1KE1A

Pseudomonas serine-carboxyl proteinase complexed with the inhibitor pseudotyrostatin (this enzyme renamed "sedolisin" in 2003)
Total Genus 137
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
137
sequence length
368
structure length
368
Chain Sequence
GTAKGHNPTEFPTIYDASSAPTAANTTVGIITIGGVSQTLQDLQQFTSANGLASVNTQTIQTGSSNGDYSDDQQGQGEWDLDSQSIVGSAGGAVQQLLFYMADQSASGNTGLTQAFNQAVSDNVAKVINVSLGWCEADANADGTLQAEDRIFATAAAQGQTFSVSSGDEGVYECNNRGYPDGSTYSVSWPASSPNVIAVGGTTLYTTSAGAYSNETVWNEGLDSNGKLWATGGGYSVYESKPSWQSVVSGTPGRRLLPDISFDAAQGTGALIYNYGQLQQIGGTSLASPIFVGLWARLQSANSNSLGFPAASFYSAISSTPSLVHDVKSGNNGYGGYGYNAGTGWDYPTGWGSLDIAKLSAYIRSNGF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SERINE-CARBOXYL PROTEINASE
publication title Inhibitor complexes of the Pseudomonas serine-carboxyl proteinase.
pubmed doi rcsb
source organism Pseudomonas sp.
molecule tags Hydrolase/hydrolase inhibitor
total genus 137
structure length 368
sequence length 368
ec nomenclature
pdb deposition date 2001-11-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.200 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Peptidase S8/S53 domain 1ke1A00
1ST3A 4NE7A 5FBZA 1C9JA 5ARBA 4LVNA 4KPGA 4ZOQI 1YU6A 4I0WB 1TM4E 4H6XA 1SN7A 2SBTA 2ZWOA 3A3NA 5ARDA 1C3LA 1TECE 3QMPA 4OMDA 1ZVKA 1TO2E 2E1PA 4DWWA 2XTJA 3BX1A 1SBHA 1GT91 1ST2A 1SUBA 3UNXA 4BWGA 1S01A 1EA7A 1Y3CE 3D43A 3L1KA 4M1ZA 2SICE 2X8JB 1KE2A 1DUIA 1Y48E 3DVQX 5I9SA 3VTAA 1SPBS 1PFGA 3LPAA 2Z57A 1PEKE 2PYZA 2SECE 1GA1A 1SUDA 2W2PA 3EDYA 4H6VA 1TM5E 1Y4AE 1SUPA 3PRKE 4K8RB 3DE6X 3CO0S 1SBTA 1IAVA 3A3PA 1DBIA 3LPCA 3SICE 1V5IA 2TECE 4WOBA 5FAXA 3VV3A 4CG0A 4MZDA 5JXHA 2PWBA 1SELA 4RYDA 5AMXA 1LW6E 3Q40A 1KE1A 2QTWB 3GCXA 1GA6A 1WMDA 3DVSX 3HJRA 1BE6A 3I34X 5JXIA 2PWAA 1Y9ZA 3QTLA 1WMFA 3AFGA 2HPZA 4AKSA 3GT4A 2Z56A 1KDYA 5K7SA 3VSBA 4ZARA 1SUCA 5ARCA 4NE9A 1SUEA 5AVKA 5SICE 1OT5A 3QFHA 4CFZA 1NDUA 3VYVA 2DUJA 5FFNA 3DE5X 3EE6A 1UBNA 1GNSA 1Y33E 3LXUX 2GKOA 3TI7A 1BFUA 1SCBA 