 1JKMA 4NVRA 4BRZA 1YAJA 1RYYA 3UUEA 4YPVA 5JAOA 4FNGA 4Y9SA 1GPLA 5DJ5A 2G5TA 4AN1A 1CUBA 4Y2TA 2ZJFA 2WFZA 3FYUA 4FKBA 3GZJA 1CUYA 1ETHA 2XUIA 2RHWA 2XMBA 5HKBA 3TEJA 4H0CA 5JYCA 2AXEA 4ZV7A 3IUJA 1BE0A 4BC1A 4QDUA 4MEAA 2RONA 4UHHA 3O4HA 1FJ2A 4OB8A 3ICVA 5FXMA 3ANTA 1QIJA 5E4JA 3WKEA 4LHEA 5F4ZA 3WK7A 4PNZA 2RI6A 2ZYSA 4Q3LA 4AO7A 5JZ9A 4GHWA 1EA5A 4GWLA 3MVEA 4QZVA 1XRNA 2CUTA 5AM3A 3V1LA 2HM7A 2I78A 3G9ZA 4RGYA 2JGEA 2VAXA 3F97A 4DYHA 2H7CA 1DWOA 2X5XA 5AK4A 4EY6A 4X91A 4EY7A 2UZ0A 4AXBA 1H2YA 1ZD2P 1VE6A 5ALHA 1ZD5A 2ZSIA 1BN6A 4PW0A 3O4IA 2QT9A 4HAIA 4G9GA 4IHAA 4CG1A 4RPCA 2BKLA 5ALUA 1WHSA 4FNMA 3UUFA 4BDSA 3IA2A 1P0QA 3NOXA 1QIEA 5A6VA 2BUCA 1QIHA 5LZ2A 1HDEA 3R3YA 3WWOA 1LPSA 3WKCA 3LCRA 3DKRA 2JGFA 1QIKA 4C88A 3C87A 1L7RA 5HQ3B 2WHQA 1EDDA 2J4CA 4K6HA 3C6BA 4X71A 5JIBA 5A2GA 2Z8ZA 3S8YA 3WK5A 5ALNA 4P08A 3G0BA 3VJMA 4WFKA 1YS2X 3VKFA 2PVSA 3ZWQA 3HACA 3STUA 2CMFA 2EEPA 2WIJA 1CQZA 4RE6A 4X3CA 1XQWA 1CUAA 1SCQA 4BCDA 4A16A 1JMYA 2JGMA 1JT2A 2OCKA 3QPDA 3I28A 3ED1A 4Q3OA 2P8SA 2WKWA 3AZQA 2C7BA 1Y7IA 1PJAA 3H2IA 1GZ7A 3PFCA 2O7RA 2XQFA 4J0KA 4RNCA 2XMGA 1F0PA 1Y7HA 3BIWA 2VATA 4DNPA 5JALA 1J2EA 4Y2QA 2IIVA 3C8HA 1W6RA 2I3ZA 3GA7A 2V96A 1A7UA 4E14A 1CUFA 2WIFA 5CH8A 1FFEA 4WCVA 1XRMA 1ODCA 1ZI6A 5HCUA 2DR0A 3DCNA 5AOCA 1N1MA 2XMRA 4L9AA 4UFOA 1J07A 5ALLA 1PV1A 3H04A 1THTA 3OC0A 3HSSA 3DOHA 4ZGBA 2AJDA 1DWPA 3WWCA 5HFNA 5DTIA 4BZWA 2OGSA 3FOBA 2JBWA 3HXKA 1UKCA 1AX9A 3MUOA 1H2WA 2PSFA 5ALTA 4AO8A 3ILSA 2WIGA 4AX4A 1CUSA 1WB4A 4Q82A 3C70A 1UK9A 1SOMA 2H1IA 5AOAA 4LXIA 4U2FA 4BVKA 5LZ7A 3C45A 4X92A 3HJUA 2HA3A 5AK3A 3DLTA 4B7ZA 3ZLTA 4FOLA 2PSJA 3IUNA 4KEAA 3PICA 4XX1A 4Q05A 1XKLA 5D3KA 4UPDA 2XI4A 3X3HA 4KRYA 4WJLA 3WKBA 2O7VA 2DSNA 2XDWA 2PUJA 4N5IX 3VJKA 5LIPA 4J0DA 4X00A 4TGLA 2RIPA 1XQYA 3QITA 4H7IA 3HI4A 2PBLA 4XWGA 5C81A 4UUQA 4OU4A 3GBSA 1CUXA 2C0PA 2QXTA 5FDFA 2X76A 4G8DA 1DQYA 4J3JA 1VXRA 5K3EA 1JJBA 2XLCA 3A2LA 1QIGA 3C6ZA 4DLNA 5CT4A 5CURA 3IULA 5KWIA 3S2ZA 5CBKA 1YSCA 4BVJA 5A62A 1T4MA 1TK3A 1ACLA 1G5FA 2ORYA 1EH5A 1ORWA 1TCBA 1VA5A 2PUHA 3D2CA 5D7BA 4BBZA 2VT6A 3WI7A 5LKAA 4DMKA 4UBOA 5KBYA 3WL8A 4IH4A 2JGJA 1M33A 4EBBA 1MO2A 5AI5A 2G63A 3V1KA 1MAAA 5EIEA 1GT6A 4E15A 2PSDA 4H7JA 3B12A 4U2GA 4AN0A 2WSLA 1EINA 3KDAA 3FYTA 4ETWA 4MEBA 2GBGA 4D9JA 4DIUA 3DEAA 4HTAA 1QTRA 1QIDA 5I8PA 5HF6A 4MXDA 1GQSA 5K3FA 2HRQA 3E1GA 3ICWA 1ZJ4A 5AKGA 1QE3A 4J0GA 2PL5A 4IQ4A 4Y2SA 4XVCA 3OURA 5AIBA 1R50A 4QDXA 4KE9A 1JU4A 4FMPA 3WIBA 3AIOA 3E4DA 4DSZA 1EX9A 2IX9A 4F21A 3QPAA 3DNMA 3G0CA 3LP5A 3BDIA 5K3CA 1TCAA 3QYJA 1W4LA 3HABA 4M0FA 4OSEA 5IVKA 1SFRA 4KAFA 2B9VA 3OPMA 5EIHA 3W2TA 4B85A 3FLBA 1JJFA 1CUEA 5HFAA 4X93A 1CUGA 2ROQA 4BB0A 5AKIA 1LBTA 5AI6A 4DSAA 5HKAA 3O9VA 4JYPA 3STVA 1L7AA 3A70A 3VJLA 2XMCA 4GBGA 2XUAA 3WKAA 4FWBA 3UMJA 2CZQA 1QJ4A 4DNFA 2Q0XA 3FVRA 4BZZA 3HRHA 1EDEA 3JWEA 1DU4A 4N8DA 4BP9A 1EHYA 2WLSA 1IMJA 1ZD4A 1HLGA 3KSRA 1C7JA 3ANSA 3QH4A 2CBGA 2XUJA 3HYSA 1J1IA 5ALYA 1VZ3A 4K6GA 5K3AA 3R3UA 3WA6A 5HK9A 4P92A 4WFJA 1ISPA 4KAJA 1P0PA 2ZYRA 4H7HA 1WM1A 2OGTA 1L7QA 2QJWA 4W9RA 3OM8A 1H2ZA 2AJBA 1R4ZA 3DOIA 4QNNA 1EI9A 2OLEA 1ZGBA 4J0HA 1BN7A 4W63A 2JEZA 4PQEA 1WPRA 3R0VA 1UOQA 2WUFA 4P9NA 2GZSA 2QKYA 5A71A 4EB0A 2WUGA 1BEEA 4KACA 2WUEA 2OPHA 2YASA 4L3WA 2JGIA 5ALSA 5ALEA 3VDXA 3DJYA 3IUQA 1LZKA 1CUJA 3AZPA 3KXPA 3WK4A 2AJ8A 4HXEB 2XUQA 3O4JA 2WJ3A 2BGNA 5BOVA 2XUFA 5AKZA 5SYNA 5IH7A 2D5LA 2VEOA 5DWDA 3AZOA 2XB6A 3WWEA 4NS4A 1ZI8A 3WWPA 1FFCA 1USWA 5T4FA 2XMSA 4AMZA 2WM2A 5JARA 3C43A 2GBFA 3H18A 2FX5A 4U2EA 3F67A 2XQJA 2DQYA 2QRUA 4MYSA 4AZ3A 5ALVA 4I4CA 2VF2A 3M3DA 2O2HA 3K9BA 4ITVA 4EY4A 2K2QB 2AJLI 2WG2A 4IH9A 4Y2YA 3RK4A 2GYVA 1CUUA 3QZUA 5JD4A 4W1QA 5JATA 2X8BA 4W1PA 3QM1A 1ZIXA 3BJMA 1K8QA 2H7XA 3D3NA 5LZ5A 4QWMA 4A5SA 4GLBA 2QM0A 3BJRA 3W05A 1Q0ZA 1CUIA 5EFZA 1XZBA 3IIIA 5K3BA 3AUKA 5IVIA 1LLFA 3AIMA 3D5EA 1RWQA 2J3DA 5A7FA 2RAUA 5C8ZA 1E8NA 5ALQA 2WFMA 4BE9A 2OXEA 4BAGA 5ALOA 3WYDA 2PX6A 1QTIA 5EHZA 4FBLA 3HC7A 4MWTA 1LNSA 3VISA 3H2HA 3N0TA 4UFPA 2ZJ6A 2RGUA 1AMNA 5AKYA 3GROA 4FBMA 3WYNA 1P0IA 2WU4A 4ZRDA 1Y37A 5SYMA 3Q8WA 3DL4A 3DD5A 1QIFA 5LYYA 2XT0A 3VVMA 2CB9A 4XJVA 4OPMA 3FCXA 2WIKA 5AKLA 1CUVA 5J3JA 5ALZA 4V2IA 2J3QA 5AI0A 3RLIA 1YS1X 2C5GA 2ZJ7A 1XQXA 4OCZA 2Y1KA 3PF8A 4BAZA 1QO7A 2V9ZA 3O0DA 4FTWA 4F0JA 1N5MA 3CN7A 4BTLA 1YB6A 3BL8A 4ZI5A 5AM1A 2XUDA 1UZAA 5JANA 3CXUA 4CCYB 2ECFA 3EBLA 1ZICA 2XQIA 1K63A 1IZ8A 1W76A 3F9CA 3DL7A 4U2DA 5CT5A 1XZGA 1UFOA 1XRPA 4H7FA 4Z49A 2BAGA 2BJHA 2V97A 1W1IA 5AJHA 2B20A 5AKKA 3BDVA 2E3JA 1ACJA 5AI4A 1XZFA 3I2JA 1AURA 2OCGA 3V1NA 1EDBA 3DDUA 2XMZA 4BAUA 2PU7A 4HRYA 4DMHA 