1KDYA

Pseudomonas serine-carboxyl proteinase complexed with the inhibitor aipf (this enzyme renamed "sedolisin" in 2003)
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
368
structure length
368
Chain Sequence
GTAKGHNPTEFPTIYDASSAPTAANTTVGIITIGGVSQTLQDLQQFTSANGLASVNTQTIQTGSSNGDYSDDQQGQGEWDLDSQSIVGSAGGAVQQLLFYMADQSASGNTGLTQAFNQAVSDNVAKVINVSLGWCEADANADGTLQAEDRIFATAAAQGQTFSVSSGDEGVYECNNRGYPDGSTYSVSWPASSPNVIAVGGTTLYTTSAGAYSNETVWNEGLDSNGKLWATGGGYSVYESKPSWQSVVSGTPGRRLLPDISFDAAQGTGALIYNYGQLQQIGGTSLASPIFVGLWARLQSANSNSLGFPAASFYSAISSTPSLVHDVKSGNNGYGGYGYNAGTGWDYPTGWGSLDIAKLSAYIRSNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE-CARBOXYL PROTEINASE
publication title Inhibitor complexes of the Pseudomonas serine-carboxyl proteinase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase/hydrolase inhibitor
total genus 137
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2001-11-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1kdyA00
1OYOA 1TMGE 1SBHA 2DUJA 2QTWB 1C9MA 1V6CA 4CG0A 1SUDA 1SN7A 5FAXA 5JXHA 1S01A 1ST3A 1DBIA 3AJ8A 3CNQS 1S2NA 3DE5X 3LPAA 5CW1A 5ARBA 4AKSA 5B1EA 1Y3DE 5SICE 3I37X 1AF4A 4YN3A 1GTG1 1TECE 4LVOA 5FBZA 3WHIA 1C9NA 3P5BA 1V5IA 5AVKA 3OSZA 4DJ5X 1S02A 1OYVA 1GCIA 1PTKA 1R0RE 3AJ9A 1HT3A 3BPSA 3D9QX 1PEKE 3DW3X 4MZDA 3TI7A 3PRKE 3WIVA 1CNMA 3DW1X 4OMDA 1BFUA 4WOBA 1SUEA 5K7SA 1SPBS 1GA1A 1BE6A 1DUIA 2ID8A 2SNIE 2Z30A 4JP8A 3TI9A 1SCDA 1GNSA 3VSBA 3VV3A 1TM4E 2Z57A 2Z2YA 1BFKA 4ZOQI 1C9JA 1SUBA 1Q5PA 4BWGA 3DVSX 3DE7X 4C3VA 3UNXA 1SH7A 1GTJ1 1C3LA 1P8JA 1WMDA 4CFZA 2V8BA 1KE1A 4I0WB 2DQKA 2Z58A 3A3OA 2TECE 3BGOS 2SICE 5JXIA 4HVLA 2X8JA 1XF1A 5ARCA 3VYVA 1TM5E 1EGQA 2W2OA 3DE0X 1SVNA 1Y48E 2ID4A 3BX1A 3SQOA 3A3PA 1THMA 5JXGA 4ZARA 2HPZA 1TM1E 1Y3FE 4H6WA 1YJBA 5JXJA 5B1DA 3SICE 2XTJA 3LXUX 1Y3CE 3DVRX 1SCJA 3Q5GA 3T41A 2IY9A 2B6NA 2G4VA 4OMCA 5AVJA 3WQBA 1AH2A 1Y9ZA 2ZRQA 1MEEA 2W2MA 2WUWE 1Y4DE 2PRKA 3DE2X 3H42B 3DE4X 4KB5A 4DZTA 2HD4A 2WWTA 3L1KA 1SCBA 3GCXA 4K8RB 1TM3E 4RYDA 2PMWB 5JMOA 1LW6E 1Y34E 1Y4AE 1YJAA 2PYZA 3DE1X 2WUVA 1P7WA 1SIOA 1SBTA 3DVQX 4KPGA 1KDVA 2SECE 1SIBE 2E1PA 1R64A 2XRMA 3A3NA 4H6XA 3LPCA 4M1ZA 3F7MA 1SIUA 4CFYA 1AQNA 3I30X 1BH6A 2ST1A 1CSEE 1JEAA 1SBNE 1MPTA 2DP4E 2W2QA 1YU6A 3ZXXA 4AKTA 3VV2A 2Z2XA 3TECE 3I2YX 1AK9A 4DWWA 3PTLA 4HX2A 1UBNA 4OV6B 3VHQA 3I34X 3QMPA 5ARDA 1GT91 2Z2ZA 1AVTA 1VSBA 1AU9A 1WVMA 1GA4A 2X8JB 3GT3A 3HJRA 1TO1E 3QFHA 3DWEX 3QTLA 1T1GA 2ZWOA 4GI3A 3AFGA 2SBTA 1BE8A 1P7VA 2W2PA 3DDZX 3F7OA 3EIFA 2IXTA 1WMFA 1GTL1 2WV7A 4J94A 3WIUA 3LPDA 1SUAA 2PQ2A 1PFGA 1YJCA 1SCNE 1KDYA 4B5LA 4Z2AA 2ZWPA 1NDQA 1WMEA 1R6VA 1SUPA 1Y3BE 1SBIA 1SUCA 1KDZA 5FFNA 3GT4A 1GA6A 1OT5A 3DE3X 1SELA 3D43A 2PKCA 3Q40A 1IC6A 1KE2A 1AV7A 2Z56A 5AMXA 3EE6A 1GNVA 1SBCA 4KG7A 2PWBA 4NE7A 4WOCA 1WSDA 3ZXYA 4C3UA 1T1IA 1T1EA 2GKOA 3EDYA 3F49S 4NMXB 4FONA 1ST2A 3GCWA 1TO2E 1A2QA 3DYBA 3VTAA 1Y1KE 2W2NA 1NDUA 1ZVKA 1TM7E 3CO0S 1IAVA 2PWAA 1NLUA 1PJ8A 4H6VA 4NE9A 1SCAA 1ZVJA 3DE6X 5AQEA 1EA7A 5I9SA 1Y33E 1TK2A 2P4EA 1BJRE 4LVNA
chains in the Genus database with same CATH superfamily
1HYHA 1UQUA 4L3VA 3SXJA 3T9BA 4K6KA 3A14A 5FQNA 3TZBA 3VR4A 2WVAA 3RH0A 3F3SA 5ALNA 1XZMA 3USCS 1MLDA 3GRFA 4DDTA 4ARZA 3L40A 2W6MA 2CL6X 1ZHOA 1AZWA 2QU7A 3FFWA 4D9KA 4E21A 3T5PA 1U63A 2JPDA 3ICQB 1F51E 3NR2A 4L4RA 1WW2A 2Z04A 5B3JC 2YBDA 2Q1TA 3EA4A 1NM5A 2RHGB 3QE4A 4O4IA 4OTZA 1X7WB 3K0HA 2PZJA 3QPDA 1XC7A 4INOA 4AIIA 4CMEC 3IQZA 3U6BA 1XD2B 1N3IA 1P1IA 2O2YA 2O06A 4ZALA 1ZJ4A 5JO9A 1QO7A 4ZRNA 2HLDA 1XKXA 2OG1A 4AQDA 2GS9A 3NHBA 4ILKA 3F73A 1Y9AA 4HTAA 5A05A 2IYEA 2R7LA 3AGPA 4L8GA 4B2IA 1H8HD 1GGHA 1LTKA 1KAOA 1UMBB 3CNHA 3LCUA 1EUDA 1BAPA 3IMKA 1CR0A 2XWBF 2YHAA 3DTVA 3K8QA 3L4BC 1KEUA 3EXIB 1W46A 3HNOA 1YE5A 3I76A 3KQYA 1I36A 4MKFA 4MGIR 1MV5A 1UXJA 4D74A 3DLIA 4LIPD 2V0GA 3HO1A 1KH3A 4QTZA 2YFKA 4RANA 1OCEA 4G0QA 1ODTC 1TNDA 3HJNA 1G41A 3UN1A 3T61A 3ONFA 4LY6A 3AIOA 1CZKA 1PQWA 1DWQA 2DBYA 2G63A 3ORRA 3QXCA 4H17A 4PO1A 2W8BB 2CLDX 1JVNA 3H5WA 2KLBA 3M3PA 4PLCA 5FHRA 4Z5XA 4J4BA 2I6QA 3HI4A 3M9LA 3OEWA 1X7YB 2ZRNA 1C0EA 5TT1A 3F74A 1NXVA 1KDOA 2DWOA 5JNRA 4DB4A 1ZOOA 4QYWA 3VDRA 1A1SA 2ZIEA 5LLSA 4RCZA 5ALZA 3VSEA 2UU9B 1LS1A 4EB6A 1EFKA 1P3Y1 4LSGA 5E4YA 2IE0A 3A9UA 2GBPA 3L6RA 3NPMA 4RPKA 4K40A 2VNAA 3RROA 2C42A 4B6FA 2HUNA 2BTQA 5IAEA 4R84A 5KYNA 2RH8A 1MQ8B 1GNRA 4JI0B 1KVSA 1HURA 2ORWA 1LS6A 3ST7A 4P9NA 1QTNA 3RVLA 4Y2HA 3BWYA 2WMOB 2D1FA 1FSFA 5REQB 5JS8A 3PEVA 4RMGA 3MJFA 1CQWA 3EGIA 1GL6A 2XY4A 3NHKA 2IXTA 3D6UA 1GTL1 2PWZA 2Q4DA 3KX2A 3OE7A 4JT2A 1KSGA 3RARA 1NUHA 5ITZA 2Q6KA 2A0YA 2AFHB 1W48A 1FX0B 3ABRB 3ZU4A 2UVQA 3UBMA 4EJ2A 5IAOA 1N5JA 4ARIA 3RE1A 1HGXA 4N5LA 3K09A 3D1VA 2BEVB 5F23A 3COSA 2Q6OA 3CUUA 4F91B 3GDHA 2KLHA 4ZJPA 2HB6A 1BOOA 2HDOA 4RDCA 5DHQA 4QUBA 2FQYA 1W0KD 3GF4A 3L07A 3CRQA 3TZKA 3BZBA 3ZNQA 6YASA 1KVRA 3D6JA 1EZZA 2BYTA 5KVAA 2ZRAA 5DNWA 4CEHA 1C1HA 1XK7A 2QB5A 2BDUA 3R6LA 2P77A 3HPQA 3VR5D 3KFXA 1XWFA 2NQTA 1TK2A 3WKAA 3IVGA 4LSMA 2A59A 1OLUB 2OP1A 4QYSA 2KYRA 1DTWA 1A8QA 1K0UA 1O89A 1V6CA 1G66A 2FPOA 2Y1DA 2Y68A 3NU1A 3KPUA 4JUCA 