1ZVJA 1WVMA 3AJ9A 1TM1E 4GI3A 1T1GA 1TM3E 2G4VA 1OYOA 3DDZX 3ZXXA 2P4EA 2PMWB 3DE4X 1Y34E 1SH7A 2Z2XA 3BPSA 2HD4A 1SCDA 1SCAA 3DVRX 1AU9A 3DE3X 3H42B 1C9MA 2X8JA 3WIVA 1P8JA 3I37X 1JEAA 1GTJ1 1T1EA 3DE7X 5AQEA 4DZTA 5B1DA 2Z30A 2WV7A 2PKCA 4C3UA 1BFKA 3I2YX 3DE2X 2W2MA 4FONA 1XF1A 3AJ8A 3DYBA 4J94A 5JXGA 1MEEA 1R0RE 4OMCA 3F49S 4DJ5X 1OYVA 1GNVA 2ST1A 4C3VA 1Y3DE 4CFYA 5B1EA 2DP4E 3DWEX 3DW1X 1KDVA 1GA4A 1Y1KE 1EGQA 2W2NA 1TK2A 1PTKA 2W2QA 2ZRQA 5JMOA 1SBCA 1Y3BE 3SQOA 3DE1X 1MPTA 1Y3FE 4OV6B 3WHIA 1P7WA 5CW1A 1THMA 3CNQS 1KDZA 1GTL1 1P7VA 1V6CA 2ZWPA 3TI9A 4YN3A 1AK9A 1NLUA 3TECE 1IC6A 1SCNE 4HVLA 1SIOA 1T1IA 4LVOA 1YJAA 1GCIA 1CSEE 2W2OA 3WIUA 1SVNA 1S2NA 4H6WA 3VV2A 1Q5PA 1SUAA 1TM7E 2Z2ZA 2V8BA 3T41A 1CNMA 1TMGE 2IY9A 3D9QX 4KG7A 3ZXYA 1WSDA 3GCWA 3Q5GA 4B5LA 3F7OA 1Y4DE 3DE0X 1GTG1 2WWTA 4WOCA 5JXJA 3F7MA 3WQBA 4Z2AA 3I30X 2XRMA 3VHQA 2DQKA 1SBIA 1TO1E 1WMEA 1S02A 3EIFA 1AQNA 1SCJA 1VSBA 1AF4A 1SIBE 3PTLA 4JP8A 1YJCA 1HT3A 4KB5A 4NMXB 4AKTA 1PJ8A 3GT3A 2WUWE 2B6NA 4HX2A 2Z58A 1R64A 3A3OA 1SIUA 1BJRE 1AH2A 1AVTA 1C9NA 3DW3X 2PQ2A 3LPDA 2SNIE 1YJBA 1NDQA 3BGOS 1R6VA 2ID8A 5AVJA 1SBNE 2ID4A 2WUVA 1AV7A 2IXTA 1BE8A 1BH6A 2PRKA 3P5BA 1A2QA 3OSZA 2Z2YA
chains in the Genus database with same CATH superfamily
1IFXA 3JRNA 4DBZA 3K0FB 3L6BA 3HTXA 4PIVA 5HUQA 5CIWA 3MBIA 1ENZA 1L5MA 4ZOEA 3TD6A 3IOCA 3ZWCA 4X92A 3HLKA 4WGFA 3N8KA 2H1LA 2XMSA 4U4AA 3TPZA 3QPCA 3GEEA 3R6LA 1W5SA 2A88A 1Y42X 4IDAA 1JR2A 3LP6A 3E1GA 3NTRA 4A0RA 4ZQBA 3KTFA 4ER3A 4FB4A 4LSGA 4ZI2A 1W94A 1NXVA 2A9KA 3L0IB 3CX7A 4RFSA 1YK1A 4OJNA 5DGIA 3SAJA 2RGUA 1WS6A 4EP1A 1CZHA 1U3UA 2GZRA 2CXHA 3PENA 1OU4A 1C8LA 1U8YA 2J6BA 3V7YA 3DJYA 3M33A 4FKMA 3WY9A 2XXAB 1D6SA 3NOOA 4LDZA 3F6BX 2ZWVA 5ALYA 2PUBA 1P74A 2FPXA 3OI7A 2G70A 5LFAA 1YA4A 2H1HA 1KE1A 4DLBA 1E2IA 3I2IA 1UMBB 2XHZA 1X1EA 4JR1A 2JFUA 3ROQA 2XMDA 4MRMA 2FWIA 1QG0A 2RBEA 2J41A 1PNRA 5LLTA 1OB5A 5JPCA 2KSQA 1UJMA 2F3QA 1S8OA 1W87A 2BBTA 4EG7A 2H1CA 1T29A 1PZHA 4OM8A 2J0QA 