1AKNA 1JMKC 1XRQA 2HIHA 1EVQA 5AHXA 5AH0A 5BWCA 3U1TA 2QVBA 3A2MA 4OUKX 1HPLA 1XLWA 3HEAA 1WHTA 3T4UA 5CT9A 4H7DA 2G5PA 4E46A 2DFPA 4OYLA 3I1IA 3O9MA 4Y2RA 2ZYHA 4UBKA 1AZWA 1LPNA 5JAHA 4DNOA 3B5EA 1DTEA 2XUPA 1A8SA 1XRRA 2WQZA 2HFJA 2DHCA 1I6WA 5CMLA 5ALKA 3WLAA 3BF8A 1WB6A 4B84A 3WK6A 3G7NA 1X2EA 1KEZA 3R3VA 3EQ8A 5HF9A 4UBJA 5JAUA 1U4NA 2FJPA 4EHBA 3C8DA 3G0IA 2C4HA 1CRLA 5JD6A 1MU0A 3H2KA 4X6UA 5AP9A 4U2BA 4AMYA 2VJCA 1PFQA 4I3FA 4QDOA 2WFLA 2WILA 2HA2A 5CW2A 1DQZA 4BATA 5CT8A 4AZ0A 1WCYA 1BCSA 2B4KA 3WJ1A 1JI3A 4OB7A 3WQHA 1HQDA 4MWSA 3M81A 3M83A 5FPQA 1U2EA 1E3QA 1MTZA 1DWQA 2XQKA 2XMDA 5EI5A 1H2XA 3PUIA 3AINA 3I2FA 2WHPB 4W1SA 1XZAA 4GW3A 5AM0A 5KREA 1Q83A 5H3HA 1CEXA 4U2CA 3G9TA 5C7YA 5EHNA 1A8UA 3U0VA 4UBLA 3STWA 1CQWA 4G4IA 4FLFA 2BUBA 4EUSA 3SC2A 3CCBA 3I2IA 1FFBA 4JNCA 2H9YA 2HA7A 5DNWA 4WY8A 2BCEA 3C5WP 5LLSA 2LIPA 3K6KA 2PPLA 3IBTA 4IH1A 4N5HX 5FRDA 3FCYA 3G8YA 2WG0A 2Z5GA 1UK7A 1MPXA 2QOEA 2PSHA 4H18A 1QO9A 2HA0A 4E11A 1AGYA 3FSGD 1OILA 5CT6A 1R9NA 5AM5A 1GPNA 1VA4A 3BF7A 3ESAA 3PFBA 4G1FA 1T2NA 3MGAA 4DM7A 2XLBA 2Y6UA 3ZLVA 1E66A 1CR6A 1WB5A 3H2JA 4L0CA 5ALFA 2VJAA 2ZSHA 1XZMA 5HZGA 1TAHA 4J7AA 3KOOA 1XZIA 2WHPA 2Y6VA 4J0JA 4EZIA 4Y7DA 1GPKA 4B0OA 5AKHA 3C6YA 4X6YA 2WIDA 3SK0A 4B82A 3D0KA 4G5XA 3ESDA 5AKEA 1R9MA 3FLEA 1GQRA 4X90A 2VA9A 4ZWNA 1W52X 1FSSA 3WL5A 2HL6A 2HHAA 5ALIA 1MT3A 1X70A 3IURA 5BWBA 1UOPA 1XZEA 3R41A 4UBMA 4RE5A 1E5TA 4JH0A 4CIAA 3JYHA 3K2IA 3H1AA 1CUCA 2FJ0A 4EY8A 4KR0A 5K3FB 3C5VA 5DTJA 4QDZA 5AKXA 4QA9A 1MJ5A 1E8DA 4Y2XA 1NU8A 3QMMA 5I7UA 1U8EA 3LS2A 5EGNA 1BROA 4J0CA 4Y2PA 5D3ZA 2QTBA 4F5ZA 1MX5A 3NGMA 2PU5A 3CCCA 4BCCA 3W04A 2Z3ZA 1OXMA 4CCWA 4H7KA 4Y2JA 4HXGA 3NUZA 4C4YA 3ZLUA 3G9UA 1R3DA 5DNUA 3EIOA 3WK8A 3H1BA 1EB8A 4X97A 2WUDA 3RKSA 1X2BA 1DINA 4Q1VA 1JJIA 2WG1A 1WPXA 5AOBA 5E4YA 1N5RA 2B61A 2VSQA 5K3DA 2HA5A 1IUOA 1HBJA 1C7IA 2OAGA 5DYTA 4B9EA 1YA8A 4M0MA 2GYWA 4DMFA 4OYYA 4G9EA 5ALXA 4J03A 3FVTA 5HF8A 2JIDA 2RHTA 2ZVDA 1IUNA 1O6FA 2Y2UA 5IKXA 1WOMA 4PSUA 3FAKA 4XIIA 3T52A 1CLEA 3AFIA 4KE8A 1MX1A 2OG1A 3BIXA 4FFVA 2ACEA 2HRRA 4EA6A 2ZYIA 3A2NA 4P93A 5AI9A 3D4LA 3DKKA 3STTA 1XZHA 3FWHA 2YXPX 3V48A 4G8CA 4KRXA 5T4HA 1XLVA 3OTQA 2XMQA 4G8BA 2PM8A 3L1IA 3QMWA 2C0QA 3TRDA 4OB6A 3G0GA 4JEIA 2VQ6A 2G4LA 1XZJA 4UHDA 1YA4A 4C87A 2DHEA 1FFDA 2OCLA 4CI9A 3GELA 1YB7A 4G4JA 5C8XA 4MJ3A 4GDMA 4K2AA 5IVHA 1MN6A 2HU5A 2HADA 5FKJA 1ODTC 2OCIA 4OD0A 1G42A 3WJ2A 2QJRA 1EK2A 2HU7A 3M82A 1VLQA 2PSEA 3WL7A 3I6ZA 3GFFA 2CKMA 4HVTA 5DYWA 3ZV7A 2CJPA 3F8SA 4K5QA 3G9XA 6YASA 4QE3A 4B83A 4M0EA 3I2HA 2Z3WA 3W06A 4X95A 3IB3A 2OQIA 5CRIA 4UBNA 1K5PA 4AO6A 5DYYA 3BWXA 1VXOA 5ISMA 4WY5A 1TRHA 3QVMA 4GEGA 5DLPA 3STXA 4LXGA 3I6MA 4AQDA 3FSGA 4KJXA 1KU6A 4W1RA 2JGLA 1EB9A 1JU3A 4NMWA 3TJMA 2FUKA 4DGQA 3ZPXA 5C8VA 1LGYA 3MUNA 3PUHA 1R88A 3PE6A 4PSDA 3H17A 5AI8A 1HKHA 5FP0A 1BRTA 5ALDA 2HA6A 1ZOIA 2XUHA 1BU8A 1LZLA 4B9AA 4C01A 4NZZA 1N8SA 5HK8A 1MNQA 4UBIA 3HZOA 4WDQA 1MX9A 5JD5A 4I19A 5CXXA 1AC5A
chains in the Genus database with same CATH superfamily
1PJSA 1F1BA 4OK3A 1YFJA 1WR8A 1YV9A 2DCMA 3HXMA 3BEDA 2ZUWA 3AVOA 1XCBA 2J45A 3FBWA 3FPHA 1Q7GA 3RRZA 1KJQA 1XAIA 1PR1A 1P7PA 2F1RA 2HPZA 1T26A 2YJGA 2GEKA 1CT9A 2F90A 2ONYA 3LV8A 4US0R 4TT3A 4DQKA 4R0MA 1E1MA 3LECA 3HM9A 5K0FA 1VC2A 1U0LA 4LSGA 4RFVA 5AVJA 4WN9A 4G09A 2PTHA 2Z5LA 1P7CA 1ZMOA 5J5AA 3KIPA 4JUFA 3FLMA 4MWDA 3D59A 1JLRA 3A1WA 1DDOA 1II9A 2RH5A 2HDWA 1SVKA 1R0SA 3D0QA 4O08A 3ZHCA 5CBPA 1BEZA 4BP8A 4M49A 1OWPA 4Q3KA 3T3IA 1KK0A 2IU4A 1ODKA 3O0TA 4EQZA 5FWYB 4E2ZA 1XTKA 1JZTA 3BXHA 3HO8A 4JSTA 2G0AA 1RJGA 2QP3A 4C4TA 3Q41A 4X1IB 4N6GA 3OO0A 2WJPA 1GL3A 1V5IA 2ET6A 2CHEA 2PT7A 3BHNA 3I6BA 4RDHA 4BNNA 4C7JA 1JEYA 2ZCJA 5EQFA 2FAXA 1FMFA 3MW8A 1JDUA 2B21A 3GMIA 4M8LA 4PIMA 5FV7A 3ON5A 5C5IA 1SMKA 1EWTA 4P54A 1SC9A 1SU8A 3MTAA 2QA5A 4IJ6A 3PDCA 1QVAA 2P6OA 2QL6A 3NUGA 4JQYA 4UNNA 3VHQA 2JI4A 2DWQA 4ZHQA 2PWBA 1G18A 3T5MA 4AJEA 4E94A 1QFMA 3A7EA 3ANMA 2VTDA 1VRWA 3QFSA 4QPNA 3N58A 2B99A 3OEYA 4AF8A 3UY4A 4BN0A 2IKQA 1RAIA 3RTDA 1FRVA 1ORVA 1SKAA 1K4YA 1YUBA 3NIFB 3CX3A 3MRTA 4QUGA 2EIHA 4H6PA 2HLDD 3OPQA 2F67A 1UFVA 1SRQA 3FNIA 3DQZA 1KEPA 1SHLA 4CCYA 1KZYC 2A2ZA 4MUMA 4DREA 4FE3A 2R1TB 4AY6A 2WOOA 1XVTA 2OSBA 4BMOB 3B78A 3TEFA 3AP1A 1M6EX 2OR3A 5EQJB 4H35A 5CLQA 4LTDA 5ARBA 4HQRA 4Q4CA 4XOUA 1QUEA 2FF7A 1DT5A 4PF1A 1YR2A 4BMYA 1T3TA 5KOIA 1E4EA 1JVNA 1LA2A 3Q3IA 4ENTA 2J5RA 2JLRA 2C5HA 1W19A 4R1MA 2ZJ8A 4UXJA 1JJAA 1NNI1 4A03A 3KBBA 4A7PA 3AEKA 3EIWA 1UEJA 3EGXB 3LNTA 4G23A 1W85B 5KOYA 2Z56A 2NXEA 1PQPA 2H4WA 2YYSA 4GQIA 4FZ3A 4R2LA 2RGNA 4FFWA 4J1NA 4RF2A 3T9AA 4CG2A 