1QP8A 3CXUA 1L7NA 3Q10A 2A9PA 2PM8A 3AJ8A 3Q1KA 5JNUA 6REQA 2X5KO 1N78A 4CV1A 2RONA 3QPVA 1ZUWA 3MTDA 2AF4C 2G0TA 4YREA 3AUUA 3OSZA 4X97A 5JMPA 2WABA 1ZM3A 1HT3A 3IPRA 3JAWA 3CSDA 3AZQA 2AB0A 5HJ7A 4JIGA 1ADFA 2X6RA 1P81A 1PT9A 5C32A 2FQWA 2OV8A 4P1ZA 1NNI1 2IHZA 3U1TA 3VH3A 5HIMA 3DDSA 4CKCA 1XL0A 3ZU5A 4FCTA 2JI7A 3G2NA 4IUDS 4MPPA 3OCJA 1SH7A 4RHCA 2NO1A 1U0GA 1P8JA 5FB3A 4WEOA 4MK4A 4DABA 4ZEVA 1JAXA 2QR2A 1D0IA 4R2XA 1E2IA 3IDZA 2ALJA 5E9AA 4HVLA 4LRQA 5DYIA 1W0JA 1XQWA 1L5HB 5JR3A 1GPMA 5B3JA 2OBBA 2VPWA 4GZ5A 4ND6A 1DI0A 5DRYA 3ZHRA 1M2HA 3QF4A 3D7NA 3FG9A 2Z9DA 3GUYA 3U4QB 4M8KA 1N7JA 1P44A 2X22A 3HY3A 2BZGA 3G2PA 5EE1A 4CODB 2BEUB 4IXDA 2IBTA 2H85A 1JDZA 4RGQA 1TZ2A 4Q1VA 2E4UA 1MXFA 1BMQA 1Z6PA 2Q27A 3B2EA 3BA6A 3IYLW 3HUUA 2ZYTX 5FQOA 3USZA 4E5NA 4OMCA 3B5EA 2I78A 3AG6A 1EPUA 4D9JA 2AFVA 3VPCA 3GNSA 5A62A 2WHPA 3GLFA 5JS1A 1TC1A 1KZ6A 3E81A 5GADl 1Q1NA 3D8BA 5FTKA 2REXB 2WLTA 3CRZA 3G7NA 3KU4A 1R5OA 5SYNA 4MIYA 2XE6A 1AKRA 2PKWA 2X0DA 5CAEB 3NX4A 4GOXA 3EVBA 1SM4A 4KBFA 1VKJA 3IUEA 4B3HA 1YBHA 1MNAA 4FDAA 2Z6UA 2P67A 1AS2A 3PFKA 1DCKA 5AUOB 3MTIA 1XR3A 2HQSA 3AILA 4M98A 3TQOA 1G7SA 3WOHA 3TE7A 4BEBA 1L5MA 4DN6A 1JN0A 3KKEA 3KXIA 1EVKA 1TRHA 1JIUA 3DP9A 3GMTA 3MLBA 1OV4A 2I2XB 5ECGC 3L2OB 3DEZA 3GT3A 3JSXA 4JSRA 5AK0A 4C7MA 5C8YB 5L3QB 1U5BB 2QDXA 3DFMA 1Q14A 2PZFA 1SXJB 4Y9TA 1CF2O 2PDAA 4GMGA 4DSOA 3RTAA 3ORSA 3KJZA 4FZRA 1ZOPA 3R5TA 5AHWA 2NSDA 3GMIA 3W4KA 4DOMA 5KINB 4NVRA 1R5NA 1KK3A 1Z28A 3AEYA 3FNFA 3H84A 3ZZMA 4PY2A 3AR8A 4AFNA 2OR3A 4I50F 2EF1A 2FPUA 4FP9A 1KE2A 2Q3CA 3AP3A 5FTMA 2PIAA 421PA 5FUYA 4OHWA 4OK6A 4H18A 1NPTO 8GPBA 3QA9A 4BN0A 3FA2A 2X2OA 3OP4A 3DMYA 3MCWA 4L0CA 3VO2A 1XB2A 1KFKB 2C84A 3O38A 4HOYA 1QE3A 4XQCA 5JBNA 2O50A 2CZGA 1NF2A 5BXQC 3NGLA 4HQKA 1MBZA 1O96A 2DUMA 2ANCA 3KV3O 2BGMA 2JJQA 2OLEA 2PV0A 4IDGA 4R2HA 4R9VA 4B4KA 1GRNA 1RLUA 1IJEA 4EUHA 3H9CA 5DBIA 3GRPA 2ZYWX 4JA2A 3HV0A 4QHTA 4D80A 1RHMA 4CKZA 3IUBA 4HMQA 5ICMA 5ICSA 2YXDA 3ZGXA 2C9MA 1I33A 4JUBA 3R5SA 1W88B 1H3NA 4UDOA 4V39A 2GVZC 3C3XA 3PWTA 4DLSA 4Q7EA 4K2HA 5FRDA 2GK4A 3G0BA 1Z36A 4BAUA 3MD9A 4R0MA 2HEGA 2G4CA 3OQIB 3Q7RA 1M72A 3BIOA 1WB5A 3RTBA 4R16A 1U4NA 2V7PA 5CFOA 3N58A 4I36A 4DXHA 1HFWA 1WA5A 2WF8A 3U3XA 1QBKC 1U5CA 1RI5A 4GMKA 4ZHQF 5HIKA 2D2VA 1DIOB 2B61A 3EXIA 1TYAE 4PX9A 1R8XA 4OJTA 5GONB 2WWHA 4B8WA 4ZIRB 4UJ5A 5HFAA 3UNXA 4B7ZA 1MAHA 1QVRA 1VJCA 3TLGA 5AJVB 3VC2A 3EZGA 5KAMA 4HGNA 2I4MA 5HPYB 3IOEA 2C7RA 3IL2A 4IJQA 4MWEA 3MAJA 1TYZA 4MVJA 3HCPA 1GM5A 1CERA 3NV7A 2G5PA 5L53A 4X92A 4HN9A 3WLOA 5IT0A 2XMBA 1QG2A 1E9AA 1PKEA 2QMOA 4RK6A 5EKXA 2OCBA 2ZW9A 4NECA 3WIBA 1ZJ5A 1KC3A 1P74A 3E9CA 2BUBA 1G2PA 2A9VA 3HEMA 3LUHA 2RGYA 4GOKA 4EX6A 1QHNA 2O5EA 4AK9A 1X1EA 4JQCA 4UZEA 1MG0A 2FW8A 3X2EA 1E3SA 1CQIB 1X80B 3MMZA 4S2EA 4NPHA 5TEWA 4CU5A 1IY1A 3PD1A 1JFFB 1VCIA 3ETHA 1UOQA 4A2PA 5CDHA 4U0KA 2AWOA 4BMVA 1NIJA 2A33A 1OA1A 4YBZA 1DT3A 1GOTA 5EIBC 3LECA 5KWVA 2BBOA 1CDDA 4Z4GA 4GZ3A 4LQ4A 4MWOA 4WSOA 3T4EA 2WYVA 4Z0HO 4O63O 3RANA 2IXEA 2PZLA 2XUPA 1QCZA 3F5SA 1T10A 3O4HA 1R4NA 4KE9A 4KKXB 4YA6A 4ASUA 2AMLA 4PTZA 1PL0A 1JV2B 1NUAA 1VLLA 3O8DA 4F5EA 3Q9SA 1AGYA 4CMJA 1ZXBA 5TPZA 1CRQA 4PZDA 1FX0A 1NY6A 4LDPA 4DLRA 4E3WA 1IPHA 2FZLA 3TOZA 4E5YA 1OZ0A 2FPIA 2IUFA 5LQMA 1DKUA 1C4XA 2DWUA 3LXRA 5LZ7A 3SC4A 1A4UA 4BB0A 1B8UA 4RC9A 3EDRA 3FY4A 1EFHA 4NATA 1WMFA 2IRWA 3ENZA 2GM4A 4UHHA 1F7UA 3SG0A 1CS4C 1EP9A 4OOFA 4J03A 5LYJF 3RK0A 4D2IA 3WP0A 1NTRA 3GRCA 3RSGA 3RS9A 3ZG6A 4ZTUB 3DMRA 1ZMTA 1YVEI 2A9QA 4FFMA 4NTZA 2VTKA 3VUEA 2WWIA 2VQFB 3GPDG 2Q45A 4EZEA 1EMDA 4PHTA 1QE0A 2JFOA 5DTRA 3PC8C 4F5ZA 1T5BA 4CJXA 2ZIUB 2QYTA 2IDMA 3JWEA 1WZNA 2GYVA 3OMXA 1P61B 2VJQA 5E6UB 4BZXA 1EDOA 6REQB 5GJCA 3I5YA 1G8JA 3ASVA 1BOFA 3H4VA 4RD4A 2CWDA 3TZQA 3HSKA 4BNGA 2FQXA 4JBNA 1V4NA 3T3NA 3KJGA 3TTSA 3H1TA 4LTMA 3MYRA 3NHPA 2FLKA 3QBEA 4QGFA 4DAOA 3MQ4A 1ISPA 3TKAA 3VU8A 1QS0B 1M9NA 4A0HA 3ENVA 1JDJA 3N3BC 4LA4A 3CT4A 5ARBA 2ZIZA 4H7EA 3OU6A 3A6KA 5JD4A 2AN1A 1PGQA 4YRTA 5EL0A 2J7PD 4WLEA 3IQGX 4NU5A 1SA0B 2GCOB 3K7EA 2IELA 3L1VA 3JQBC 3SEQA 2GPJA 3ASUA 1MTOA 3PQCA 5AOVA 1MC4A 2ONKA 3H19A 3KWFA 1TTHA 3ZY4A 3CZRA 3GAAA 1R5BA 4XOIA 4ZI2A 4BNYA 4CIXA 1RPNA 4ND3A 4MRMB 1J8VA 5EP4A 5K1ZA 3NDPA 2BM1A 3I72A 4RZ3A 1J8FA 2BHSA 3JVIA 1AY0A 2ZROA 5EMHA 3ZDQA 4H4DA 3ZTWA 2WAXA 5A2QA 4RL4A 1ZICA 3ZCXA 2EGHA 1TKRA 2ZJFA 3DFIA 3QHQA 4XVUA 1A2KC 3RSFA 2ZB7A 3IQEA 4HZUB 3I2JA 1JMYA 2WU1A 3D8RA 4KQKA 2MYUA 2R4QA 3Q8MA 1B0ZA 4HYYA 2WIKA 4XFKA 3RJ9A 1KYVA 1T8PA 3K1YA 3U16A 5E3IA 3T5BA 3AFNA 3D7KA 1TU0A 1S3GA 5FUQA 5IJ9A 3WLEA 2YHIA 4YASA 5CA1A 3CUVA 1XQ1A 4QDZA 5IDYA 4UU1A 1P9RA 1YUNA 4C14A 4GVXA 1XK6A 3TLJA 5E0KB 2BFOA 2WQ6A 2HA2A 1E77A 4C0LA 1ZYUA 4AC9A 1PEDA 2QI9C 1XEWY 2JAHA 3ECCA 4P38A 4ZT7A 5H3CA 3D2CA 4NV3A 4L7QA 3W8NA 4PGMA 2GPNA 2O2SA 2ZYVX 5FV7A 4J2OA 4PZLA 1NNUA 3S2FA 2HSGA 3PU6A 3E3NA 4P34A 2NZ8A 4N49A 4NG4A 5G0SA 3JALA 3FPEA 3TSWA 1HE4A 4YECA 4KQ6A 3ITEA 4GI3A 1T5OA 3HBJA 4HDCA 1I7QB 1XZBA 3H1PA 1XE3A 4AJNA 4AB1A 1X7HA 3KJHA 1FP6A 1H3FA 1JPNA 2D6FA 1HRDA 1IH8A 1DRJA 1VHLA 2A84A 1TU4A 2KQUA 3H99A 2ATEA 1XQYA 