3QFHA 1NKSA 1BU5A 2ZWIA 3FNEA 1EGAA 2WF9A 3LLVA 1OU0A 4EKDA 5BV7A 4UTNA 1Q15A 1SXJE 4RULA 2PLNA 2RHCA 4XX0B 4UHCA 3REFA 1UP6A 2JA1A 3RK1A 2O8CB 3LOUA 2FP4B 5K0BA 2BGLA 2C78A 4BVLA 2JGAA 4GAEA 3GJ4A 2ZI6A 4MR9A 2ZJ2A 4HN4B 1SCDA 5LMCA 1A77A 2RHBA 1JQDA 2FF7A 1X3SA 3LHDA 4CV3A 3EQ6A 5B6JA 4LZJA 3H9BA 4CM7A 1U8CB 3AJDA 1N5DA 1TEXA 3FCEA 2BTQA 2Z6VA 5ALOA 4CLHA 4ZCLA 1B74A 3QFSA 4QNMA 4LXYA 2FQ1A 4ZKDA 3QE3A 2OSVA 3ELUA 3ZDDA 1CQZA 4UTVA 4ZYXA 4L07A 5KVQA 4LNAA 1UAAA 1R0LA 4OFBA 2QSYA 4KYIB 3PWZA 4NBLA 3SQOA 4CLOA 3EXFB 4DUGA 5I7FA 1C7IA 3C5EA 4PC7A 4HDNB 4EATA 1LSJA 4F38A 3F6SA 4H1TA 3KUXA 4MV3A 4MARA 3ZE0B 2QRVA 4EI8A 5IMSA 5GJWC 3HJNA 1NT4A 4HDRA 4IXDA 3V97A 2HQSA 4NEGA 4YP5A 1JJFA 2DH6A 1K7EB 2JLBA 3IILA 4OQLA 1L5GB 2EQAA 3DMPA 4WZAB 4DSOA 1XL1A 4BX8A 4GI7A 2WHXA 5GAJA 5DTIA 5L3ZA 2UDPA 3E27A 5DRYA 3UATA 1NVVQ 1YMQA 3EF3A 2VJNA 1GU1A 2W6OA 1JMVA 4L02A 5K51A 2K2WA 2DUWA 1PK9A 1SIUA 4DWJA 2B69A 5CB0A 2BJHA 1FDOA 1IQUA 2Z2KA 5AHKA 5JO9A 1OSNA 4DA4A 5AW1A 2PQ6A 2VHCA 4YRZA 5TIIA 3PXBA 1O0BA 4D02A 3MJVA 4D3SA 3ZHSA 2BH2A 5ARBA 5IBRA 1KBOA 5AR1A 1TJPB 4JEHA 2AH5A 3DLHA 1W4LA 3HKBA 4I0WB 5ITZA 2QBYB 3EEIA 3FBTA 4KMMA 4HB0A 4EJ6A 4TYYA 5DNDA 1F4VA 5HRAA 2EZ8A 4XDYA 3KFVA 1W46A 3T99A 4QJ3A 3Q4GA 3PRYA 1EUZA 2ZDQA 2ZR7A 1PQ4A 1XO1A 3GEGA 3SZOA 1E3MA 4Z0PA 4B48A 1W0JD 4WNAA 4OGKA 1IRIA 4POOA 3RASA 2QU8A 2B1GA 1KPIA 2GQ0A 3TZEA 1C29B 1JJBA 3SF8B 3UK0A 3ZDQA 2YW9A 5HEKA 5C8YB 3FHLA 3TTSA 3VC2A 2PA3A 1NUTA 1RIFA 1ZIOA 2QUIA 4KXLA 3WWEA 3ONFA 4CU2A 5L3QA 5T64A 4O5AA 4FMBB 2EJUA 2R1ZA 3K5WA 4RPIA 2X5KO 1OX6A 5HA5A 5FL7D 2RGYA 1DMRA 1X1QA 3C74A 1CD5A 5REQA 2DBVO 1XYVA 1MC1A 4IHJF 3CN7A 4HP8A 4AKSA 3GT4A 4DZRA 5EMKA 2VVTA 2GCOB 3T12A 2X2OA 3G9TA 1NIPA 3PNKA 1SUCA 3KBOA 1ZOLA 4MGEA 4GG1A 4NXNB 4IDEA 1JTFA 3SK0A 3LVBA 3ZZ1A 1LFAA 5MFPA 4BB5A 4B6QA 1V7ZA 1VCIA 1Z17A 3I2JA 3U4QB 3HB7A 1Q22A 2DSTA 5KYUA 4C04A 4M9CA 1ZO8A 4W1QA 1BYUA 1OGJA 4LDJA 2A0YA 1E5DA 4C0QC 5JNSA 2XMBA 1GEGA 5KOYA 2R44A 1T0IA 2HSJA 2O4CA 