4D57A 4YP7A 4CEIB 1C3XA 5JSQA 5EE0A 1MORA 1E1NA 3WLEA 3A25A 4EF6A 2P3LA 1FXSA 2DEUA 1UJ4A 3BMXA 3OFVA 3QUBA 1RPJA 1L5SA 3AIKA 4M1SA 5C7IO 2OAEA 5DP1A 4PBSA 5IX8A 2Z6QA 2Z2YA 4Q9HA 2WV9A 4X41A 3T06B 4BLOA 5KVCA 4MA0A 2J6CA 4P3KA 5AK5A 3HCCA 3AF0A 3TPZA 4Q4DA 3ZWMA 1EK1A 3EQ7A 4HXFB 2YQ4A 2O3JA 4LKOA 5KINB 3LRXA 5EC8A 2HREA 3VU9B 5IVDA 4OBWA 1HFJA 4FT4A 4ZVSA 1SZCA 3LH5A 4Q34A 1C30A 5KTOA 1OZHA 3FGZA 3LQKA 1FC0A 4ZOAA 4QVIA 4QUIA 3OZUA 1VPWA 3WGZA 1PR5A 1DWUA 3KM0A 3LUHA 4JQOA 5EP2A 5A7HA 3OX2A 3VGPA 1K8XB 3JW8A 1LPMA 2MSWA 4E2FA 1DNPA 1JHVA 2KB0A 3NEYA 2GZRA 4ZYUA 1SU6A 2AJCA 1YIDA 1S3SA 1Q17A 3A4VA 4V1CA 1TYEB 4H7EA 1XBTA 3DDCA 3Q1KA 3WZ2A 1BC5A 2WHRA 3MMNA 1NFQA 1AA6A 1IBSA 3GLHB 1FUYB 5KC9A 3NOQA 4N3GA 3V1MA 3SMVA 2ZPTX 3X1JA 4M8IA 4FWIB 4CMIA 3SWWA 1S1CA 1GGKA 2H31A 1GZ4A 2L18A 2OV4A 4TSFA 4F4JA 2P4UA 3LX6A 3WGYA 2V7QD 4V38A 4LY6A 4OKSA 3RUFA 3GPBA 4GI7A 3ADBA 2HWUA 2PKRA 2A1IA 1DT3A 2GCNA 2BF4A 4L8YA 4ZO6A 1ECFA 3RK0A 3U7QB 4YCNA 4FMDF 3PFWO 2PZ8A 3VNSA 4GS5A 1XA4A 4FQ7A 3V8PA 5D3QA 3WGHA 3KP1A 2GXAA 3ZZ1A 4J4BA 4RLHA 1RQRA 2VJLA 3Q0TA 4OQYA 4B3XA 2O8FB 1XJWA 3IQIX 3KWJA 4IO0A 5JXWA 5KQLA 2YY6A 3C3AA 1KPIA 1JW9B 1N3YA 1XO1A 3ABQB 3DE7X 4NOKA 4XGRA 5GQSA 4P6VF 1W581 2YDYA 1OXXK 3MS7A 3SZRA 1A5SB 2P6RA 2JVJA 1ENPA 4H17A 2WM8A 1TTQB 2AC2A 4EZEA 5IHPA 3DBRB 2C84A 1D2AA 4OHVA 4FGWA 2PQMA 4B33A 1M8FA 4URUR 4UHBA 4I50A 3W9SA 3CVVA 4TXJA 2GBIA 3KTAA 3UK2A 2HMWA 4A10A 3NYIA 4LNAA 4ALIA 1XC7A 4YPOA 2TMKA 3HVHA 5TARA 2Y9MB 1KDZA 4MS1A 5D84A 2PWAA 3WLNA 1XWIA 4XH9B 4V0LA 1Z38A 3HR8A 1ESDA 1NZDA 2QXUA 4DV1B 2Q9AA 1C7EA 4KQGA 3RT1A 3HTXA 4DQUA 4FGJA 5ENZA 1HZJA 3EF1A 3UKDA 1TMOA 1XZLA 3OMWA 1GQ2A 3OIWA 5J2TF 1SUCA 2PA0A 2FEKA 3MUEA 5TPWB 3SJAA 3JQAA 3W90A 1G6HA 3IUYA 1U5BB 3D8BA 2P9YA 4Q7LA 3K70D 4LJLA 4DUZB 4IIJB 2EWWA 3ADKA 2V54A 3A3YA 3P5SA 1P1CA 4KXXA 3THOA 1NBME 3AVXA 1KY5A 5DP2A 2C83A 1E2LA 3QY0A 2XE4A 4HDOB 2J5XA 2LV8A 4JKOA 4UDYX 5EMLA 4BTVA 5JT1A 5ENVA 3CF4G 3GGPA 3LA8A 1NL3A 3H83A 5LP1A 4PGMA 3I5AA 3GA5A 3BCRA 4AYWA 4IX9A 4MV8A 1KYWA 3KUUA 3OPYI 4P86A 1C0KA 1ADYA 3IRVA 3LPDA 1ZJYA 4O59O 3WGOA 1YONA 3U4MA 3TW8B 4IRUB 1UXJA 4HH1A 2OHJA 3U3DA 1WXDA 3ZXXA 2WYIA 3NOOA 4KP7A 3TK1A 4D97A 4XDZA 4TRJA 3WGQA 2XTNA 2Q5LA 2ORVA 1RACA 2IY9A 4MR9A 3A9WA 2IZZA 4PAWA 3EHDA 1UBGA 2JIBA 3M5PA 3KVVA 2W9XA 3MBOA 1ST2A 5EG5A 1NNEA 4CQNA 1K9SA 5DO9A 3OTWA 1FX0B 2PJDA 2IYVA 4S0XA 2CLHB 2QNIA 1T4BA 5MF6A 1ESZA 1P18A 4ZTUB 1F7UA 1U8ZA 3DD1A 3UBTA 2VJBA 2Y1WA 4UHEA 4WEQA 2IGTA 2J48A 2YRWA 4PR3A 1RHJA 1V2GA 3FBGA 2IEGA 4YDRA 3O1LA 3R7WA 5A4IS 5ELMA 1JMVA 2GAIA 2H4ZA 3JQAD 1G5RA 5L4NA 2HLHA 3TR5A 3IUMA 2FW0A 1HXHA 2WSYB 5KEIA 1FIUA 4OQ4A 4CCAA 5EIAA 1L5HA 3HUUA 4LSWA 3D8UA 2PWPA 3GWZA 4BPRA 1NOKA 2NUPA 3NVKI 3N59A 1Q3HA 5I9LA 3L7BA 4FHZA 3KKEA 1GV1A 3MOGA 3LW7A 1LVGA 1QONA 1PDOA 3LLCA 1T8RA 1ADBA 1Z9BA 2P7IA 3D1VA 4CV2A 1CY1A 4TMYA 5JDIC 5AHWA 2BFEA 4C6HA 5K0GA 3EARA 4FE7A 3D6AA 4M0LA 4N0EA 1G64A 2B98A 2ZJ4A 1B3BA 3QEMB 5GPBA 3AHCA 3NBXX 4PSAA 2RHMA 3VTZA 5E9AA 1IUPA 2ATVA 2D0IA 1UJ2A 3CE9A 2BHRA 3IJPA 3DPIA 3HV0A 4JP2A 4KFRA 3RSLA 3SDSA 3TNLA 3VZSA 3W3ZB 1EG7A 2HGZA 5MN6A 3U7GA 3D5TA 1ISMA 1UBOS 5KKCA 1JAYA 4OP3A 3FDFA 4RMNA 3UC9A 3E0XA 1R2QA 3WLSA 4R8RA 4INPA 2HIMA 4RFSB 1QLWA 3A37A 4GGMX 2AYYA 1ZY2A 4KXFB 5MGNA 2PO5A 4F84A 3ROKA 1G3QA 2XGMA 4OHUA 1W5SA 4MP8A 5JAMA 5EHZA 3AFOA 2VWPA 4N9WA 5EKTA 2ZSBA 4F60A 3WLPA 4B76A 4MUNA 3IKTA 4UCFA 4A0RA 4JSYA 1LNZA 4CL0A 3WB0A 2H85A 4E2WA 2W8ZA 4IS3A 1GTMA 3LVBA 1PHRA 2QUHA 4EB6A 3W9BA 3OM0A 1C4KA 2FGKA 1DC8A 4EK9A 5HHTA 3GEDA 4LNHA 4DLVA 1VSBA 3BWEA 3GLGA 3JQCA 3T1HB 4X8MA 5D6OA 1DUIA 2CLKB 4RKWA 5IJ0A 1SVSA 1VLLA 4ZYWA 4LJRA 4XEHA 3K30A 2BFFB 4BVBA 3L0CA 3Q72A 4R5HA 4BNWA 1NLFA 1KI9A 3O4GA 2WPDD 4A1OA 5COBA 1JDBC 5CJ2A 5TPZD 4NU0A 3TLCA 3Q6MA 4ALMA 1Y4UA 5GIPE 4WK6A 3O91A 3EN0A 4KQCA 4AMGA 2ES4A 4DEVA 2WKRA 4LXYA 4Y2VA 2YCBA 1ZD1A 5BN4B 3FZQA 1SZPA 4QJBA 1QG2A 2XKBA 5FLKA 1E6WA 1ZOOA 4R1TA 4UCWA 4XW2A 3V2UA 4DADA 1P0CA 1XFDA 5DNVA 1I2CA 2CVZA 3KQUA 4NAUA 1WTCA 1C8BA 2ZT5A 1PL8A 2O8FA 3L7IA 4E7PA 2ATIA 3PNKA 5BNTA 1X14A 3L0IB 3MTEA 4IJKA 3OX3A 5GOTA 3OKFA 4U8GA 3RVPA 1WUJS 1YQUA 3OZ7A 4MUEA 3G5AA 4Y98A 3D81A 2CNLA 2GAAA 2GZHA 3T1YB 4OHYA 2C5SA 2ZATA 5H1YA 5LDGA 3RGGA 1U5AA 4YRFA 4FB4A 4BKOA 2Q6TA 3ENQA 2FUG6 3KV1A 3IAM1 4MR8A 3KHKA 5KJEA 4TPKA 4B43A 2QZPA 1YAHA 1L3BA 1QH0A 5JASA 4KXQA 5E38A 4QELA 1Y1TA 4TVKA 5I9IA 2X2OA 3GJSA 5IXJA 3GFSA 2GESA 3DO5A 3PENA 4JBNA 5E4TA 1Q57A 3GRCA 4KLAA 4PN7A 4ZALA 2XA1A 4YX9A 5IVPA 3L7JA 2PSSA 4MIEA 3L9WA 4PC1A 4YUVA 1FW6A 3HEMA 5UKDA 5K6RA 4MWEA 4OFZA 3HLKA 3PP8A 4QTXA 1IU9A 4ZQEA 3RV4A 