3LU1A 4L7VA 4M8IA 3ND6A 1QLWA 5GOZA 4BCBA 1FFGA 1L5WA 5DWQA 3ESQA 3BK1A 3IVCA 3L7DA 2R6DA 3UHJA 3OA0A 3NTQA 3LPMA 1GLNA 2QMHA 4L8WB 4U7GA 5KVQA 1TB4A 1USWA 5DHPA 4JP1A 3WA6A 3GJTA 1OAKA 3JX9A 3BCSA 1RAAA 1B8VA 4DIKA 2OHJA 4RFVA 3UGJA 3FI0A 1VSUA 1Z18A 2FJPA 4GKVA 3IVMA 4X90A 2A5LA 4HXYA 2ACVA 5KWJA 3K1TA 4MKHA 3G8CA 3R3SA 4FZVA 3QPAA 4RO0A 1X7XB 3BD7A 1G3UA 4DYHA 2FCAA 1HTBA 4BQFA 2Q3EA 3M7IA 3ER8A 1RM5A 3OUUA 4BWFB 4GXQA 3BL6A 3PD0A 4OUDB 1OYYA 2BJWA 4F2PA 1PL6A 3BMCA 3BQNB 3OEHD 4RVDA 5T4EA 4CI9A 5FLYA 4BMZA 3L6OO 3FB4A 4JYZA 1WL8A 1K68A 1O0SA 3D6VA 1T9AA 1CY2A 1KFJB 2ORVA 4BFVA 5JEDA 1V45E 2J31A 3A6FA 4MMZB 5JSUA 3OEED 3EIUA 4KPYA 3SP1A 1A8IA 4PPQA 2EF0A 2AR9A 2O19A 4WPGA 1T36A 3C6XA 1V96A 3TSCA 2I7DA 4CMHA 1LZKA 4HMOA 2P9JA 1TUBA 1YUMA 4N3GA 4BASA 2XQJA 4GPZA 1J4AA 2PMKA 1BU8A 1UBRS 1KP3A 3KZKA 4HYQA 1L4YA 2A78A 4R1NA 5CX1B 5JXIA 2VZEA 3OZBA 2ZBVA 5C8YA 3G59A 4J0KA 1L4LA 5TR9A 5IT9A 4NBWA 3K96A 3SQOA 4YK7A 4R3UC 2O7NA 5TLSA 2G6TA 2PYDA 3C3MA 2GJKA 4JJKA 1I3LA 1ITZA 3V33A 2IEAA 4HCJA 1O57A 4CM4A 5B1DA 4M0MA 4HB4A 2XGOA 5B1IA 1ZMXA 3T95A 5KNBA 3HBMA 4TV9F 1Q0HA 1M7HA 5IT4A 1XMIA 3COYA 3JQ7B 3L8CA 1SZJG 4AZWA 4EJSA 3MQ2A 3ZGLA 2D5CA 1A4RA 3H9EO 1EHCA 1SHZA 4YAUA 1JAZA 1VIMA 2JLSA 2ONJA 4JKYA 4I46A 1UBHS 4MV5A 2K4MA 4B9AA 4YIKA 3CTPA 1UM9B 1SD5A 3HMQA 3OE1A 1Z6GA 4QELA 2BGTA 4WMLA 4HJRA 4V0SA 5CVUA 2Q8NA 1ORWA 2G8NA 2NO7A 2IVFA 1VG0B 3QENA 1SXIA 3C6QA 3LY9A 2D1RA 3EYWA 3W6NA 4D92A 3D3KA 1OAOA 4UUMA 4J4TA 3L4JA 1Z0AA 3WXBA 5CT6A 3OCZA 5ARDA 2XGGA 3OZEA 4O4HA 1XDBA 2J3MA 1D2GA 4O1IA 1IN4A 5EHGA 4E5MA 4RK7A 1UZMA 4DQUA 1S2GA 4MI9A 3O91A 3W9YA 2Z83A 2LUOA 4B87A 4DY6A 3U39A 2I67A 2BR5A 2BH9A 3H9GA 4HWTA 3V2HA 4E7OA 1J56A 1IOVA 5D00A 3WGLA 1Z16A 3A6JA 4CETA 2HSEA 3LWNA 1NU6A 2RGGA 1ZD4A 4Q48A 1J2UA 1FLDA 3PHLA 4Q03A 2XVAA 1FXWA 5B57C 4HP8A 3QVOA 5KPDA 1M33A 2BZ1A 5E0OA 3GY0A 4V0ME 5H02A 3FVRA 3VKVA 4YDQA 3E48A 3R23A 3EVTA 5JS6A 4NCBA 1GUDA 1SC6A 5DP1A 1F6BA 4MR7A 4P08A 2L2QA 1XXHE 3KQTA 4UE6A 3SQLA 3ZE7A 5A02A 3AU9A 3KJXA 4LBZA 2I6SA 4RIGA 4MW1A 4TMWA 3A6GA 2EKPA 5DEOA 3U0VA 5K99A 2EW1A 2WAAA 1SQ5A 1M1ZA 1PTJA 1GCGA 3EXG2 4UPEA 1K7FB 4K9OA 5FWYB 1JKMA 1YOBA 1DG9A 3VJMA 1E1NA 1XFDA 3QIAA 4DVJA 3FUTA 4DWOA 2ZUEA 3WFIA 1LQ2A 1N9GB 5E7IA 3OCWA 2A7QA 4UVDA 2IYSA 1AE1A 4XJXA 3ZWWA 1SN7A 5KHLB 3O0TA 4MVYA 1YGYA 4H2DA 3AERB 1ZNXA 3U3ZA 4NNOA 1CK4A 1Y7LA 5KTYA 4YN3A 4JX8A 5F33A 3PC4A 5EJ4A 1Z15A 3Q1LA 4MRPA 4YX9A 1MDBA 4EG6A 5JY1A 2J5KA 2LBPA 3LT2A 2DR3A 2GEDA 3R0IA 4Q7LA 3QVSA 5KYWB 4MV7A 4XUDA 5BSRA 4CIBA 2JI9A 3CRNA 1SUEA 2JATA 2XA9A 4RVOA 4DJAA 4DBVO 4IDAA 2DZDA 2A5FA 2Q9AA 1R00A 2QD3A 3N6VA 1F2VA 1QH8A 2VJMB 4C03A 1JSZA 2QRPA 3QUTA 3AF6A 5TX7A 4MA0A 4PNHA 5AKKA 1DGQA 1WMDA 5DYGA 1XJ0A 2PT5A 4DV3B 1UXHA 4TN1A 1NAIA 4RTOA 1NJGA 5HDQA 3WAKA 3IO3A 2PGLA 4KJXA 1M6WA 3IIMA 3L7JA 4EB3A 4QPZA 2AV6A 4NMMA 2I71A 3GNQA 3A3PA 3ROPA 4ALNA 4ZQEA 3CY6A 1HNXB 1E3WA 2PYIA 3VU0A 1YQQA 4RLFA 1J97A 5ELLA 1PJLA 3K6SB 3C5HA 3RRYA 3ZJUA 2AG0A 3A6HA 4ID9A 2Q5QA 3TW8B 1U81A 3FPSA 4JJEA 2WUWE 3CLHA 1CRWG 3UMVA 4CF4A 1BW9A 4WA8A 1TOAA 2MIIA 2PMWB 3ZQUA 1Z4KA 2RKOA 4FFNA 3UK7A 2WMNB 4N5NA 4WTOA 1DVRA 4I66A 3RNLA 5KCZA 2IP2A 2J1LA 2V7VA 3B1FA 4UTZA 4KXWA 1AOXA 2HKIA 4AQYB 3RSQA 5D5HA 2X1HA 2FPSA 1XD2A 2BF4A 3G1WA 3JTEA 4AKTA 1C7FA 1SUIA 3LZCA 4MDHA 1JIVA 1T5SA 4LXYA 3V1KA 4KVZA 1W59A 4LNUB 1B14A 3L7BA 2ZFUA 1UQTA 1HTTA 5JCPA 4WJZA 3IUSA 1BJTA 1AA6A 1ZM2A 1KSHA 4K26A 4IIUA 3L1UA 1XA3A 4R1PA 3N70A 4LI0A 3AFGA 2NU7B 3FGPA 4GXNA 4TZ0A 1BEUB 1PJRA 2VHWA 4W9NA 2P68A 2YS6A 1GD1O 3WRWA 1MO6A 4HXGA 4U4AA 3QZUA 3JYPA 1E0JA 3IBGA 4V3CA 3DE3X 2C1XA 3E9NA 1N2SA 1KETA 1EP2B 4RLHA 4RMNA 4PNPA 1IQ0A 4JVOA 5F4ZA 3L82B 1TZKA 2PD4A 4M55A 3HZZA 1FS6A 2GFQA 5KDLA 5CBKA 4BV9A 1HR0B 5KMGA 5DV9A 3EMBA 4GLFA 4L78A 3OG9A 5DTJA 2H3HA 2IU0A 4W82A 2H3EA 2N1BA 3F8WA 4XYBA 1NQUA 2JFUA 2QR3A 4JEHA 3F3MA 3GLHB 1MJHA 1WCYA 3EOAI 4UUAA 3U9TA 4AS2A 2UKDA 3ABQB 3R5XA 2A3RA 2B37A 2VJDA 3A1TA 2OQRA 1QIDA 4JLKA 4A0GA 1JQAA 1CUBA 3LC7O 3NHUA 4C7BA 4DIFA 5TIIA 3L8GA 2OMKA 4FEEA 4ACBA 2H1RA 2PU5A 3DYVA 4ENTA 1TLLA 2J6HA 2Z4SA 1EVLA 3OKCA 3NPAA 4JT4A 5FPQA 4NH0A 1ZUNB 3IAS1 4WJKB 5ENZA 1RIFA 1WCV1 3RJZA 1VBKA 3DFFA 3SC6A 2H52A 3U48A 4LKOA 4FCVA 3IAS6 5BT9A 2NO9A 1FXUA 1PS9A 4F12A 2DU8A 4PONA 4J0HA 3M33A 1DBSA 4ZYXA 3K5PA 5LA6A 3QY9A 3C8UA 5ER6A 1TX4B 4BNIA 2FWAA 2A9OA 2HK7A 2J5BA 4OFZA 3SJBA 5B5SA 5JZVA 3TG2A 1CP3A 2HWWA 3GPBA 3QSGA 3HZOA 1G21B 5K3BA 1FYVA 3W5DA 1TW2A 3LDGA 4F8EA 2WM3A 4P7GA 1P60A 1KE1A 5L3RA 4HNRA 2SICE 2XBLA 1UK9A 2BGJA 3P0RA 3QYAA 4KKVA 5EA2A 1QONA 5LZ8A 4C3OB 4F85A 2RGXA 2ZIVB 3QX8A 1G6KA 2G83A 4DMMA 4Q4CA 4LRYA 3W5BA 2AOTA 3LWBA 1IXYA 3G85A 5DXAA 1WUYA 3LNCA 4GMDA 4XA8A 5THKA 2Z4TA 3C6KA 3DUWA 4Z51A 3FIJA 4GNKA 4XIYA 4QE3A 4FD3A 2VDKB 4FMBB 4CCAA 5J4VA 1EBBA 2B8EA 2VZ8A 2IY9A 2JAUA 4OBBA 4XWTA 5C9ZA 1IUNA 4PIVA 4BYGA 4JR2A 5EJAA 4C0SA 4D4LA 5GIPE 2PS0A 1L7XA 4KVGA 4Z4CA 2J3HA 1CJVC 2UAGA 2VH1A 4Q9AA 4D97A 5LQJA 2OA0A 2BMAA 1DLIA 2DUUA 1P4HA 1SIUA 5ENVA 3RKSA 4PPYA 3MERA 1L7MA 3SDZA 2O8CB 1UZLA 4IRXA 4OJQA 1JEAA 1PZFA 4OFWA 4AS3A 3AHEA 4ARSA 2R6CA 