4RBNA 1G60A 4HG2A 1EAYA 1V95A 5E8RA 3FKSA 3A0UA 4E4TA 1GRQA 1DG1G 1IH8A 5B12A 2CXNA 4PFJA 4R0NA 4YJGB 1CPYA 3NH6A 3EIUA 5LMCA 3QKRB 4HUQA 5J2UF 3IAAA 4OYRA 1WEKA 3JYQA 5FL7A 4AWAA 1I13A 4M55A 1C1DB 3E8XA 2O0KA 2QM8A 3LYHA 1PYGA 3E84A 5C8YA 2FEWB 4O6VA 3OTOB 1PT6A 1FJHA 2FRDC 2F9LA 4YRCA 1JFTA 1XDUA 2C4UA 1G8GA 1NX9A 3PIIA 5E95A 4UMDA 3EFOB 4LEIA 1V8OA 1ONOA 4MDYA 3P0EA 3N05A 2EX0A 5B7QA 3OKAA 1OI2A 3PG5A 4CMCA 2I71A 1O54A 4LVUA 4R81A 2N0SA 3EULA 3CSDA 3C8UA 3BKXA 2V3WA 2ZQYA 1E8MA 2JI8A 4OXQA 4LGYA 1P2BA 5K6AA 3OQHA 4NI5A 4B4WA 2C88A 4DIMA 4CR7A 2CT8A 2XE6A 4LYAA 3ZCPA 4QU8A 4B0PA 1R0RE 1SCKA 4I1UA 5FHQA 4BTEA 4CV1A 1ZVKA 3FWYA 1THGA 1HL7A 4Y6PA 2B8TA 3EVCA 4QBKA 5BNWA 1R0YA 2VO1A 3Q12A 1Z8HA 1KJ9A 4COOA 2R1TA 2RHLA 4WBNB 1GO2A 2VH5R 3NWEA 4ZYXA 1LI7A 5FF9A 2QRVA 3M6VA 4Z5XA 4ZAVA 3GVHA 4BYMA 2O8BA 4GI5A 2QENA 4N8SA 4ND3A 1H85A 1O0SA 3LIPA 3R6GA 4KYVA 1S2DA 2OLKA 1J22A 3P2EA 4LHSA 1HOTA 1GFZA 1I1HA 4KWIA 3P2MA 3A9TA 3R3XA 3T7DA 4J0IA 2QL7A 5IJWA 5JPCA 1BGVA 3H0CA 1BFKA 2FHPA 3TR0A 5L9AA 1RYFA 2W4QA 3FPEA 3K2QA 4NZMA 3A9CA 1KFCB 2ZTHA 3BFKA 3EEBA 1D4OA 3GJQA 3JQQA 1T0HB 4MUIA 3R6WA 4QSHA 3VX4A 3WQQA 5IDQA 4G5OA 3ZDRA 5LFAA 4OHFA 3RYCB 4WEOA 2W2LA 3W5BA 4BIIA 2PBZA 4YY3B 4BWGA 1XZKA 5FWXB 3CWQA 4TX1A 5TVGA 1P4JA 3HYNA 3OJCA 6ABPA 2NADA 1P6QA 3JZMA 5FOQA 3SZUA 1L6IA 1F0KA 1GKLA 1ZJ5A 1DSSG 3LA6A 4TXLA 4JI4B 1RMQA 1EP9A 1KJNA 1JE0A 2QR5A 2W8BA 3EVNA 1CVLA 3OJ0A 4K9MA 4P36A 4P7GA 5CM9C 3NTLA 4CQLB 1C2YA 5KSWB 2BV3A 3K9QO 1MIOB 4CPDA 4DV6B 1JBQA 4R2HA 5LZ8A 5I3CA 5KTSA 4XQGA 1G3RA 1TVCA 4PZDA 1RCTE 4U7DA 3FPKA 3NORA 4RYDA 2Z95A 1W1UA 1YI8A 3GUUA 4X8LA 3UICA 4GSLA 3WKDA 5LPNA 1V47A 3AEKB 3EGXA 5DNEA 4MAMA 3HB4X 1PWXA 2I7TA 4OXKA 1IMOA 1PLLA 1SCUA 4UE3S 1BGXT 1XD9A 2Q5JA 4J1SA 1PWEA 4HGNA 4ZXFA 3ROFA 1C9NA 4KMOA 2DU8A 1RI5A 4HRAA 2C82A 1J8QA 5KTTA 2Q4DA 1RWKA 2Y93A 2COUA 4NBTA 4XLZA 4Y7CA 2R9VA 2W0SA 1R4NB 3OQBA 1Z08A 3ORFA 2JBHA 1DIHA 1CVRA 1K7XB 2PA3A 1GPWB 1NW5A 1NVMB 1ZGZA 2YY5A 4F56A 3RADC 2IS1A 1U0NA 4MR7B 3NHRA 2Y1LA 1QZUA 1N7IA 2FW9A 5BORA 2PUBA 1XLUA 4D0RA 1EQUA 4AM8A 1KZ9A 2SKCA 3WVNA 3EVBA 4CMIB 2JCXA 2IOQA 4JT2A 1RC0A 3N2ZB 3TDKA 1L5GB 1JKMA 4Q7KA 1QKJA 4QQFA 1UADA 1BWQA 2I5PO 1ST3A 1TI7A 1JPJA 4JQZA 5CVVA 4YPVA 4WESA 1Z56C 1KK1A 4NU8X 3VDRA 2WYHA 1ENOA 4IUDS 2BFPA 1QVWA 4CV3A 2BEVB 1S2IA 1NQTA 2XOXA 3ZHRA 4ND2A 1CUBA 1JEDA 2WFZA 2QPTA 2XNKA 2ZJFA 3C0KA 3HS3A 3L04A 4JC4A 4KIJA 3HCPA 1CY7A 1CUYA 3ADCA 3GFQA 3N2GB 4NDNE 4NHOA 1C81A 2JVKA 2H5JA 2X7JA 3TPCA 4QXAA 4NLLA 3TEJA 3CUEF 2I87A 3IP6A 3QVXA 4O4LA 5F1YA 4AF6A 3RTAA 4ZV7A 2EJVA 3FDZA 2XX3A 4LRTB 2VJYA 3FIJA 4MCIA 3GJRA 9LDTA 2N75A 4FC7A 3ZHTA 1BE0A 4CKBA 2LPMA 1FYWA 3I39X 4RPJA 2WNHA 4O2BA 3S68A 5KOJA 3H1GA 4MQBA 4NWIA 1OW3B 1PKXA 3GJ5A 4XEUA 5EJGA 3TS1A 4YJFB 2ZAIA 2RONA 2ZVPX 4Q4HA 1U1DA 3VC3A 3CEAA 1F9AA 1CF9A 2C1XA 1FJ2A 3AHGA 3EEOA 4ENPA 5U1PA 3PPIA 3WIUA 1R16A 3RYIB 4HGYA 2XF8A 3F74A 3KZCA 3EZYA 4E5KA 2FA9A 1Q11A 3VV3A 1KVRA 3MT0A 5HOEA 4E5DA 1QIJA 2QF7A 5DIFA 4KIWA 1RBMA 3UJ3X 1GZSA 2GJSA 2W7TA 1HE1C 1RZUA 2Q2NA 3HUTA 4DANA 2VNKA 1W9HA 4LHEA 3WAGA 2WJZB 3A1FA 1E2GA 3GW8A 4WJKB 1FS5A 1S8AA 4P7BA 4WERA 2GN2A 1H94A 4GHWA 3VSCA 5JS7A 1QE5A 3EASA 3R5HA 5CGZA 1EA5A 4Z4IA 4N5NA 4GWLA 2CXPA 2XIQA 3MVEA 5LP6A 4FWTA 1GVNB 3LX5A 4NATA 1Q7TA 3C6MA 4PRLA 3TTSA 2FZKA 5KYUB 3GG9A 2DWOA 5HFJA 5DGXA 1W0KA 2PXAA 5AM3A 1NVUQ 4OY3A 1NE7A 4G1MB 2DOKA 4QHYA 2CNKA 3DWIA 4UEWA 1O95A 3SYMA 3AONB 4IO1A 3ORSA 3S29A 1Q12A 4GP6A 3R09A 4XQ0A 4LBYA 3VU0A 1A9XB 5C5DA 5ECGC 2VAXA 2FW1A 3F97A 4DYHA 5L53A 2V0NA 1DAEA 3BA1A 3BB1A 4D9KA 1I7QB 3B20A 4HDCA 2H7CA 1K5HA 1IJBA 4GVLA 4QUDA 5E9WA 3V32A 4QM6A 4OHRA 4DCUA 3F4KA 5KVSA 2AJTA 4EY6A 4G1CA 4KUEA 2IDKA 4HVLA 2RC6A 1NM5C 1UBKS 3GVCA 4QBIA 1I6KA 2IZ0A 4C4PA 2AV6A 1CRPA 1MVLA 2X3FA 3VO8A 1O5OA 2B92A 4HQKA 5EZSA 4FOPA 4PX2A 2G1JA 3MINA 1Y5NA 1Z34A 4CG1A 4D96A 1QWOA 1DKNA 3PXCX 3TSOA 1MEEA 2V7PA 5CFOA 1D1SA 2GK6A 1T15A 4D9EA 3U0BA 3GRKA 2H06A 3ZCSA 4ALJA 3I30X 3WE7A 4BDSA 3U3KA 1P2FA 4GWKA 4CJXA 5BVGA 5ESXA 3E9NA 1O9BA 1UM8A 2XCIA 3AUUA 1MW9X 2HK9A 3DFUA 3FSRA 2QTVA 5B6JA 4R31A 3IOCA 1NFRA 2GJAA 3HB1A 4P83A 1CX9B 5CDUA 2UXBB 2PYDA 5J58A 5FWDA 4JVMA 3M4NA 3DKRA 2LCFA 5ENDA 3EQ2A 3QEMA 3WRWA 2PBFA 2AYZA 2N3ZA 2C61A 4G0XA 3U4CA 2CJYA 2VNHA 4EECA 2RGBA 4AECA 5HYVA 2WYOA 3Q7IA 2WE8A 5T64A 5A04A 4RO0A 2ZBFA 4PHCA 2YV1A 1R4MB 3OHPA 4OGFA 5IT9A 4MZXA 3PNQA 1EDDA 4QGGA 1R8SA 4DIOA 5F9MA 5L3QA 1LWOA 1A9OA 4V0QA 5KB3A 2J7PD 2F7SA 4XR9A 1E4VA 1JR4A 4HAXA 1EWKA 5G0TA 4RORA 5JIBA 2AFIE 2IYLD 3V6LA 4EGQA 4FCTA 3S8YA 1F48A 2ZRDA 3IIEA 4RZ2A 2LCIA 3P9QA 5EMKA 3VO2A 4KGDA 5HW0A 2Z4SA 1C3VA 5DOVA 1KYZA 3JR7A 3RU7A 5AW5A 4H3KB 3VJMA 4XFJA 1YR3A 3EH2A 3I12A 3ZE1B 3PGJA 4BFSA 1FYXA 3E8SA 3VR3D 3ZV5A 1DG9A 1I2BA 3HACA 1FUEA 1M7BA 2UUAB 1U1FA 4IMIB 1CEQA 3PX3A 4Y2HA 5FPKA 1E5LA 2FI1A 3KYCA 2AZXA 4E5SA 1N5KA 3EIFA 2VUTA 2AEMA 1ZGAA 4G1VA 4ASUA 1N1EA 3PPXA 3O3MB 4P82A 4YC7A 4DZRA 4ZT7A 2JGMA 1JT2A 5E7IA 1NLYA 2CW5A 5H3LA 1DZ3A 2VSFA 3ED1A 3I28A 4PLGA 2XB8A 4Q3OA 5I6DA 3R9WA 1HE8B 1KO1A 4GXRA 4Q0MA 4WI1A 1TX4B 1HOXA 1KQOA 2JVIA 3AZQA 3KL4A 3CSUA 1EAMA 5DMXA 5JWOA 1MEJA 5F35A 2C7BA 2Z2KA 1Y7IA 3BREA 1PJAA 2H63A 4X8HA 5B6IA 1EMDA 2GHRA 4Y18A 2NPFA 1R0KA 3W2GA 2D0PB 2XQFA 3GPCA 4RNCA 4F2GA 4GOXA 3KXDA 3KZVA 4XGKA 1KC3A 1UBJS 3FZGA 3N2GA 5A03A 2VATA 3BSFA 1YF3A 3R9IA 2HSJA 4Y2QA 5C18A 1I1QB 1NR1A 3HI6A 3N7AA 2R751 1GGHA 1Y80A 3QE3A 3QTBA 3TLZA 3WRXA 2PRKA 4IOJA 3GO4A 4EFLA 4MLDA 4OQLA 1E2EA 1TC1A 2F3PA 2YXEA 3TTUA 3IQFA 4P3NA 4Q7EA 1UKYA 4YJ3F 4K86A 2V96A 3QUAA 4DPLA 1HNWB 1KAMA 3GIDA 2IQIA 3L8GA 3ZZNA 5B4VA 4D42A 5C8DA 1O58A 4QFCA 3OU2A 1N6PA 2NO1A 2VXOA 4GRDA 2TRSB 2OCBA 4GRIA 3TZBA 4CTKA 4ZO8A 4Q4HB 2WIFA 1R12A 1V7ZA 2QDXA 3M6XA 3D3WA 4PZ0A 2R6HA 3RC1A 1YVPA 2BR3A 1ADCA 2WMNB 4DHWA 1SB9A 2AZMA 1XRMA 3NR2A 2TS1A 3UGKA 2HN9A 2VP3A 4NZNA 4ARVA 4R8SA 3VZRA 3CC8A 1BDJA 1TUIA 3A3OA 4MVWA 1NTOA 4WXRA 4BE7B 4B40A 5LB2A 3WQBA 3W1VA 3Q88A 1H5NA 2NGRA 2Z43A 5C1OA 2F3RA 1NLUA 2DR0A 3DCNA 5HCUA 3QKRA 4JX9A 1N1MA 2XMRA 5FNZA 2R4TA 1J07A 3WNVA 1H6BA 3PQEA 4TLCA 3H04A 5BRJA 2PZKA 1HT0A 4LBVA 4MVJI 1UBUS 3LOUA 4REQB 3A9SA 4LX0A 1CZOA 1PK8A 1HETA 2CMDA 3HKBB 4WOCA 1DLIA 1XSEA 3UT0A 1MJNA 3DA8A 5JYDA 4BX9A 2EFJA 1Y3FE 5CYOA 5B53A 3IJRA 4DCGA 4MDFA 2EU8A 1N6KA 1DC6A 3JTMA 3MRVA 2O0HA 1VPTA 1GCOA 3KCQA 4IDPA 4EHJA 4QG3A 1VJ1A 1AKEA 1V26A 4IDNA 3A6PC 1N5LA 3NBFA 2GM3A 1IPHA 3CINA 3KZXA 3LUKA 4QLBA 1QBGA 1RM0A 4TKUA 3N6RA 5DTIA 3W7AA 4YCLA 3OF5A 5CCBA 2R79A 2XKKA 2PFGA 3HE3A 4P22A 3UJBA 4K0KB 2XZOA 1TC2A 1XTQA 2OWEA 5BUZA 3ZNPA 4R9RA 4IGIA 3K8QA 4LZPA 5FJIA 5DSZA 2EG9A 3KAPA 2W6JD 4UDXX 3U4QB 2PQ2A 3FM9A 3G88A 4EFDA 5KX5A 1ZOLA 4PSVA 3VSDA 1O6CA 4DVGA 2FZCA 2WIGA 3QEJA 5EZQA 5TV2A 3B1YA 2R4UA 3CU5A 3DZKA 2Z3VA 4FYIA 4GYYA 4RHTA 1PFYA 3AF5A 4WKNA 4KQJA 4Y0NA 5EY5B 3IEPA 1ZJWA 5KKNB 3GEHA 1WB4A 3H2BA 5JH7F 1R0CA 4M1MA 2I67A 2BDUA 3TOXA 5LJIA 1U7PA 3UMGA 1SOMA 5IM5A 5ANRB 2NU8A 2QVXX 3NC1C 5TB5A 2H1IA 2AFHB 4DV7B 2A0XA 1N4DA 3ZE9A 3IE1A 1YA6A 5I7RA 3D8SA 2AG0A 3MA0A 4U2FA 5LZ7A 3TXAA 3DXZA 3AEUB 4RSGA 1OXUA 4H16A 1JGTA 3HJUA 4CM4A 2GJ4A 1F06A 4NONA 4KPUA 5I7VA 1KI7A 5SV2A 2DT8A 4FI3F 3ZVNA 3F1KA 2VDVE 4KPFC 4LXQA 3AXTA 4I5EA 3RVNA 1TT7A 4ZCQA 4C0QC 2X42A 3INYA 4DF3A 3CZ4A 2CDNA 3L0ZA 4HDSB 3IUNA 4YRPA 4KEAA 6ADHA 4F4HA 2A1UA 3PICA 3QVTA 4ZVLA 3L8CA 3GUYA 4J4HA 4CQMD 4DLRA 4Q05A 4CKCB 4KPYA 5D3KA 5B57C 3OPYB 1NJ2A 3IGFA 1KYXA 4Q9KA 2F8TA 2O9JA 4G2NA 1TKAA 5GVSA 4E88A 4KRYA 3PDUA 4C21A 3QKSA 2DSNA 2XVMA 4B3BA 1MX3A 2R0QC 3LUPA 4FYVA 4DMMA 2GD0A 3KJFA 3HBFA 3N8HA 4WZBA 1UXIA 4J0DA 4XD7D 4X00A 4F5YA 3FRHA 2LIVA 3ELWA 3JQEA 1NXSA 3ROPA 1ND5A 1XQYA 5IBQA 5IH3A 3FVVA 2H0QA 1J20A 1J7JA 2LR0A 3HI4A 3M1YA 1GZ6A 4HNVA 1EVZA 4YIKA 4DM3A 1G17A 3W4JA 4XWTA 4LJ4A 1HZZC 1CZLA 1LBEA 3PJFA 4NCKA 1M72A 4PC3A 4PTZA 2JPDA 3H3XA 4TMFA 2J4DA 1ZK1A 1CUXA 2C0PA 4EY3A 1COWD 1ISSA 6CHYA 1WQ3A 1Z2NX 3DLPX 4O4IF 4D9MA 2QXTA 3D4OA 2X76A 3Q11A 4G8DA 4R2WA 4D4JA 3ZHUA 5FDFA 3H4MA 5LQCA 1LNQA 2GWRA 5F52A 3OJLA 2B2NA 3KZOA 1V35A 4MGEA 3U62A 5I7FA 5B1DA 3SLKA 5CT4A 3U40A 5KWIA 1QC5A 3IILA 1Y5LA 4H1HA 5AUNB 4LTMA 2IRWA 4M1OA 3HCBA 1DO2A 3K1YA 3LRPA 3QUSA 4QOSA 4MB2A 4EM6A 3U13A 1ACLA 1G5FA 3A4MA 1O97D 4GYWA 3RTBA 5GGYA 1JHOA 3ZWWA 1K0FA 3KKKA 4IM7A 2WSSD 5B1HA 1TM7E 1KNQA 1NN5A 3Q10A 4INJA 1S0UA 1Q1GA 2DUMA 2GJ9A 4BO8A 4C06A 2G36A 2PUHA 4YRJA 4W8GA 4JBGA 1ZIOA 4YNBA 5D7BA 2H1FA 5JMOA 3FTFA 1PJZA 2Y71A 2R7MA 3E0QA 1PUJA 3QMPA 1RJ9A 3GJ3A 1RWNA 3K0BA 4YFVA 2IS2A 3UK6A 2Q4BA 1WQ1R 3OY7A 1HDXA 4TTVA 4DMKA 1MV5A 5L3RA 1J2TA 2AMFA 1IBRA 3SZGA 1RR6A 3E7FA 1LSOA 1A2QA 3LWBA 3PB3A 4J7CA 4IH4A 4P0TA 3F7NA 4EBBA 1FFXB 3DE1X 3NLLA 4QOFA 5KHLB 2G63A 3SEQA 1EFRA 3QE9Y 1OYYA 1INLA 4JFAA 4F12A 2F43A 3CEMA 4PZAA 4QYIB 2PSDA 1ABBA 2FETA 5AJYA 4H7JA 5AVKA 3WIEA 2IPOA 1KH2A 2V5UA 5H5JA 3RVMA 1XPRA 4J1QA 4P7KA 2WSLA 1R0ZA 3BFXA 3CEHA 3EXFA 1P1JA 1TF7A 1O1YA 3FCCA 4HNRA 3U48A 3UMYA 3QSGA 1MV8A 4O3FA 4A92A 3Q2OA 4BNDB 4CW7A 4D9JA 2OZLB 3HJGA 3QENA 3GJ7A 4MYCA 1OSNA 1IIBA 4NZOA 4U7HA 4X63A 5I7WA 1OOEA 3DEAA 4GVPA 1XCMA 2IPAB 4XUEA 2P9ZA 4MIYA 5I8PA 1N2CB 1GQSA 1YC2A 2E87A 4RIGA 1IOWA 3T9BA 3FYSA 4L3VA 1FY2A 2PKCA 2QT1A 1H0RA 1TGVA 2KS6A 1TEVA 2YS6A 2DE0X 2HDHA 2ZBRA 4M9SA 4RA9B 2OP1A 5CIQA 1YZVA 