4DCNA 5B1YA 4ZD6A 3VV2A 4QM7A 1P0IA 2A94A 2EP8A 4JWKA 2JBAA 4DKJA 3SS9X 1GPKA 2EFGA 4D8TA 5TSDA 3OJOA 4BLSA 1IATA 1USVA 3W2GA 2ZYUX 3Q98A 4QRDA 1XFAA 3UH1A 2YICA 3A4IA 1M6VB 2G5CA 2PS3A 3EXHA 2JCVA 3PD7A 3Q7IA 4HWKA 4K8OA 5CDGA 1VJ5A 4DNOA 4P7JA 1SZPA 1ZOLA 2AQIA 4EDFA 3S2IA 3FZEA 4CF3A 4L22A 1N1DA 4QTYA 3ZD7A 5CMLA 4ZEXA 1LKZA 5AOCA 3GUCA 4EWLA 1D4OA 2H0RA 4FXOA 5JROA 1NMYA 3SE0A 3P94A 3LNTA 1ZW6A 3E5MA 1AHNA 4V3BA 2RGCA 5J40A 4BGEA 3TLBA 2IEBA 2X2EA 4F2DA 2QTFA 1B1CA 2FRDC 4ODIA 3UWKA 1Z22A 2QPAA 2XWSA 1F14A 4POAA 4QNMA 1A2QA 3ZDRA 4X41A 1GUFA 4JB8A 4JR0A 5TE9A 3JQAA 2JJ8A 3E9YA 3A0UA 1Y8QB 3KDAA 3MGCA 4NEQA 3DLCA 1N36B 2A9KA 2ZGVA 2H29A 1PZGA 3LDUA 2WJVA 3TWOA 3JASB 3TSAA 3ZNOA 5FORA 3AF2A 4QBIA 3GT0A 3M4XA 3WNVA 5C8ZA 3L92A 2OCYC 4ND8B 2RAVA 3LX5A 1E1MA 4REMA 5CYOA 1UANA 4CBVA 2L18A 2OC9A 1OF1A 2OO5C 1UC4B 3BHJA 1VE1A 3I2GA 3AM3A 1YB4A 4D5EA 4R9RA 2ZAYA 1QIGA 2ZB4A 2ZJ2A 4YC7A 3D6HA 1RZ3A 2AI1A 4DLXA 2X15A 1U7UA 3ZW9A 1H1TA 4EMSA 1Y1LA 1QDLB 3HWRA 3QEKA 1NUQA 2IXFA 1GNSA 3VMMA 1NLZA 4ZEMA 3ECSA 4XASA 2GK6A 3ZEIA 3TZCA 3PXGA 2VYFA 1O9BA 1UFVA 2XNSA 2XMZA 3RTCA 3II6X 3A1CA 3MGBA 1XALA 1N77A 3ICWA 3R7BA 4KK3A 1U2GC 1P2VA 1ZX1A 3MILA 1NN5A 2PGXA 2B0CA 1BXGA 4DA0A 5T5QA 2XXAA 4Q4HA 1XD8A 1GSAA 4JY7A 1Y9DA 4RV4A 2PFKA 3OT1A 2JIOA 3ZCUA 2I2BA 1A1VA 3KR0A 2JG3A 3AHFA 2VLIA 3VSCA 2QZ4A 1M0TA 2ZWVA 3RVNA 5JH7F 3DAYA 2BE9A 2R44A 1QIEA 2O6LA 2XIQA 4ER7A 2BRUA 4N3AA 2V96A 2HLDD 3HDQA 1P75A 1MGPA 1II0A 4LOAA 2C4UA 2FMFA 2W2MA 2X1LA 4MEAA 4MUNA 3VPXA 3WHKA 1LLDA 1MUUA 2C8JA 5DYTA 5I7RA 2XKKA 2EHDA 3PUVA 1Q7CA 4L4XA 4V0OA 3RABA 4BUJA 2VPQA 2C2WA 4ZGGA 4U7FA 2QRJA 3QX3A 4AI6A 1Y34E 3FKSA 1RD4A 3GEBA 3VZQA 4HL6A 4UM7A 4D3SA 2IDZA 5DCUA 5HA5A 3ESCA 1C3OB 2Y0CA 1NATA 4FK8A 5FOSA 3O9ZA 4RWEA 1NGSA 4MUHA 1E92A 2GEJA 1ZA2A 2MSEB 3DL7A 4DA9A 1AXGA 1GYPA 2QUBA 4DLBA 3A4LA 3BCRA 4ZO4A 5K3OA 2PQMA 2W2KB 2XMSA 2YHSA 3MA0A 3ROFA 3TINA 1NASA 2XNKA 1Q57A 2D13A 4CCYB 5LIPA 3BSSA 3LLSA 3WLRA 3N2GB 4PE5B 4G0UA 1HMYA 1RXYA 1FQOA 2PZGA 4CMBA 1BXGB 4R69A 5HXAA 1ZJJA 1PAUA 1AO0A 1M2VB 1H5NA 1W52X 2O8EB 3JS5A 4TS3A 4G67A 3WZMA 3VKWA 1Z7YA 4FBGA 4QXQA 4YMLA 2JBAB 4CTNA 1GKUB 2NV0A 5BN4A 3HYRA 5HM6A 3BH6A 3AR6A 3JQGB 4GC9A 2GDZA 3E9EA 3L1IA 1Q0UA 2WZQA 4JVSB 5LCXA 4B4UA 1JLLB 1L1QA 1PSZA 1XNJA 2P62A 4FMCB 1T4CB 2EX4A 4MQBA 1IRXA 3BA1A 2C92A 2O8DA 1BYUA 2JGRA 5TQ0B 3THSA 2C5SA 4UU0A 4IQGA 1X8LA 1Y1KE 1ZSVA 3HA2A 2CVFA 3KTOA 4FGUA 3RUHA 2CYCA 1QFZA 2B6HA 3FZGA 3V3KA 5I4CA 1JBEA 1I0ZA 4MZXA 3NXSA 2X9LA 5FWAA 3JYNA 4CMKA 1UBKS 1PFQA 4JBIA 4AZ0A 1JHZA 2CDBA 3ETNA 3IQDB 1VHTA 3U17A 5AW7A 1QG4A 1YA8A 2ZTSA 4M53A 3KYDB 4N0PA 4EI7A 3KKNA 2GDJA 4TKUB 4X00A 1H9BA 4OA5A 2NZYA 1FJHA 2Y2VA 2QRGA 4C20A 4MR8B 3LW7A 3VRHA 1BVYF 5K0JA 2GN0A 2ARKA 4IV5A 1ZVMA 2Q7XA 2QN3A 5JOQA 1RWVA 2I7XA 2HU7A 5E2AA 3ROZA 2BUAA 4KL8S 4M0KA 2Q5JA 3NKLA 3PDHA 5IVIA 3AOEA 1FTYA 1D6SA 2AN3A 2Z30A 3NW9A 3P4UA 4RHYA 5DHTA 5AKJA 3PDUA 1O95C 3VVCA 5ISMA 4KFSA 3N59A 1N75A 1O6GA 2P27A 2Z98A 4X6XA 3OUZA 3NJ8A 1J09A 1K4MA 2CXUA 1Z8FA 5G0TA 1IUOA 1EWRA 1VFPA 1MO3A 5C81A 2O8FB 5J2UB 4HNTA 1LVHA 2GJ8A 1H8HA 1U8UA 1Z29A 2HLHA 2QMZA 2TECE 4RSRA 3S2GA 2GRAA 1J33A 1WDWB 1SVNA 2C57A 1E1LA 4QSHA 3VNRA 1AHHA 3FVQA 5LOVB 2AHRA 2QIOA 2QTGA 4GRIA 1YJBA 2PTGA 1L7QA 5LUBA 1PNRA 3IELA 1QX4A 4M0UA 1M2KA 3PXDA 4RDHA 1OW3B 4TLBA 1TZMA 2ZVDA 3GFTA 3TFWA 2FFRA 1XN1A 5GVRA 1Q1BA 2HN9A 3CF6R 4TWIA 1VYHA 1ZBQA 3E5HA 4Q21A 2JD0A 1LJ8A 5ECDA 4N4AA 1CQZA 1UFRA 3SIRA 3UFXA 2OFPA 3PDJA 3V4ZA 4L28A 3SF8A 3I0ZA 3VR2D 1MXHA 1RHJA 3A3YA 2GPTA 1Z25A 3MELA 4WK0B 4BNVA 3U5ZB 3L84A 3X2FA 4E1VA 3WTCA 2JLRA 3JR7A 5EZ5A 3VVMA 2VCEA 3LO5A 1IBRA 3SJ7A 4BCDA 2QTCA 1BDIA 5F3WB 3IXMA 5B53A 3ERCA 1W96A 1JQKA 3VBCA 4BO5A 1GPH1 2LCQA 2VSFA 2AKAB 2NO4A 2K5UA 1KGSA 4FFSA 3OQPA 4GECA 2VIIA 3IOMA 1PGNA 4LUCA 2YMMA 3QFHA 4YRMA 4N3CA 1G7TA 5DOZA 1DFGA 2GLUA 4LJ9A 5EJ2A 3OX1A 1T1GA 3E8SA 3NATA 3OQVA 5DLDA 1HBJA 3TBFA 2AMFA 4J94A 4JOBA 3EWSA 3OECA 3SF0A 3AZPA 1W85B 3WQQA 3LPDA 3I6IA 5J58A 2OV4A 4HBGA 2BFDA 4Y2UA 4XGKA 1RKQA 4V0RA 3COZA 4F9FA 3NAZA 1DWUA 3OX3A 1M0SA 3UOWA 2G9VA 3VKHA 3ZDCA 2J3QA 1OZGA 1V26A 4HGZA 5JZBA 1LDNA 1U0TA 5KJCA 1OI7A 1QQ5A 2B3TA 4WOCA 4DA4A 1QB8A 3BQ9A 4RE6A 3TRIA 1PSWA 3MBIA 2O8BB 2FV8A 1OR8A 1NZDA 1W4LA 1QZTA 1MB2A 4WINA 3M1LA 3DGEC 4X54A 1ONPA 1GGKA 3MUEA 1YQWA 5FL7D 1BC5A 2J09A 4ZVLA 4GOMD 2VYND 5CJ2A 5I01A 1NVAA 5I7VA 5EWLB 3QOWA 1IULA 2OBNA 3WRYC 1IBKB 2R8PA 2H1IA 4IEEA 2P9QA 3BIWA 4KXVA 4R7GA 1C9MA 2F1HA 1D6JA 2HL6A 3GRAA 3K4HA 4PG8A 2J0SA 2HBZA 2CHVA 2P1ZA 3T1VA 1QQAA 1EESA 1HOXA 1S2NA 2VP4A 4JSYA 4UMFA 3WNBA 3ZE2B 1P7PA 1SXJE 2GESA 4W1RA 2FWRA 5AW5A 1RPZA 1QIFA 4P3XA 3IS3A 2VOEA 3S2YA 1V4VA 2ZRCA 4OLJA 4I4TA 1UINA 5K3CA 2IA5A 1IBSA 2AC4A 2I62A 1XCBA 1AUVA 1T1RA 2QNRA 3C24A 2O2HA 2OY0A 3QUQA 4KQXA 4XM1A 5EWMB 4GKAA 2ZAMA 3RT1A 1Y7IA 1FZQA 3ZY6A 1C0IA 3OOSA 2VHZA 1UXKA 3KYDA 3KBOA 4G63A 4LYYA 2V7QD 3DDNA 2AF3C 1C9JA 2JIZD 4OXXA 1Q7GA 3NTVA 4TVOA 1JDUA 1OX4A 1QHHA 4K1XA 4M99A 1FW8A 2FX2A 2QPLA 3QEJA 4B33A 4LBWA 5G3ZA 1VCHA 4PZZA 5JLJA 3A3OA 1NONA 3ZY2A 1M66A 4OMUA 2QW1A 3ZDBA 2QMYA 4RGYA 