2HF2A 1ESMA 1QBKC 2PIAA 2Q6OA 4PWYA 4WVLA 4RDCA 5K2MA 1B8NA 1JXOA 1X39A 3WQRA 2E1PA 3D2LA 1J8MF 1Z5GA 2VAWA 1QK4A 4IQ4A 4XGIA 3SHVA 1ZK2A 1L8AA 3OURA 3OKCA 5H9WA 2VWQA 4R40A 4EPRA 2VC2B 3A3NA 1VHJA 2A92A 4PZLA 1V39A 3NVMB 3VNBA 2B34A 1ORDA 1ACMA 4HVAA 2J3HA 2XKJE 1NG1A 3WBJA 1PBTA 3ONNA 2GUWA 1VHDA 2B1RA 3DFFA 4HDAA 4C0AC 4DUGD 3WIBA 2PX0A 3AIOA 2ZRAA 3O8LA 1PWYE 3TGWA 3VTFA 3U4QA 1DZIA 3BFVA 3EB9A 4FC6A 4P3XA 5LP6B 3G0CA 2X1MA 2Y05A 1P3JA 4DSNA 1FP4A 1Q20A 4RMHA 3KALA 2R1UA 1ZXBA 2RGYA 3AY0A 4BKPA 1XTUA 3DVSX 3E22B 4UATA 4UW9A 3SBDA 5BSWA 5LNK1 3DQQA 3HABA 2HH9A 2CDRA 3EPRA 3O6VA 2E6KA 1JTEA 3QEOA 4M0FA 4N1AA 5SICE 2NU8B 1E98A 3ZCQA 2AFHE 4YCBA 1KOJA 3NANA 2PH3A 3KB1A 4JEMA 1C3JA 1EXMA 4KAFA 3RBVA 3RVKA 5AK4A 4US2R 3ZBPA 2B9VA 2IYFA 3E9CA 3W2TA 4X20B 4B6JA 4BV3A 4E2XA 1A8IA 4U7FA 3HO1A 1RTKA 1DO8A 3FLBA 5F9FA 4ZVMA 2CXSA 3AR3A 3REQA 1JXAA 4OIMA 2OHXA 4P33A 4YDSA 2C1ZA 4X93A 1H2BA 4C2AA 4L8VA 5CFZA 2FPUA 3HKEB 4FGZA 4YCCA 1TKBA 2H08A 2HPAA 4C0KA 5EINA 2Q1UA 1XF9A 5GJWC 3DTYA 3WRXC 2FR8A 4V1CI 4HBZA 2WTUA 4JYPA 5G0SA 1SUWA 3C8ZA 1W36D 4UU7A 4LGMA 2GOYA 2J1LA 5BYJA 1IATA 4DA8A 1TAQA 1UC4B 2XMCA 1GSAA 3OQ1A 3HA2A 3ICCA 4IIVA 2MYNA 2R6AA 4GBGA 4MJXA 4RKRA 4B4UA 1POXA 4ILKA 3WKAA 1SAYA 2VHUA 1HG0A 6AT1A 3NPAA 3N8GA 5F77A 3ECCA 2V5VA 4DRXB 4FWBA 1SUBA 3QKSB 1OBCA 4FFDA 3UMJA 4JP5A 5IG2A 3EK2A 4C20A 4K7JA 1MFZA 1NMZA 1ZK0A 1Z8DA 2HWYA 1FK8A 3LUDA 3QWBA 1EDEA 4QGFA 2X9QA 3MXOA 4MMXB 2F2TA 3FRJA 4X1OA 2KE5A 5IU6A 1G4UR 2PLAA 2WLSA 1RS0A 1ZD4A 1IMJA 1VLVA 2H3HA 2JCVA 2LKDA 2VQDA 2JHGA 1NZJA 2ERXA 4KYUA 3W5JA 2V6JA 2W2XA 1CBUA 5DH9A 2IJGX 3L4BA 1MRNA 4EEXA 1U1CA 4RUKA 2GCOA 2Q5QA 4J7UA 2J6HA 1WMAA 3JQ7A 4MAAA 3HYSA 1GTG1 4TUYA 3VU9A 1I5OA 4PNPA 1DBRA 3MCAA 4ZZ0A 2Q5FA 621PA 2GILA 4AN4A 1ISGA 4ZYVA 3R3UA 1DKMA 2OBNA 1ATZA 2OMEA 4Y1GA 5BSGA 1S8FA 1SKYB 1NI5A 3K1TA 3OVMA 5JQWA 2OO3A 1BOOA 1JH9A 2I34A 4MGYR 3GRVA 1E3IA 5CX4A 3TZHA 2NO0A 1RXYA 4GMXA 5L7TA 1RC1A 1YQ9A 2WQ7A 1JN0A 2E49A 1E2JA 4RTNA 4YCDA 4P38A 4G26A 1L7QA 3AEQA 1FRFS 2H8KA 3PC3A 1RSZA 1AQJA 5F33A 4NSNA 2AJBA 1R4ZA 5IAGA 1I7LA 1VKOA 4CODB 4AJIA 3HUFA 3HJBA 2WWHA 1G9SA 4TS9A 5D2CA 3WYFA 3DAYA 4V03A 3R1IA 2HHJA 4A27A 3GAFA 4P0PB 1LX7A 2ZU6A 2J9RA 3ISVA 4GPD1 4FDAA 5JSKA 3CKKA 3F9IA 1Z6YA 1XAGA 5B37A 1XUOA 4RU1A 1GG2A 2IK8A 3LZCA 4LK3A 4MQEB 2QHXA 3ZE8A 4BVFA 4C0XA 3I5YA 5FPSA 3TRIA 1II0A 4P7FA 4XARA 4D44A 2FMTA 2GVNA 3NP9A 4QOJA 3FWPA 1V1RA 1Y8AA 1GNQA 4WLNA 5ALSA 2FGJA 4YREA 3LX4A 1FTGA 3ELYA 5ALEA 4GLLA 4MYTA 5DB4A 4U5QA 4Q1FA 4GQBA 2NSJA 4IEFB 1CUJA 3AZPA 1HRDA 3C1TA 3CX8A 3IAS1 3KXPA 4ZOLF 1NSYA 5ARCA 5JXHA 1EFLA 2OO5C 3RARA 1OKKA 3KVNA 4KKVA 2FR1A 3SC3A 4QQNA 3OQMA 4QGBA 1W35A 5CNKA 3OOEA 1PKEA 3SR0A 2C2HA 1Q0LA 4PXSA 2Y0BA 4PNHA 2MSDB 4UAGA 1BVHA 3ZWYA 4TV9F 1TZBA 3IQWA 3X1WA 3ZK8A 3ZZUA 1O96B 5TQVA 4ZVOA 5C37A 3D6NB 4RD1A 2EQAA 4REQA 4MQ4A 1N2CA 3L6EA 1QV9A 4GX2A 3JYLA 3VPDA 2ZVQX 3DVQX 4RWZA 4XYMA 3D3WB 1SOVA 4PFKA 4ERNA 1V43A 4U63A 2YZMA 3ZJVA 4P4UA 3P9ZA 4AMZA 3U3MA 4WW0A 3NTQA 2V4UA 2IDMA 4F6RB 3IHKA 3RUDA 4L51A 1Z4NA 1FW8A 4EPXA 4JXZA 2HWKA 1DMSA 1MB2A 4G9BA 3E9ZA 2HUNA 3GGDA 1YDHA 4IICA 4Z0NA 2QQEA 3IIJA 3TW4A 3UATA 4Y6LA 4QDKA 2BISA 4HF7A 3IQZA 1ZLXA 4L08A 1BHO1 3HNRA 3TQCA 2NP7A 3T7AA 3ZQKA 1EJBA 1Z5ZA 1AQNA 3AT1A 2GEUA 1OE0A 1VP3A 3GP5A 4HLDA 4W5OA 2IPXA 4QXMA 4R1SA 4ZANA 4MYRA 3M3DA 3G2NA 3QEAZ 2HI0A 4TMZA 1XWFA 2Y1FA 3K9BA 4ITVA 1G16A 1CQJA 3K8OE 2YBEA 2BJWA 1PUXA 3G5UA 2AJLI 1KZ6A 1LY1A 2WG2A 1C9YA 3CPSA 4FIDA 5G0UA 5U9CA 3Q9SA 4GIBA 1GZUA 4OX9B 1JG1A 1RM5A 4XIGS 2RC5A 5T3YA 3NTXA 5HS6A 4YTEA 1LTKA 4Z4HA 3SNKA 4YMLA 3C3MA 4G24A 5FLYA 4KIGA 5B58T 1M6YA 4W1PA 3KSMA 3QE0A 3Q8LA 1YS9A 1EIZA 1D5CA 3VI4B 5LMUB 3PHJA 3ENVA 1NJGA 1R9GA 1TZKA 2EZTA 3BJMA 4I3GA 1K8QA 4TXNA 3BDAA 3ZHOA 4AKTA 1YRYE 4RVNA 4ZVRA 4E12A 1KQGA 4FFOA 5C52B 1EP1B 3IAEA 5LZ5A 1XJ0A 1NBMA 5DI3A 1ZA1A 3N5KA 3OQIB 3L9XA 5AWFC 1I10A 3UAYA 5DNDA 3UMSA 3BT7A 3C4QA 2PJZA 5CFMA 4BJ6A 1N9GA 2RAFA 4R98A 1G55A 1D09A 4ZT3A 2OEPA 1LDNA 2X22A 3AM1A 1DRVA 1Q16A 2J9ZB 3KUKA 4RY0A 5D6NA 3TQHA 3ND9A 2AR0A 3AR6A 5G0WA 2KSQA 3VO9A 5B3LA 2Q8NA 3GZ4A 5FPYA 4LJKA 2Q0QA 1XZBA 3S3TA 1O9HA 3UJ6A 5ES4B 3LHSA 3O8DA 3B9RA 3BCSA 5AK0A 5K3BA 2QVYX 2W37A 2YYAA 3AUKA 3DVRX 1C8VB 3T3HA 4D79A 5AW2A 3VR4H 2QAGA 4YUAA 1MA0A 4D9GA 1OC4A 2YXBA 1LLFA 1DEOA 3H42B 3PNMA 3WHIA 1G20A 4NFSA 1J21A 3AIMA 3D5EA 4TLAA 4NBWA 1ORTA 3TVTA 4WLFA 1TLLA 2QD3A 3EFEA 3OWHA 4IIXA 2N46A 1SXPA 2I2DA 4DCJA 5HUQA 3A3PA 3BJIC 3P71T 3SQWA 3AX6A 1ADJA 1KK3A 3MC1A 5EE9A 5A7FA 5C8ZA 3GAMA 1L5ZA 4FONA 3GFOA 5PNTA 3ZU6A 1P29A 3NEPX 1N0UA 5FI5A 4ZZIA 4FS8A 4IUCS 3AY3A 2IXBA 