1E9RA 1P2SA 4EGAA 4MKIA 5IN5A 4PLTA 1KVUA 1CQJA 1NUPA 3O3CA 4KWTA 1IL0A 4QGHA 4WKBA 5ESWA 2W58A 2R86A 3P0IA 3D4NA 1I3CA 1BKDR 1PD1A 3AC0A 2NPIA 2B25A 2ACKA 3MZ0A 1SCJA 3GBVA 2A0UA 5D8DA 3OBIA 1ZGHA 4NXMB 1ORRA 2KBFA 1BSVA 2XD4A 3MAGA 3MW8A 1AD2A 4GGMX 2BFAA 4H77A 4XSGA 5AK5A 3ZLVA 5ALFA 3UT0A 3EIEA 2FF7A 4RJLA 4F3CA 4CIAA 2E85A 1LW6E 2H48A 1PYDA 1K7YA 3ENQA 1CULC 2E82A 3LMKA 4L6IA 1KJ9A 4RAQA 3HLYA 3U4CA 2HU8A 2GCGA 2VK4A 4BQIA 1VP3A 3P8ZA 5KTMA 1TXGA 5JSHA 1GFZA 5CCDA 3BILA 1GKKA 3NM4A 4P80A 2NU8B 3ROEA 5LD2C 2CLIB 4M46A 4UASA 3ZHOA 3O4VA 4JUFA 2Z2XA 3KSRA 3O21A 3I2KA 4O33A 3W7VA 2DFLA 2I9KA 4Y6PA 4B09A 1OA0A 1LV8A 1OXBB 4URWR 4KQCA 1RPAA 4AZVA 1YDHA 1XZNA 2CUNA 2PJDA 1E9VA 3L7LA 3OCVA 4CU2A 4YV0A 2FX5A 2R6GA 4AJHA 4UXHA 4L75A 1HZZA 2QVLA 1HE1C 4WZAA 1Q6YA 3KAQA 2MINA 3NBMA 5C4MA 2FSFA 3U5TA 3A25A 4Y1EA 3EZ6A 3KKZA 2AJLI 4Z1MD 4X5OA 4Z3DA 3TZEA 5E3HA 2JFNA 3LDHA 1JDPA 3SYTA 4HUQB 3V8PA 1GU0A 2C2MA 4MUIA 5FFNA 4COKA 8AT1A 2VS1A 2F59A 1BQ3A 1IC6A 5I47A 2AYXA 3FTDA 5LMZA 2XB2A 3U81A 2BFBB 3H8SA 4RBNA 5J9FA 1D3AA 2ZJ7A 3CNLA 3KAPA 5D5PA 4BLRA 1F3LA 3TSZA 2AEMA 5CH8A 1OGJA 2P41A 3UXEA 1Q21A 1ZN9A 4XSVA 3KLPX 4HPWA 5LKAA 4TLAA 2RGUA 3FMIA 2X2PA 1A2BA 5AI5A 3PE3A 5ICCA 1H4QA 4LVCA 1RCFA 2EATA 2PZEA 3EZXA 4JLOA 2XAAA 3DMNA 1A9OA 2GB4A 1ESZA 1TIPA 1V1RA 2X4GA 3BMNA 3BS4A 1AMOA 5DHRA 4YWJA 4BLTA 4QNRA 2CLEB 4GGOA 1QWSA 2AFHE 4N82A 1ZCZA 2ANBA 3QLUC 4LE0A 4G5HA 2AFIA 2O0MA 2QV0A 3CJTA 5THQA 3QXSA 2JH3A 4LVOA 1XAHA 4Q7QA 4E09A 2JLZA 3G0CA 1C9NA 4Y0VA 1WZ2A 4UCFA 5H5JA 4AF8A 3ZVNA 3HI6A 2R62A 3WWOA 3ZKWB 5BSKA 3GXOA 4HN4B 1Y6FA 2GRJA 1RP7A 3HCWA 4B3RB 1W7AA 5GZ1A 3ZWXA 2H7YA 4FMDB 2C9DA 2HMVA 2CLFB 3FMPB 3GWZA 4H7FA 4DC9A 2BFNA 2R60A 2YZMA 2MT9A 4KAXA 1ECLA 4NJMB 4QPJC 2VDPB 4TKVB 3Q9UA 5KI6A 1Z4LA 1E2BA 1C2TA 3QEOA 3TZHA 4BGIA 1ZH2A 3DP7A 3FSEA 2AJDA 4ZAFA 3FTPA 3M4ZA 2NUTA 2CBXA 2VAVA 2VYQA 4HDQB 3SXPA 3PUWA 5JAUA 2NXCA 4BLVA 1PLKA 5NLLA 4C08A 4URFA 2GWHA 2QTRA 3IKVA 4YYZA 13PKA 3SC2B 2QP9X 2REOA 3UHFA 5MFZA 1M1YA 2OXIA 1U1EA 2MSKA 4FC6A 5B6IA 3KCNA 1QHEA 1Y98A 2GNOA 1NHWA 2ZZMA 2R68A 4YH1A 1UWCA 4IMJB 1VL2A 8MHTA 2P2SA 5AP9A 1B93A 4NENA 1XELA 5JVDA 3IA2A 2AFIB 3NJRA 5TQVA 4FW8A 1AH2A 1T0IA 4KXNA 2QYSA 4QUEA 2CUTA 1IWPB 1LPPA 1CQJB 1ULZA 2HD4A 4KDFA 4EJ6A 1XNGA 4C4RA 1IUPA 1O4WA 2ACWA 3H4IA 3DA8A 4LV6A 3KKQA 1NQTA 2Q2NA 3AFOA 5L6MB 1ODSA 4JEUA 1PG2A 4LDRA 5HCUA 1FX1A 4MB0A 5DPMA 1T43A 2VPZA 5LJIA 2FPXA 2NZXA 3V1LA 1CR6A 2O23A 5REQA 4RMHA 5FAKA 1CY1A 1R16A 4KTVE 3CU5A 4UPVA 1A3CA 5G1OA 4ZCTA 2J48A 2OK7A 5JFTA 3HXTA 3U7RA 4H1TA 4DEXA 4Q9DA 3AR2A 3O8OA 4OSPA 4F38A 1XTQA 1X70A 2AXEA 1THTA 1M67A 4DM4A 4XQ0A 3GJ8A 4PAGA 3GAZA 5KJ6A 4NP6A 1GT91 4JBGA 1XDSA 2UZ4A 4EZBA 2VHJA 3PQ6A 4KE7A 3QNMA 1JFSA 2NG1A 3TZ6A 3NRJA 1XRJA 3FNGA 4HLQB 4WQMA 3S3TA 2GJAA 1AUQA 2O2GA 2HCTA 1USIA 4JJZA 1EFUA 3NWJA 3T3OA 3WFZA 4OVKA 5KSPA 1M8GA 3DUFB 3NCTA 4DR7B 3EGOA 1NVDA 1LI4A 3AGQA 5LP6C 4J76A 1BCSB 4MO9A 3UCXA 4PHHA 5EWLA 3R7NA 1QYRA 4LECA 1ZU4A 2AJTA 4RAOA 4BNJA 3I53A 3T38A 1OIXA 3B48A 3KYCB 3QP9A 3AXSA 3WGYA 2YFQA 1GL9B 1KJIA 5U1PA 3WBBA 1A8HA 1UK7A 3KTAA 3ON5A 1RQNA 3PIIA 3MINA 2G9RA 3U60B 2YKGA 2J0EA 3DE6X 3P9ZA 2VPIA 1VC2A 2D5LA 4OEHA 2Z1MA 5EMNA 4F86A 2MDTA 1JXMA 1DHRA 3LF2A 4LVNA 4IWNA 3FJ1A 3L6BA 1MOPA 2C4HA 5CK4A 4OU4A 5TGDA 3A4TA 3HFGA 3VVLA 3CZQA 2E21A 2OXEA 2PL9A 1P1FA 1VHDA 1RDFA 2Y4NA 4GPIB 4UVGA 1ZJWA 4YRZA 4OI2A 2JAXA 4BX0A 4D8UA 2BGNA 3Q3HA 1JSLA 4A26A 4AF6A 3ZHQA 4BGDA 3CVWA 3HZRA 3VR2A 3CRVA 1XDUA 5A9RA 1Y6QA 3GLGE 3KDPA 4IDHA 3M1YA 3CW9A 3GGSA 3SF8B 2XCSB 2WJJA 2A8YA 3KZXA 4RCVA 5CA0F 4D46A 1UDCA 2IY8A 3NM5A 5EJIA 1N32B 1N2CA 1WP9A 4JKIA 5JBQA 4AROA 1YI0A 1CETA 2WFZA 5F5XA 3QX9A 3RAJA 1QO9A 1L3CA 4LVUA 4M1WA 1SXGA 4PV7A 3A1DA 1KY4A 1EVJA 1EU1A 1U3FA 3IODA 1Z26A 3GJSA 4OB8A 5LBTA 3VKFA 3QVGA 1ZL2A 4BP3A 5F76A 3ADBA 4JB0A 3MXTA 2P5TB 3I1IA 5T4BA 1N1MA 3EC1A 2WSBA 3IVRA 1R66A 3AVOA 7ABPA 2FP3A 4D79A 4DNPA 4BFXA 3EGCA 1U2QA 1ZIYA 3ND7A 4W1PA 2IPNA 4YGXB 4NBSA 3RLFA 4YV2A 4GX2A 2ZG6A 3VOAA 5D51S 1EP3B 2ZRDA 4L6CA 1JUDA 4KPUA 4F7WA 4D1YA 4PYOA 1TYEB 3MB8A 3FPJA 5KTRA 3FFTA 3GDGA 4WZAE 1PW7A 3EH1A 3KPJA 4AVYA 1R2QA 2VDOB 3DL4A 4HH0A 3ANMA 1QFSA 5CT5A 1YHZA 5JASA 4TYQA 4XXHA 3C98A 3TNLA 5IKPA 4UNRA 2NTEA 2VQEB 5EOVA 3TVTA 1HQKA 1JFFA 2HXSA 3DLPX 1F2UB 3UWPA 1RRCA 1LUAA 3QU9A 3EY9A 2VF7A 1HFJA 4FHCA 3UIEA 2P40A 3ORHA 1D0SA 1NVTA 4WL0A 1DTWB 2WF6A 3DHNA 2WU0A 4MVWA 3QXJA 1AZSC 2CYAA 3N5KA 4BIIA 1JG3A 1JHUA 1JQEA 2P2DA 2G77B 1DV1A 2EZ9A 3PXBA 2HTFA 5KX5A 4PIMA 1TO1E 5EWJB 1HY3A 1PYOA 2O3SA 2RSLA 4E22A 2P6OA 4S05A 3FZQA 3C3BA 2Z8YA 1O3YA 3B6JA 3IIKA 4E70A 1IOLA 1FDTA 2OZKA 2PBLA 3L05A 4BNFA 2ZWPA 4R1TA 4MDYA 3OCUA 1I13A 2I7CA 4K3VA 3WMWA 2NUBA 1VGQA 5A6VA 4JOSA 5KQMA 3QUSA 1A7KA 4WFJA 4X7RA 3VTFA 5BXYA 3OQ1A 3V8RA 1KI4A 1UEXC 3JQBA 1IU9A 1J8YF 1GPDG 1GU7A 1RKUA 4HLDA 1YH3A 4INZA 1HDZA 1MT0A 4MULA 5IC4A 1PSDA 2XDQA 3UMSA 5EE3A 2JA1A 4RH3A 3NOQA 3QWBA 4NXNB 2DYKA 3M6UA 4IXWA 4QPCA 2UZ0A 5DBHX 4URXR 5AVQA 2LPMA 4CV3A 3H18A 5DI3B 3SBOA 3ZXUB 4JJFA 4BFSA 4B6RA 5I7EA 3W2FA 1TEXA 3N05A 2FZWA 4A23A 4FEAA 4B3GA 2H8KA 3EZYA 