3TIGA 3EWIA 4UTZA 5ALQA 2JAHA 2Q6VA 3TTVA 3W8FA 2JG3A 2O7QA 4BAGA 1QSGA 5DLQC 3AVUA 1GL6A 1LB1B 1ARZA 1RVV1 5CM2Z 1MVNA 2FSHA 3C48A 3BERA 1P44A 3NCTA 5J4YA 2ISSD 1JAXA 1DE0A 3L5KA 1P3DA 4Z2YA 1OIWA 3UCXA 1B2RA 3I0ZA 4GM4A 1Y1LA 2WFAA 3VISA 3H2HA 1TCVA 4MGKR 3N0TA 4CF5A 1AZSC 2H2FA 2RGUA 4EYQA 3VR5A 4Q18A 1L9KA 3ODPA 4EGSA 3C7DB 2WDPA 5TSDA 1YS7A 2QTHA 3OCWA 5AVYA 2I65A 4ZRDA 3ZW7A 3RBAA 4GPEA 3THWA 1JKXA 3UJ9A 3HB9A 3PQ4A 1QIFA 4OJTA 5K9ZA 2QVLA 1NW4A 2F1OA 2GCEA 1RWVA 4JFRA 3ZDEA 1R27A 4OPMA 2J0VA 1HNNA 1CP2A 1ZOPA 1N6LA 1VYHA 2WIKA 2QRMA 4XM0A 1GPAA 1CUVA 2HD4A 5DDIP 4BFUA 5J3JA 3ZQJA 2Q6IA 5ALZA 2PZEA 1A7AA 2VPIA 2PMFA 5H02A 5P8WA 3WYEA 2AOWA 4C7VA 3X2SA 1CY4A 3DE4X 1OWNA 4IGAA 1NI3A 3LJKA 1OFIA 3UHJA 3RLFA 5BN4A 1JG4A 4E4RA 3VYRB 2QZ4A 3EDQA 2OFFA 1YJAA 3FB4A 5KAPA 2Y1KA 4E21A 2GK3A 2JLSA 4QFBA 4CDMA 3CGWA 3PF8A 1QAMA 4D8VA 3QLVC 1WZIA 2BHLA 3IP5A 4MSUA 4BAZA 1QH9A 4PVCA 4CMKA 4YUZA 4PN3A 3O0DA 4FTWA 3CR7A 3I73A 1JJVA 5CNIA 5JCPA 1NT4A 3MB8A 3DOJA 1E2MA 1KETA 2EW8A 7GPBA 5EN4A 5A3JA 3EPHA 3H5TA 4MV3A 4Z51A 1U2SA 1XVLA 1HTWA 2PKXA 2UZ1A 2X9VA 3R8CA 3EBLA 2XQIA 1K63A 1IZ8A 1W76A 2MWMA 1I8TA 3F9CA 4L07A 2Y0CA 1XR3A 2PZGA 1TK9A 3K9GA 3P94A 1TQ8A 4EF5A 3GLIB 3PGA1 3E3LA 2XTMA 1TO6A 2A9OA 2BAGA 2X0JA 1WPQA 4H4CA 5ADUS 5IANA 5KQPA 1W1IA 3BWVA 2B20A 1YVDA 4U9UA 2FSGA 3BDVA 4IIUA 1BW9B 4ZOCA 2FPRA 1CR1A 3VR3A 1LBHA 3CRQA 4NAVA 3B89A 2O5RA 1XZFA 3T7EA 2ZE8A 1DJOA 4LJ5A 2QTRA 3FCOA 2PIDA 3TBHA 2OCGA 1IONA 4IZOA 3S4YA 4H1VA 5H0IA 1EDBA 3KXIA 2O23A 4W9NA 5F5NA 2WD9A 2XMZA 3EQ6A 3GUHA 4HDNA 4ASUD 3EIEA 4L7QA 4JLSA 3EWAA 4NJMA 1JMKC 4WUTA 3KEOA 3EXFB 3PQFA 4OP2A 2JKVA 4I2VA 2HIHA 3KOUA 4M89A 1C1DA 3SOPA 2SCUA 3NW9A 5AHXA 3FIUA 3WGGA 3ZX4A 5K0CA 1YR7A 3MEQA 4Q19A 3DHNA 4QYTA 2FFQA 3CPJB 2GM5A 2UU9B 5GZ6A 3ESXA 2Z98A 1T2AA 4NNOA 4OUKX 1J5PA 5DV9A 2ZUEA 3B6EA 3HEAA 2R4QA 1YIOA 5CNJA 2ZU0C 3WXBA 5FI1B 1GDHA 3JQFA 2JIZD 1ML4A 1E58A 1N7HA 3QX7A 5LQKA 2ID4A 3DMYA 4A2WA 3INNA 1ABFA 2B36A 5I9MA 4B2LA 3QHQA 4EA7A 5CDFE 4QBGB 3LDUA 3L01A 4I5GA 4X1KB 3U3XA 2ZJBA 4E46A 1JXQA 3A1DA 4B3SB 4HAYA 4I5FA 1OQAA 2YOGA 3J81k 2VG8A 4YEDA 5AW9A 3KVOA 4ZIRB 1YCFA 4UBKA 1K92A 4Y6QA 1M2HA 4IIEA 1MBZA 4DNOA 5JISA 1Z6GA 2XUPA 4EGJA 4RPGA 3TIVA 4TTPA 1F17A 2GNPA 1U9ZA 2CHQA 4GPAA 2Y68A 1X38A 1XRRA 3B2QA 3HKEA 3LY8A 4PGHA 3VV2A 2WF9A 3UTDA 5K0SA 2QV0A 2QRVB 3BGDA 3IPRA 1HNZB 1DEHA 3P9XA 1N8TA 1THZA 5G02A 5B3KA 4TL9A 2RCYA 4BWFB 4IDQA 5IT5A 3C3XA 3MOSA 1PW5A 3L7MA 1DJLA 2JKYA 3PNLA 4RD0A 3OE7D 1VSQA 2QTMA 2WZDA 4HDQB 3TFQA 3WK6A 4PLTA 5T3UA 4EKEA 4QPJC 1KEZA 2JH9A 3QFTA 3V6MA 5K7SA 1NPTO 2JGDA 3AHJA 1I01A 1VG0B 1J5XA 2WU0A 5JAUA 2D2IA 2B2XA 1QRDA 4O33A 3L7AA 4MV0A 3DVLA 5JS8A 2G5GX 1R5JA 3C8DA 1E5DA 1HRKA 3G0IA 2ZRNA 3O3OB 1HT3A 3LCUA 3RO7A 3T34A 2BHNA 3H2KA 1DUVG 3DTVB 4E0BA 5DKFA 3TXYA 1HZZA 1NKVA 2HKIA 3PXAA 2G8NA 4IDDA 4OMCA 1UBSB 3VBEA 2IXFA 1E3WB 2B7LA 1UJMA 2BBSA 3P0HA 4XQ9A 2X77A 3SJZA 2GETA 1DFGA 3KPWA 3Q0IA 4CR8A 2HNAA 5BV0A 4J0FA 3G2QA 1XEWX 3KTAB 4TTJA 3LCJA 2HA2A 2XODA 2G9VA 3GJXC 1VPDA 1DQZA 2GD1O 2Z2XA 4HGRA 4BATA 4AZ0A 5BN1A 4BFVA 1L0BA 3DV0B 5IFLA 1WHTB 2C3OA 1PIWA 4F2HA 3EXEA 1X1EA 4HY3A 2CLFB 3GI1A 3KZKA 2FN7A 4WY2A 3EAGA 4YAFA 4MUXA 2B4KA 4NPHA 1AV6A 1OFTA 4KGXA 3SKXA 4DNXA 2NZXA 1JI3A 1X8XA 1YUMA 4KG7A 4MWSA 3M81A 1T1JA 3ML1A 1V6CA 4S1OA 3T94A 5COAA 2F8MA 3WFZA 5ES3A 4XRGA 4YJKA 1MTZA 4JLUA 5IWCA 2AOUB 4RW0A 3OE1A 5EI5A 3K0FA 3AH8A 3I01A 5EJFA 4XYGA 2O2SA 4Y1EA 4DL9A 3U7FB 2DBQA 1T8WA 2FPKA 3I9V6 3QEKA 1XK7A 3KYDB 1E7MA 2CNOA 3CKLA 3I2FA 4EQ6B 2W4MA 2R97A 2WHPB 2QQ0A 1RE0A 4NX2A 4GW3A 4CIDA 3HR4A 2GYYA 2FPMA 1P77A 4DLXA 4RVCA 4EEKA 4X9XA 2UDPA 3AF3A 3FKJA 3AU8A 1OR8A 5KNCH 1YTUA 2F8LA 3EMVA 4LYGA 4C0WA 3AERB 5HGXA 2BZ0A 1GG5A 1Z22A 4U0JA 2GNOA 1VKNA 2A3RA 1QHHB 3ZY4A 1CEXA 2HF7A 1XMSA 4U2CA 1XHEA 5JE8A 3CUTA 3DHEA 1G5HA 2O6HA 5EHNA 3LI2A 4Z0TA 1FFWA 1OA1A 4CQMB 1ZRMA 3EX7C 4FVTA 4ZYLA 5I4CA 1IOLA 1U2GA 1SOUA 1G7SA 5FBLB 5EYPA 1MO4A 1L1EA 4UDOA 2N9UA 4UE6A 3MPUA 1VBNA 1HTTA 3HXOA 1C0EA 1Z4QA 5ICMA 4S1WA 4WASA 2YFKA 3USZA 1KMHA 1RLOA 3STWA 1DGQA 2ZFUA 4LECA 1SY7A 1CQWA 3IQHX 4FLFA 3K0EA 4EUSA 2APJA 2RBKA 4EG1A 1OH6A 2VQ3A 3K8ZA 3I2IA 1SHKA 4D4GA 2ZDGA 4HEJA 4JNCA 1DAHA 2HA7A 2G06A 1SPXA 2BCEA 4DR1B 1I2DA 2GTIA 4CM1A 3B2NA 4DAEA 1O2DA 4B4DA 4MQFA 4XCVA 5JSHA 1NPYA 3LPNA 3IBTA 2EWMA 3TMKA 4M9UA 3UJHA 1JR6A 3B1FA 3AKCA 3ZDYB 3U44B 2CXOA 3H1EA 4TWRA 4F6RA 3ZKWA 3RAJA 1W47A 4FK8A 1VKZA 2LVBA 2Q29A 1UK7A 3H8SA 2ANCA 1PDVA 4NJMB 4WKBA 5KYGA 2QOEA 4PYJA 4H31A 4O8CA 4BXOA 4RXTA 2BFWA 2RD2A 3AV0B 1OX5A 2VTBB 3FSGD 1T0PA 3BAZA 1Y1SA 2WVHA 4JLMA 1ELOA 1OGIA 4LBWA 1JFVA 