1RYEA 4OXQA 3FW1A 3I9LA 1WLSA 1H2EA 2ZQ5A 3NP7A 4QU0A 2I2WA 3IGFA 3VZDA 5HM8A 1DX9A 4UQPA 1XWIA 2WU8A 4HPJB 5H9VA 1KMNA 5DT2A 1N8NA 1FJGB 1HE3A 4WJLA 2DR2A 3MINB 4BTEA 2WT4A 1JX6A 1YGPA 2FPPB 3KL4A 4PZEA 4X60A 1RKXA 3DZHA 3TIFA 2GHQA 3TO5A 2BHLA 5BQFA 3A6PC 2E0IA 3CE6A 1EFPA 1QIKA 3L0YA 2B35A 1D1QA 1NMXA 2ISSD 4NU0A 3KLMX 1RHUA 2BKAA 5F1KA 4LWZA 2IYXA 3B7WA 4N47A 7ADHA 3M4NA 3BRSA 4OYRA 4B80A 1Z8HA 3IT0A 4NOLA 2E2WA 1KNQA 2OD9A 2ZT8A 2FP4A 3O8NA 4U2GA 4JVMA 1JIIA 1R0KA 2F62A 4J1TA 4RM3A 4N40A 1N34B 4F2HA 1QBGA 1GLGA 1YS1X 2QG6A 5A1JA 1Q19A 5FOQA 3M6LA 1ZW1A 4EL0A 3FWPA 4FFBA 4MICA 1HYBA 3WLSA 2WNHA 2XR1A 2R5NA 2WTMA 3KZCA 1U5BA 4J49A 4MCAA 3TPFA 5JLAA 1T13A 3WK6A 2CLOB 3AR5A 1YBFA 3EQ7A 2HCJB 3I01M 1PI3A 1TMKA 2BMEA 1XLWA 2JGDB 2FWNA 2JJ2A 3KU1A 1GG5A 3LCJA 3QVKA 4FR2A 821PA 3SZMA 1RXCA 3RBAA 3X0DA 4ARAA 4GQIA 1ISHA 4H7DA 4BNDA 5IUKC 5A3RA 1H1LA 4DREA 1YASA 5MDHA 2IYLD 4OXIA 1BRTA 5FI3A 4W1QA 4FN5A 1SC4A 4DG5A 1YFKA 1C3JA 2PX4A 1PQYA 2BC9A 3X1MA 2GA8A 3FHJA 3PICA 1T3LA 1U0OC 2CMHA 4A0QA 5KZMB 5TMPA 3FTEA 2P0YA 3KPYA 3LO8A 3PPIA 4JYPA 4RS4A 4BO4A 3THYB 2WPDD 3GN2A 2AUMA 2AXQA 4DLAA 1TKAA 5IAKA 3TM4A 1UT5A 4ETWA 1E2JA 1JKIA 3CEAA 4GMXA 3QH4A 1XZIA 1YCHA 2GTPA 2CF5A 2WVHA 1N9GA 3EGEA 3F1LA 4P33A 5KTOA 1QHYA 1UPTA 4M83A 5BWLA 5C80A 3HB4X 5DNVA 3CR3C 2XNDD 1KQOA 4CI0B 2XQGA 5C34B 3D5QA 3IJRA 5FIUA 3UFBA 4AQ7A 5H7XA 5TV2A 2EGGA 3QXXA 4NE2A 2I5PO 3EIFA 4BMXA 3H2ZA 3TFOA 4WK2B 3JQPA 4CT5A 1IHPA 1KFCB 3NAMA 4HFRA 5KMGB 1QVZA 1GGVA 1UXIA 4PZCA 1TGVA 1R6XA 2F17A 2ZTHA 3F9IA 4EAQA 1DRKA 2O20A 1P29A 1X1QA 4CGYA 1CJKC 4MV4A 2AR0A 2V9ZA 4JX9A 4D4MA 4F46A 4A0FA 1QRDA 2NUPB 3TL2A 1CJSA 1ZIOA 2IHNA 2R7AA 1Y1TA 4IHAA 4DT1A 1PNVA 1ACJA 1EE2A 1FQWA 3EFHA 1XF9A 3ZHCA 1C4KA 5AFSA 1N5KA 1N5DA 4DLZA 4U2CA 3MWGA 4BX2A 1VMIA 4AY5A 3IHLA 2R48A 5A03A 2C61A 4BZZA 3T9CA 4UNNA 5JNVA 2FUG1 3H97A 2FK7A 2CXPA 2G80A 2RHOA 3C7DB 4LFCB 2BY4A 2C9ZA 2DTEA 2R8YA 3BFKA 3BWVA 1TJYA 3UJ6A 4W5QA 1G21E 2BCJQ 2KE5A 3CC8A 4PM4A 4Y9RA 2HMSA 3W3AH 3P96A 3B9PA 5A4MS 3JYQA 2ZRIA 3BGIA 3NS7A 2J3EA 4H27A 2FAXA 2AYZA 3LP8A 3NBQA 4BJ1A 4L9SA 4MMXB 1LU9A 1SB8A 5JZOA 3MHPA 2QRMA 3G88A 3KD3A 4LBVA 3UV6A 5L3VA 2E4WA 3OPQA 5CXQA 3E2IA 1I3MA 4AP5A 4JC5A 4FCWA 1WDTA 4E5UA 2Q0QA 3MF4A 4TQAA 2QP3A 4GLBA 2QSJA 1HLDA 3PDIA 3VAZA 3P52A 1LC3A 1EBUA 2FB9A 4Z54A 1TVKB 2YY7A 4E33A 4H1VA 3JQDA 4DQXA 4U39A 3WK4A 2ISQA 2OCPA 3OFVA 3VPBA 1E1RD 2QX9A 2NT3A 3FOZA 2FWPA 3EEYA 1YI8A 1UMDB 1DU4A 2JVKA 1T0UA 2V5UA 2AJ8A 4CM8A 2R66A 3E15A 4HRAA 5AJHA 1PR3A 4C1NA 2R5FA 3E1SA 4MR9B 3SICE 1M5RA 4DCTA 5JJCA 2X9VA 1C1XB 1UPUA 3GJYA 3Q0IA 4ZVNA 1B23P 4DYDA 2B1RA 1LLUA 4X1IB 1VKZA 1N0HA 5INTA 2WFMA 4KR7A 3DM9B 2HSZA 4LYDA 4WADA 4EARA 4DKXA 2Z08A 2OGTA 4F9GA 4J9UE 3WC4A 4FGKA 2CT8A 2P6PA 5JDCA 2WOOA 1JQLB 2EIXA 2P6UA 5HF5A 4EI2A 1TA9A 2TS1A 4IOMA 5AJUA 3I30X 3ABOB 3N76A 3VVBA 1M6VA 2D0DA 4LSZA 5CDUA 5KYKA 2KM1A 1IXZA 4IAOA 3TGPA 2I9PA 1AB5A 3WL5A 5IS2A 4LDAA 4BWVA 3U7JA 2H16A 4OUKX 1LF5A 1IY9A 1IBCA 4Q15A 4RZHA 1CYDA 1Y7PA 2QA5A 4M6WA 5DM0A 2OOKA 3G17A 3OM9A 5HILA 3RIEA 3V7YA 5LC1A 2OLKA 3PUXA 3T5GA 1RWNA 1QAMA 1I4LD 2OQ2A 4DRXB 4ZKDA 4YJ2A 3L8DA 3F2VA 4PS1A 5IHPA 3MCAA 2H57A 5DN6A 5H82A 4EFLA 5CR9A 4CM8B 3WIUA 2H1HA 1AKVA 3P2YA 3ETEA 1PFGA 1KDYA 3IP1A 4B5LA 3WGUA 1E4VA 4M88A 1NBWB 2DJ5A 5BV1A 1TAQA 1YC5A 4N0DA 1GN9A 1WOYA 5IU6A 2JKYA 1DOAA 4NE7A 1N2IA 5I7AA 2OFXA 3RHTA 1GPJA 1MAAA 1N2OA 4W4TA 1GPNA 3R8XA 4EHIA 1MG5A 1H5UA 1JLHA 4DILA 2CUKA 2PL1A 1PEAA 2IIQA 1IPFA 3QF7A 5EIWA 2XBUA 1VQ1A 2O3RA 1JFVA 1S8OA 2WWGA 2O14A 3W2HA 2V0NA 2IPMA 3LY8A 3WHLA 4J0JA 4CQLA 3DVRX 2IXDA 1Z0KA 2BM0A 5K8IA 1RZRA 3O8RA 4M6WB 3DBIA 4BAZA 1OFHA 4HB3A 2QN8A 2QUZA 1T1SA 3TNDA 3HE3A 2DR0A 5GGXA 3UTCA 4D5GA 3DE5X 3D3NA 5GMOA 4IILA 5ES3A 4Z1OA 1NY5A 2MYNA 4DV5B 1MIOA 2V7EA 2PJUA 1OGIA 4EPYA 1Z35A 3ZU3A 5IDWA 3NCHA 1Y3AA 2FR1A 5E6SB 1TUIA 1M2NA 1DIHA 2XQKA 3LXXA 5JRZA 1V25A 4IO1A 3F6YA 2FDRA 2EARA 2RAPA 2UYGA 3WIVA 1XTKA 3ENKA 4EG4A 1E62A 4MARA 1E7SA 2DUNA 1BXZA 3HN2A 4FFBB 1LX6A 5JSKA 4Q37A 2H63A 2WF5A 4C7KA 1F4LA 1XCPA 4IL5A 4NNJA 4RHEA 3ZU2A 3HN7A 9ATCA 3G2OA 2X6QA 4NK4A 5DW3A 5KPJA 3EPLA 3DD5A 4RF4A 4BKQA 1JLSA 3PWZA 3P4XA 4URZR 2V7TA 2XDWA 4KMOA 4ROSA 1V6AA 2GN6A 2CJPA 3PUHA 2ODWA 2UUOA 3ONVA 2GETA 3EX7C 1KOJA 3ZX4A 1G6Q1 1BS2A 1FFXB 4UTXA 3HACA 3LQKA 4EKDA 3N2KB 2HMTA 3LVBA 5E9WA 3SX2A 3MT0A 3F47A 3JCZA 5AHKA 2Q2WA 1GZSA 1FMFA 3ZVKA 1VCMA 2JLBA 1M8JA 2CNKA 4NOMA 1XXHB 3LQRA 3QOYA 1YL6A 4R0VA 3IOBA 3IBTA 4FZ3A 3WLPA 1CT9A 1M75A 3VPGA 2DLNA 1E3WB 1R4AA 5IZ4A 3Q6NA 3UB3A 4DEYA 1L1EA 1P77A 2FKAA 4YP9A 1JA1A 5F77A 1ADBA 1IHUA 1QVVA 2MSDB 4MYRA 4IBOA 4GOJA 3ZV5A 5GINE 3F7MA 2N0SA 4MV1A 1V5GA 4GRAA 4L73A 3ZWQA 3HJGA 4N7JA 1IY8A 4V38A 1X7YA 3FZYA 2WUFA 3ME5A 4LJ7A 2GI4A 5KOJA 4CL8A 5K0TA 1KU6A 2YMQA 4RYLA 3PT9A 5KHOC 1O7JA 3UXMA 1M6NA 2ABWA 4UM8B 2CXNA 1Q92A 3EMVA 3LV8A 5B1SA 3RODA 3V9AA 1LWNA 4PF1A 4D4HA 4OCZA 1OFIA 4YY3B 2HW8A 1XPOA 4JYMA 1V95A 1N6PA 1OKKA 2G1UA 2H2GA 2Q2OA 4RVFA 3CVXA 1VB5A 3E3OA 4TXNA 3GNTA 4HHEA 3CRMA 4JEMA 1RWQA 4LXGA 5AI0A 5TF4A 4CM9A 3OBBA 4QEZA 4GLOA 1E5TA 3O8LA 1GPAA 1NW7A 2OO3A 1P5FA 1TE2A 2IQ5A 1JW9B 2X0KA 2YW9A 4UOQA 2GARA 4US1R 3JZMA 3ROMA 10MHA 1EUYA 3QTBA 1YTLA 2FETA 4GE3A 3L4EA 1W0JD 1KDTA 3MYYA 3ICEA 5ESRA 4IH4A 5AQ1A 3GG2A 2ZT6A 4KNVA 3RWOA 3S44A 1S2IA 2HOQA 4X1YA 1Z3IX 5U4XA 4ARZB 3ADDA 3T9EA 5COAA 1A2OA 3DNPA 3LH5A 1OGYA 3Q7QA 4HDSB 4I14A 1DG3A 5FYDA 3K9LA 1SCAA 2VUHB 4FIZA 5FPHA 2BWJA 3MCTA 1P9OA 3PDWA 3S7TA 1E4OA 3TOVA 2REBA 5JVDF 2OCAA 5BMVA 5SY6A 1XMXA 1TF7A 3FETA 1J99A 2GOYA 3I39X 2WHYA 4HF7A 1CVLA 4NBVA 1KTIA 1X7WA 1KIFA 1UM8A 3BTSA 4BVEA 1A98A 1MENA 2UUBB 5HK8A 2LCFA 1EVIA 1QKJA 2XMGA 4O0MA 2Z8ZA 4FEYA 5EG5A 1ZVVA 2VT2A 4A10A 1W4RA 1TMOA 2Q1UA 4EUKA 4PFQA 2DSNA 1MDFA 1V5IA 2CNWA 2XRZA 1S1MA 3ND8A 4EW3A 2VKTA 1Z6AA 1MW9X 1SOUA 1ZN2A 4UEOA 3V8MA 1YVPA 4UULA 5AHRA 1DAIA 2OORA 5AIAA 5JQGA 1W9HA 3Q8LA 3B1VA 5C1BA 2ID8A 1JDNA 2F7SA 3LT5A 1MFPA 3GRYA 5CK5A 2X0RA 3CO5A 5EFZA 1EBFA 8OHMA 3HP7A 1HM5A 1OREA 3KHUA 3W5AA 1K63A 4K9KA 1M83A 1P3DA 5JS2A 3T5TA 3TSYA 1JEYA 2HK8A 3FSRA 3NOXA 2XB6A 4PSUA 4HQ0A 1N8TA 1K98A 3VGJA 2YJNA 2Y0EA 3C7CB 5AW4A 2VRWA 2F55A 1KR5A 1M2VA 2P8JA 1DRWA 2X86A 5ALEA 3DHYA 4IJWA 4KO3S 4E5SA 1Z38A 3RUIA 2GILA 2DFTA 3FPAA 4LJLA 5HE9A 5KNLA 1PD0A 3DWIA 5AM2A 3C3JA 3THOA 2WB2A 4D8VA 5L8VA 3HBFA 2G88A 1VI2A 3D6NB 3NFRA 3OTQA 2N75A 4ND8A 3U4DA 4PN7A 4TZKA 3V4RA 5BNIA 4YCSA 3QVMA 2MSNA 5ABPA 2ZE7A 3NTOA 4R9NA 2RIPA 3RVMA 3WLKX 2IBMA 2VP9A 3FBGA 3NVAA 5E3JA 2EBUA 1XA0A 4JZKA 4LHVA 1JI3A 1N7HA 1WABA 2QVBA 3TZLA 5JC1A 3INTA 1WPGA 1K6XA 2HX1A 3CEJA 3QGMA 1KZHA 3EEFA 2ID9A 4G1FA 5JADA 2PUJA 3CHYA 4BEJA 4KLAA 1OLXA 2QMEA 3LUCA 4NH4A 2QAGA 4GP7A 1YBVA 1ZY2A 4IJVA 1S8NA 3FCXA 4TM8A 4BMSA 3CEMA 4P3YA 4PSVA 4J1TC 3I5MA 3HCBA 3QJGA 1CUFA 2JJ1D 4QBGB 1AU9A 1I1OA 5C31A 4CLOB 3RJTA 2HIGA 2VHQA 5DSTA 3PKZA 2QIPA 3HWWA 3OT1B 5KREA 1FLNA 4P7FA 2PV7A 1Q1QA 4LMBA 1YDEA 5GAJA 5J47A 1ZOIA 4TLEA 4YAWA 4RJTA 1Z0UA 2J08A 2R1VA 1PGJA 4JBXA 2PKCA 2WP0A 1JFLA 2DJIA 4F2WA 3DTTA 2C3PA 5DGCA 3ZBPA 3AB8A 4V1CB 5AW3A 2PWBA 4FVTA 3RS5A 4H1HA 1R6UA 1NBIA 1RWPA 4RADA 3STHA 1ZI8A 1ZR2A 3EUFA 4ROTA 4A7PA 4BRUA 1JALA 1GAWA 4HB0A 3OQNA 3AM4A 5KNDD 4EO7A 1ZM7A 1LDGA 1NJFA 2YY5A 3O8QB 4JJ4A 2H0AA 4LTNA 1U0HC 1ZD2P 5GZ6A 2C2ZA 1YZNA 2XEDA 3AHCA 4UOZA 2LGJA 2JGKA 4CCYA 4WRRA 2BBTA 4NMHA 3UG7A 5L4NA 1EIWA 5JNTA 2PKRA 4PG7A 3PF8A 3ZXSA 2F1IA 4L0MA 2C4NA 3TR5A 5J3JA 3NAGA 3WI7A 5CCBA 2C7QA 1GT6A 2G71A 4Z3KA 2CXSA 2Q4TA 2DTXA 2ZSFA 3N7TA 2EP7A 4G37A 2G0AA 4ZVKA 3VX4A 1N1GA 4ZGWA 5CJJA 3ITKA 4NFLA 4EF6A 2DKNA 4AN4A 2Y8EA 1QCDA 4NHEA 2RGEA 4GP6A 5M3BA 1FUYB 3FLBA 2QTMA 4Q7JB 5B1HA 2PTHA 5T4FA 5CUQA 3RLIA 3TX2A 1FP2A 3M5WA 4FYKA 3LI2A 4K86A 4HNAA 3LF1A 4YQZA 1UAAA 3I1YA 1DKRA 1RE1A 2VI5A 1E2PA 1XTTA 5EE9A 1WXDA 2W37A 2WM8A 3QYJA 2YUTA 4HK4A 2H7VA 1P4RA 5BRAA 1MJFA 1TT5B 1YCDA 1IAQA 2P5SA 2PBRA 3FUCA 4U9HS 3S1AA 2HUPA 2P91A 3IKMB 1BRMA 4PVCA 3WKDA 2HLPA 1DMSA 4YFYA 5F1PA 2O3TA 5ED0A 3OTOB 3LGXA 1FPMA 1JQBA 5C0OE 3TYXA 4JUIA 3G0HA 3SLGA 3K92A 2WSMA 4BFZA 4B3TB 2FG7C 4F3KA 1G5QA 5LP6F 1VIVA 4JI3B 2ONYA 4N54A 3KT6A 4QRHA 2YVLA 4DW8A 3LP5A 4QKQA 1GUZA 1L5OA 2Q29A 2QM3A 1S7CA 2QSZA 4NULA 5JH7B 1XEAA 1HEIA 4K28A 3PPXA 1J8DA 1VI6A 2ERYA 4F11A 4KQMA 3TLGB 2E4XA 3PNMA 3DPSA 4LZPA 1JYEA 4A1OA 5M2QA 4HEJA 1XZFA 2EFHB 3CX3A 3R0VA 4FYXA 4PG5A 4MQFB 4UREA 1FMLA 1RYYA 1YMQA 1A0OA 1RLOA 1JFRA 1Z83A 1Q7EA 1JFTA 1RM3A 1H2RS 1YMVA 1JEQA 3BFXA 4R1UA 2ECKA 3UPDA 4QJ4A 2PXXA 1PNQA 1RWKA 3N8IA 1QANA 4G5GA 4ZAXA 4RXUA 5HKBA 4XWOA 2Y67A 3LKDA 3TTXA 3T1OA 2GPAA 2JRCA 4MRMA 1PUIA 4MVJP 1IN5A 1KIMA 5IKEA 3TECE 1M1XB 4YMSA 3WKCA 1XRLA 4E12A 5JHGB 4EMTA 3QTTA 4CTJA 4JC0A 3K2IA 2Y6VA 1L7BA 3OTWA 4ZQIA 4IINA 3DQQA 3LYAA 1VHJA 4L4YA 4EPVA 1YT5A 2CFCA 1WDLA 4OI4A 1RJEA 1QIJA 2ZSAA 3KP1A 4G5FA 3WSTA 4L8VA 3PSAA 3RVDA 5FI5A 3UT6A 3BIXA 4PLWA 1NLFA 4LNHA 4ZKEA 2BTEA 2CDCA 2FMUA 3N2GA 1EWTA 2QD1A 3B2QA 4LSWA 3RRZA 3VX3A 1BHQ1 3F67A 4EENA 3GGPA 4XR9A 2VNSA 3NB0A 1Y0BA 4TMZA 5FLEX 1EE1A 3VBEA 1V1RB 1TTQB 3I0NA 3O1JC 5LLDA 3KQOA 4JMLA 3LS2A 4ZWNA 5MHTA 3V7WA 2BOVA 1K8ZB 2JFBA 2VHEA 4C4YA 2V7GA 4IY1A 1W5BA 4YFVA 4M37A 1REQB 4C0KA 2PO7A 2IGBA 4D9MA 4PLHA 3U4AA 3AJRA 4TUYB 1GWNA 1Q7TA 3GLIB 4DV2B 5DOVA 1TYCA 2ADMA 4NPAA 1WEHA 1XDDA 2HREA 1MMFB 2VZ0A 3HU1A 1GQSA 4J8PA 4IICA 3RASA 3RK4A 2V1UA 1PR0A 5D7BA 4RNCA 2IYWA 3FDXA 2OCXA 3ZE9A 1G17A 2GZ2A 1VECA 3GA0A 3IQXA 3AL2A 4AJIA 3P5SA 3G2KA 3LCRA 3TRJA 3EBPA 4ZCRA 4DR4B 2QNBA 4RK4A 2LD4A 3PGKA 2GJ9A 2ORYA 4RD3A 1ICIA 1RBZA 1J9EA 4F4DA 4MI6A 3AEKB 1DEXA 1I51A 1YO6A 3HB5X 4LJSA 4RMIA 4OB6A 1DKPA 2W4MA 5CX4A 4LI3X 1F5SA 5AVOA 2DQ4A 3RFXA 3ESZA 3PGLA 5DK4A 3LSYA 2ZZNA 4Q3EA 1G0NA 4IRMA 4O4LB 2JLXA 1TM4E 3LPLA 3W79A 3H04A 3EG9A 3SM9A 3RO7A 2GXQA 1QV6A 3T7AA 1OU4A 2FOXA 3A27A 3VNQA 4EYQA 4AZ3A 2UYHA 5EE0A 2JRLA 4A4DA 2QM8A 1SA0A 2GCOA 4IFEA 4GYWA 4TTJA 5HZMA 3C5CA 3BGOS 4IHJF 2ZDQA 5ALMA 4QFMA 4C2BA 4LRSB 5EE5B 2FRDA 4WLOA 3NKFA 1GGEA 3DEJA 1XMSA 1IMOA 3QLEA 1MZVA 3GP8A 3C16C 1EG7A 4S24A 2MINB 3U0BA 4KV7A 5CFZA 1EDZA 2A5JA 4KIWA 2GM9A 1BMDA 5LDHA 1KSJA 1M2OA 1DXQA 1XRSB 3V4OA 2Q3LA 4BY9E 2FW0A 4II2A 3F71A 1LDYA 4HWSA 1G3RA 5IN4A 1X38A 1EJ0A 1W1IA 2ZRQA 3KB2A 4Z2AA 4P3PA 2VBFA 4FWTA 