1REQB 4UHJA 3LF1A 1WUIS 3F6RA 3AGQA 2C7OA 4OOFA 4ENRA 4D8XA 3QF4A 1W9MA 4UAUA 4BECA 3ESAA 3PFBA 4G1FA 4JOSA 4LYYA 1IZZA 2VHXA 2CN1A 2V45A 1E69A 2QR2A 4R9NA 1D3AA 2Y6UA 2YZ7A 3ZLVA 1UKEA 5DT2A 2NMVA 3IMGA 2BGTA 1V16B 3NNSA 4R6XA 1I7PA 4ZQIA 4ZAZA 5I7AA 4YRQA 1CR6A 1QHEA 3NPMA 4AY3A 3PA8A 3NGXA 3P45A 4DCTA 4ZK6A 3ZDCA 4U3JB 2PT9A 4W7HA 2FOIA 3H2JA 1R66A 3I01M 4JT9A 4CL3A 1BX0A 2EJCA 5ALFA 2BN4A 3WNBA 5J23A 4LPSA 3IPCA 1O0CA 4DGSA 1FJXA 4ED9A 5FJJA 4NZPA 3NAZA 2Q28A 3C97A 4J0JA 2GN4A 4OLHA 4ATNA 5LDDC 2JCSA 1BDMA 3NH9A 1YK0A 2PX5A 1PJ2A 3O7WA 4B0OA 2NAPA 2I1WA 2QLTA 2ZPUA 1EFRD 3RHSA 4AUKA 4PZ9A 4YR7A 1RQLA 3OPNA 3VC2A 2PUGA 5TQJA 4N76A 4IWXA 4KQMA 1F51E 5DCYA 3I3SR 4G5FA 3MLAA 1GPH1 1J9GA 5LA6F 3ZTWA 5BV2P 1XVAA 2RE8A 3ZX5A 1D6NA 4G5XA 5TDHA 5G4KB 3HXLA 1ZGGA 4IVQA 4PYKA 4YAWA 1KY4A 4N5MA 3SYTA 4GUAA 1EWYA 2QN9A 4N47A 5AD1A 2E4UA 1YCHA 3FHCB 1UKVY 421PA 4R0VA 1WXWA 2X3YA 3Q6NA 1Y9AA 1CTQA 2WVGA 1MT3A 2R1ZA 4XX0B 1TYDE 2CB0A 5FAXA 1Y8RA 4W99A 1VI6A 2PZFA 4MWGA 1F4PA 4FMCB 4OJMX 5BWBA 4YMUA 4O02B 1XZEA 3PNYA 4EG0A 3R41A 3EG9B 1WL8A 3OLWA 3WSWA 4UBMA 3RS4A 3CB2A 1E5TA 5JS1A 3IOYA 5KOHA 3JYHA 1LJ8A 3TX6A 4ER5A 4I99A 4I8IA 4MV5A 3WRVA 3TSAA 4XCQA 2OZEA 3G79A 2FN9A 4ALLA 2O20A 4DKXA 2AKEA 3LQFA 2D6FA 5JSZB 5K3FB 4REOA 4QU5A 5GGXA 3LO8A 2E6UX 1CFZA 2PS3A 1KIMA 2QV7A 2HDOA 3C5VA 3M2PA 3N3AC 5DTJA 1HTBA 2O3UA 2QAGB 1W0CA 4HQOA 5AKXA 1HORA 5DEIA 1MJ5A 5JVDB 3KKLA 1G20B 1Q14A 4A6DA 3GCXA 1V41E 4UNRA 2ZI7A 3MJTA 4MUBA 3AUJB 1JHMA 3QIAA 4CI0B 4CGZA 1AG9A 1RWBA 2CYBA 3HB5X 3AHDA 4GC5A 5A6SB 3NKLA 4IIJA 2IHUA 4YWHA 2DBRA 2PUCA 1NUPA 3VKUA 1JSCA 4YAEA 1UUFA 2BGLA 2UXDB 1JFLA 1YRBA 2C4WA 2I6QA 4RTRA 1Z26A 1H4SA 2R7AA 2A33A 4KXVA 4TLBA 1FA9A 1MX5A 2D62A 1YCGA 4ESEA 2EQBA 1T9GR 2Z1MA 4YJDA 5IZCA 5KWVA 1YVRA 1QO0D 1JXMA 1SKBA 4DT1B 1GFWA 2CZGA 3JD1A 4BCCA 3L4BC 2R85A 1WW8A 3L7CA 4L28A 1KPHA 2PLWA 3EGCA 3H5VA 5E9QA 3JZAA 1EE2A 1U3TA 2BEWB 1FBNA 2ISCA 2NG1A 2NLOA 4G4SO 4H7KA 3V55A 4EATA 4GC9A 3ZJTA 5F5LA 2CF6A 4I9GA 1NQWA 3NUZA 1N1GA 1YVUA 4AX8A 1UMCA 3I72A 3JVEA 2WB4A 3SXUB 2M32A 5FD8A 4I6EA 2HCBA 1ONSA 3WNQA 1SKUA 2MMCA 3EIOA 4HDMA 4IDAA 1T6YA 3PUKA 1Z73A 2C7VA 4CMBA 2JAOA 3R6LA 1TYCA 3WK8A 1GKIA 2NV2B 3H1BA 2Y0EA 3CR8A 4R9SA 2HWXA 2WYWA 4LY0A 3AESB 3COZA 1M5UA 2CFTA 4JI1B 4A9AA 3VA7A 1EGMB 2IWHA 5IAEA 4B4OA 2FMUA 4D46A 4YACA 2ZI6A 1DINA 4HAZA 4Q1VA 1G6KA 3KETA 3AF4A 5EMNA 1JJIA 4R8KA 2QX6A 2ZSEA 3NHMA 3HB7A 1K2VN 3AFGA 3DAHA 2NU9B 1N5RA 2VSQA 3HH8A 4HAUA 4DVJA 4F4IA 3DMTA 3F7TA 3DBHA 1AQYA 3HFJA 5FAKA 5DBFA 5DYTA 3QW4B 2AI3A 1C7FA 2EL9A 4DV0B 4DQVA 1CY2A 3N2EA 3Q0EA 3C3WA 3CNEA 1GR0A 2X1LA 3ASVA 4IEEA 3F0TA 1RYMA 1JQEA 5P21A 5GJBA 3BZUA 2PAFA 3L0PA 4YS6A 1ZIDA 3TIFA 3L1KA 4E31A 3CM0A 4GR5A 2FUEA 1SVNA 2ZYVX 1JX6A 1JSXA 2QJOA 3KQVA 4IXWA 4RF4A 3Q3GE 5HF8A 3RVBA 4TT3D 4ZJZA 1I0IA 3BIFA 2RHTA 4U6NA 1P8JA 1FTSA 1O6FA 1XTTA 2Y2UA 4PXAA 1OFUX 2JIOA 4WTOA 4F85A 1T3SA 5JRDS 1ZHHA 4PSUA 3IA7A 4MWZA 4C29A 5EJAA 3P32A 4ZYZA 3IP9A 1VRVA 3BWBA 4QFMA 4ZCLA 1XN1A 2J08A 4AYXA 1X9IA 2VIIA 4QXRA 1I3NA 1N6HA 4KE8A 1P6XA 4Q3NA 1YHZA 2A3NA 2VPWA 2GCPA 4PO9A 2OG1A 3ROTA 4OI0A 3BIXA 3QQ5A 4I4TB 3BG5A 5DHRA 1JVSA 1RYZA 2HRRA 3BZBA 3TUIC 5LYJB 2ZYIA 2PUFA 4M53A 2PG3A 1IYZA 1RXEA 1ZCJA 3HLYA 4Z53A 4IRXA 1FSZA 2P5TB 3H6GA 4W8HA 5AI9A 2IL1A 5IAKA 3D4BA 3FW1A 5LB4A 2JH3A 1SKMA 1GHTA 1C3LA 3HBJA 4Y67A 4B87A 3RIEA 1ECCA 2JAUA 1PT8A 3WHPA 1KTIA 1DADA 3PKIA 1XZHA 1E32A 4ICIA 2YXPX 1DELA 4CKXA 1BDIA 2B7CA 4A2QA 4GPBA 1WKCA 1D6SA 3AP3A 3TNJA 5T4HA 4C03A 4HPWA 4F91B 3EUWA 3DM5A 2FZVA 4DCOA 3ICOA 4FYHA 5CNMA 5IT0A 2PM8A 4TRRA 2MJLA 1R5BA 3E23A 4DLBA 1KOGA 2OUKA 2X4LA 2REQA 5HZMA 3HCNA 1GPMA 5CX1A 5AJZA 3CH7A 3F9RA 1Z6XA 2PFKA 4YAUA 1MJGM 4ZRNA 1XZJA 3C85A 3G8DA 1FLAA 4FUQA 1W5BA 4I1YA 4U9IS 3TW0A 2G6BA 5FOUA 4IGKA 1X42A 1FFDA 1M7HA 2FEAA 4ENSA 2OCLA 3D3QA 4CI9A 3WL4A 1YB7A 2FFBA 4MZDA 2EP8A 5C8XA 4L5CA 3TB6A 1KJ8A 3DEFA 3K16A 3IDSA 4R2KA 4RPHA 4JI7B 3DB2A 1KIFA 1V0JA 1WABA 3CEPB 1TUGA 4PG7A 5EWLA 1DO0A 2Q6LA 2P9EA 2CV0A 3OQVA 4OD0A 1YE5A 5KI6A 1NXTA 1F3OA 1YQWA 1G42A 1TEHA 1VE9A 2DM6A 2OFWA 1H8HD 2ZUCA 2YQZA 2AOTB 4ZAFA 4HNUA 5JDIA 1ISJA 1CDEA 2QJRA 3Q9NA 4FR0A 3QV2A 2W48A 2VDPB 3ABSB 4I08A 3V7UA 5BMOA 1VLQA 4DZZA 4WXEA 1QQTA 3T7CA 3V4LA 2HSWA 2IYAA 1VJDA 4HVTA 1ONNA 1W94A 2I3AA 3QNWA 2B82A 2QL9A 1RI2A 2R8EA 4QTUB 4W9MC 3ZWNA 3Q5DA 2CV1A 3LP8A 4TMXA 1F2DA 1A5AB 2C9YA 4U1RA 4W9NC 1CHNA 1OREA 2AG5A 1GQOA 3AETA 4KW7A 1NQ5A 1OLUB 2G9ZA 4QE3A 4ZPJA 5KWEA 5FX2A 1TZCA 2XZPA 2VBGA 3BJZA 4K40A 2ZI5A 5CCEA 2HJ9A 4JR2A 1Q1BA 4YWJA 3T7RA 3VYTB 2BGJA 2IY7A 2VNIA 3I52A 1RADA 1EFVB 3VSEA 3ZQ4A 1I3MA 1PV4A