1E5LA 3L0CA 1VYTA 3P2JA 4JI1B 3ANTA 5LP6B 4TKZA 1P4SA 1UMCB 3VC3A 2W2KA 2NOAA 1VPWA 2PQ0A 1G42A 2E6UX 1EDBA 3ZV3A 2A4MA 3F8SA 3FFAA 3TG8A 1C5KA 1DO8A 2GPYA 2GPSA 2M9MA 1QG6A 2O7QA 3BMOA 3H4TA 3KKKA 4PBTA 4Q3LA 5EXSA 1KP9A 1CSEE 3C3KA 1G1MA 3MNFA 3RBVA 5LM3A 4F96A 1Z3CA 3JVUA 4RVGA 4ZPXA 2DY1A 5DNYB 4RF3A 1K3FA 2ECPA 2XQFA 3EAGA 1OX4B 3I73A 2FZVA 3W06A 4MOWA 3CG4A 2FSVC 3GEIA 4G25A 1PZNA 1F0NA 1SAYA 3ETJA 4DUGA 4GL2A 2W6ZA 1P0FA 3B1XA 4EGQA 2I8CA 2R6ZA 2XTAA 2KHZA 5ALHA 3V8QA 3B8EA 2QORA 4WXPA 3MK31 4YDSA 1BROA 6AT1A 1OILA 1W4CA 3T5CA 1T6NA 1KPGA 2GX6A 3P20A 4AN1A 3MMSA 4A2QA 5E9JA 3RRBA 3ESDA 1YJCA 1XMVA 3QJYA 1NXTA 1YL5A 4KFUA 3E7XA 5KCMA 3VH1A 4UBKA 1DB3A 1YVDA 2HC9A 3CNEA 4EA7A 5K45A 4OU5A 1JHQA 4G65A 2R7MA 3RAPR 5K6RA 1KQGA 1USGA 4IIVA 4UHBA 1DCMA 4DGQA 3WDMA 1TD9A 3OLZA 2JD2A 2R00A 2ZRMA 1OY1A 1UFKA 2J59A 4TL8A 3BD6A 2DPMA 4IIGA 1LPOA 3JAKA 3UC5A 4BP8A 1CEXA 3CUKA 4GKJB 4YIHA 4AJEA 2J33A 3NT5A 3DZKA 2C95A 3TLMA 2NM0A 2CLKB 5K8UA 1RXVA 4AMVA 1NG1A 4KFTA 1EM8B 2EP5A 1KI9A 1U28C 1R18A 1YJQA 2O4CA 4F3TA 4UD6A 1TM3E 1A5SB 3DNFA 4H3VA 4NMLA 4I8XA 1ADCA 1BHO1 3GJ3A 1JBKA 1UBGA 2HBRA 3HUDA 2C3MA 4UE2A 4WACA 1WB6A 3I2FA 3G2JA 4NENB 4EJFA 1I8TA 3U62A 1ZCBA 1O8BA 3M1IA 1LEHA 3JR3A 3SZRA 4NNPA 2VJPA 4MWSA 1AS3A 1EJ2A 1SXJA 3S1AB 3CE9A 4C4XA 3E7PA 3UAVA 1ODCA 3HV2A 1NRJB 4AUEA 5IAAA 1SCQA 1ZJ6A 3GGGA 4GUAA 2XXJA 3JQFA 2ZUWA 3D6TB 2G1PA 5K7SA 3ZDEA 4WX2B 4K2AA 4KQ2A 1NULA 4GWLA 5H70A 1YCGA 1J9ZA 2I1QA 1WKVA 4K1LA 3VSBA 3K0SA 5E4TA 2R6R1 2PMEA 2G1AA 1BFKA 1TQHA 1P1RA 1I3KA 2QVXX 1JNXX 1G20A 2ZVPX 3AUXA 2FWMX 2VXCA 3MBOA 5AJZA 3T3EA 3ZI0A 4M8LA 4CN8A 1KYWA 3JW8A 5CBPB 1G59A 2N46A 5D3MA 1FMCA 1H2HA 3GB9A 3WGTA 4TXMA 1MAVA 3NHRA 3I6BA 3ZJYA 5KNCH 4A6XA 5DM2A 2X8JA 2W2LD 3H9BA 4QYMA 3NTRA 4PR0A 1SKAA 2WE8A 2OV1A 3EQ2A 5FNVB 1E2FA 2IXGA 2J46A 4C4ZA 4YRBA 2Y1XA 2HXGA 5AUPB 1ZUD1 3VI4B 2JD1A 1POXA 1WUTA 3L1HA 1K97A 3D1JA 2RGAA 3S2SA 3DT6A 2O4UX 2OSBA 1L4FA 2G9QA 3GRVA 3P7MA 3VNVA 1ZAYA 2YBEA 5JWRA 3MWFA 5IDXA 2HM7A 5B4UA 3WYEA 3HA3A 2IT1A 2CD7A 1MFZA 1QOPB 2HA6A 4DLUA 4KRYA 1VE3A 2KSQA 3IVXA 4L2IB 4RSMA 1YHYA 5G02A 4ENPA 3QOFA 4KVFA 3KYJB 3QHAA 4UFOA 5EIAA 4IXTA 4L0DA 5FF9A 1R0YA 3OICA 4E11A 4R71A 2H1CA 2W11A 3FIUA 3ICOA 3NANA 3ZLTA 2M1ZA 1TAGA 3I6QA 3LQFA 3LGAA 1X1CA 3E05A 1J0AA 1W2GA 1RQXA 2E1RA 1VDMA 2RAFA 4MIKA 5D1HA 2VP3A 4FSHA 3D1LA 3FYDA 2F3PA 1OH6A 4UNIA 5GJBA 1I6KA 2NUTB 3PNBA 2G40A 3SX4A 1A76A 3KG2A 3UQYS 3UXHA 2ZUTA 4R9SA 2VJLA 1XHEA 1SHTX 2H7XA 1FYEA 4PQEA 4K9QA 5LNK6 5DW0A 3MSCA 2REQB 5GV7A 3SC2A 1H6CA 2H5IA 3CEPB 4P7KA 3B7PA 4KZKA 3JRXA 4EF4A 1VL1A 1AKYA 1VPVA 4H60A 1Y80A 2VC2B 2X8LA 3DC7A 3KEGA 3CN7A 3G49A 4R8SA 4AYTA 3KV1A 2WDPA 4HEHA 2FTKE 3F4LA 1E1QD 2C2GA 2QU8A 1AKMA 3ZHTA 3JZDA 2FYTA 1STOA 1BDBA 1IHYA 1R9NA 3HY6A 4A2CA 3HDGA 1XWWA 1C1DB 3D4IA 4V03A 1PW5A 2YUIA 2WWXA 2QT0A 2Z4RA 1VG1A 2WZBA 3GJ5A 2VUTA 4TYPA 4BMNA 3PL5A 4BVLA 5J43A 2QJOA 3AW8A 3WY9A 2ZBFA 5GZ3A 4PO8A 5I3CA 4PRKA 3TB6A 3EBOA 4N8SA 3W5IA 2D8MA 2BBSA 4M1SA 3G2IA 3L7CA 1GQRA 1WQ4A 4BJHB 4ETNA 1DDIA 2EZ4A 1M74A 4M8NE 3SCZA 4EUFA 1T4DA 1UDXA 3LP6A 5LQCA 2H1WA 1N7GA 4FLFA 3S28A 3NRCA 5K3DA 1A5ZA 2WG0A 4K87A 2XUKA 4JJAA 4MKXA 1EFVA 1OBVA 1ST3A 2JFFA 2KS6A 5T41A 4Z49A 1RHKA 4GM4A 4R3NA 1G5PA 1TUEA 2Q5IA 4KAAA 3UJ9A 3U7FB 1UJ5A 3V8BA 4YRRA 1T35A 2P1DA 4LZAA 5EPEA 2ZJBA 1R0RE 1K4KA 3PVCA 3BPSA 1C30A 4ZO8A 4CM3A 1I0LA 4GU5A 4NZOA 5T3UA 4QICA 4RSHA 3H5VA 3W1WA 2R1UA 4ALIA 1CJMA 4KXXA 5FWXA 3RVRA 5HJ5A 1V5WA 1OIWA 3DAFA 2J87A 5BN3B 2OGSA 4S1PA 3G82C 1OOEA 4RF2A 4RFLA 4G0PA 3NIWA 5HJEA 5IX8A 2Z58A 4HI0E 1R27A 1VL6A 2I1LA 3L7YA 3PI7A 3MMXA 4U7WA 1K6EA 1JQDA 5LB4A 1UH5A 3TDKA 4LZJA 3UCEA 3KXPA 2OPHA 5IJ0A 2E5LB 2R1TA 1K5DA 1IJKA 4XAQA 1Z4PX 2EQ5A 3ND9A 4AXBA 2RCYA 3K4PA 4ZI7A 5LR6A 1QP4A 4Y9UA 1VPDA 4XCXA 1Q22A 1N6LA 3K35A 3QITA 4RFSB 1OXUA 4BBPA 3LTNC 3HL4A 3QKUA 4DL9A 1JDBB 4MWCA 2QY6A 4JLBA 4JAVC 1NT2A 4NR0A 3CZ4A 3GZNA 4ZXFA 1R0ZA 4Q1FA 1FP1D 2IWHA 3SOZA 4AUNA 5BUCA 3EZ9A 3T4UA 1QGDA 3WO0A 2XHEA 4BPRA 3AIMA 3M5DA 4MS1A 5K3SA 1OQAA 3A10A 3ZWDA 4NDAA 4NBKA 4XB2A 4OHBA 1CLUA 2JCXA 4M60A 3CH5A 4YUVA 1UJMA 1FNDA 3UT5A 1KS9A 3AEUA 1ATZA 2EYUA 4KIUA 4R6XA 1SUFA 5A3JA 4FQ5A 4F5WA 3I9KA 3K8OE 4JUAA 1VL5A 2NSJA 4PYJA 3HJBA 1T5TA 4G0NA 4TGLA 3R3YA 1O6BA 1ZIDA 2X0NA 1TF2A 4FFWA 3ZLBA 1ESCA 1PLLA 3I34X 4IF4A 5JALA 5L7TA 2GF0A 2IYTA 3QLTA 2CD9A 1ZKDA 2VXYA 5DIFA 2AXNA 4IXMA 4H7KA 4DRZA 1OZFA 1FB5A 4PO3X 1L1RA 2FN8A 5G2OA 3LUAA 1DC8A 4YP0A 3ESRA 3DDZX 2W2PA 2DOKA 4B71A 1OXVA 3ZS9A 4ZHQA 5LQNA 3ZGYA 4TWRA 1W581 3FYUB 2HYDA 5JH7A 3P9QA 3QFSA 1P2FA 2O3UA 2AEEA 2W0MA 4HRVA 3ILVA 3ADCA 3WOVA 4RIHA 2WT9A 1T8RA 1MF7A 2V5AA 1F9AA 1K86A 2W71A 3DO8A 5I7FA 4FPXA 4LRWA 4BO1A 2GASA 2APJA 4FGLA 5B64A 1LD3A 4V0QA 1JA9A 3I45A 2XYHA 3K2BA 5KU7A 3AV0B 2CSUA 4N3NA 1JJAA 4IFBA 4UBIA 2J5XA 4E2FA 1P4JA 2XGJA 3IQIX 4BCCA 3K3PA 1OFVA 1F0KA 4LRUA 2A1IA 2EGUA 4W6QA 1ZA1A 4G4SP 4BQRA 1FY2A 3PNVA 4MRVA 3AB7A 4QGAA 2XWJI 4RA6A 3VGPA 4GR5A 4C9BA 1W9MA 2VSYA 3GC6A 1GPBA 4P83A 1WZCA 5DSXA 4IKEA 2IYPA 1ORIA 3B89A 4BEWA 1UAYA 5B7GA 4B5KA 4FJ2A 2ZKLA 5K8CA 5JU6A 5BVHB 1RKVA 2FCRA