3WZ2A 1PWYE 3OX3A 2C20A 1FLAA 3P26A 2E6UX 5G0SA 2IZ7A 1DQPA 1BRTA 2WYOA 3UH1A 5IG2A 2W2MA 2HL6A 3AGQA 4Z9FA 2CLFB 3F96A 3G9UA 3D81A 4ZQFA 1GUZA 1OI3A 3ZQUA 3KUCA 3SY8A 2XCOA 3G6KA 3A3KA 3OOSA 3D2LA 2RBKA 2R8XA 1TADA 1B0AA 2CVOA 1MB0A 3R7FA 1I1HA 1TUEA 3MHPA 4R1MA 2YTZA 1JKXA 2NU6A 3MSCA 1X7ZB 1OJLA 1NR7A 1N6KA 2IJGX 4X24A 3D0KA 3FNIA 4YXFA 3G8DA 2F1IA 3JVDA 2W2OA 3K4PA 4DSAA 5KOHA 1GPYA 3KD2A 4GS5A 4JLJA 5JC1A 1KIAA 4UM9D 4Y0VA 1Z07A 2QVYX 1TYDE 3HVJA 1GZ6A 3V8RA 1AQ6A 2FWPA 3HV0A 2W8ZA 1F2TB 1BC5A 3DDUA 4A91A 1WTCA 1ISPA 4I1OA 3KR0A 3AEUB 4N6OA 4C22A 4GXQA 5LVAA 2JG3A 3ZDFA 4YK7A 5LUAA 1QP7A 2WUWE 4H1UA 1N6NA 4MUYA 1G8GA 3OURA 5AI9A 4E11A 4EHKA 4M55A 1JHXA 3ESQA 1YJBA 2PRIA 4UQPA 4WE3A 4AP6A 1ZM4A 2ID8A 4PO9A 4C7XA 4XD2A 3H11A 5JISA 2O7VA 1FQOA 4MV0A 4LGVA 3VR2A 1HQCA 3ZDRA 1UCFA 4C4SA 4EG5A 2W43A 4IWXA 3UJ3X 2I91A 1MB9A 1T0JB 2JRCA 1DE0A 1XWWA 1FFXB 4OHBA 3RANA 1T3HA 2ZSUA 3IP6A 1E2GA 1SIWA 2WVJA 1SURA 4HR7A 5KCZA 3GGJA 5JQGF 3QSYA 1C80A 4DYHA 3HP7A 1Z0UA 2P6UA 3T15A 2AI2A 4V02A 3D8TA 5KKNB 1TLTA 1NNLA 2XF8A 3PNQA 4N0PA 3H1BA 2BEUA 1I4DD 1HG1A 3PFCA 5LC1A 3ZWMA 4KWCA 4BY9E 3KKOA 3L1VA 1ONNA 3EGDB 2JGNA 2H1WA 4BJ6A 1TK9A 3DL2A 3KPYA 1GGHA 1DXYA 1ADJA 2WTXA 3KVVA 3P9XA 1DLIA 2MINA 2HJRA 3OP1A 1YS1X 4PR3A 3HM9A 3LDAA 3OQJA 3CPHA 3FYHA 3UXHA 3LBFA 4RADA 3P0JA 4KAFA 3RWMB 1QIEA 1CE8A 2FMKA 5FLEX 4Y1RB 3ZTTA 4WUVA 5GIOE 3HYRA 3UUWA 1WW3A 1UPAA 3VPGA 1JQ5A 1K5GA 1PJ3A 2X19A 4ZK2A 4CEIA 3AVQA 1SCQA 1YE8A 4HWTA 3A27A 4Y2QA 3KJIA 2WIDA 1S6YA 4GEKA 2A9OA 5FO1A 2ZT6A 1W36C 2XNJA 3FPHA 1I2ZA 1JV2B 2FTKE 2C54A 1FNCA 3A1SA 4FLEA 4N5NA 5T8KC 2QAIA 1LC3A 4BB0A 3PGJA 1IU9A 2EEZA 4GE3A 3HUFA 2ZETA 3I64A 2YJ3A 3ODGA 2RG7A 3K32A 1QK4A 3DDZX 5JCOC 1U2ZA 1D4AA 1Z73A 2P78A 1ADFA 3H9EO 4X90A 1R4NB 2WEKA 2JS7A 2X2FA 3F1LA 3IR6A 3REGA 3NRBA 2DKFA 4IYJA 4AMUA 1UKCA 2QUZA 4BQEA 4ENSA 1E32A 3RUFA 4M0FA 2ZSJA 5KOIA 1AKUA 4J0QA 3UXYA 3B1ZA 4HVAA 4DMMA 1HKUA 2RBGA 1T5IA 5EJ2A 4E5PA 4QL3A 3HKBB 3G2HA 4H3HB 1LPNA 2AFIE 2QBYA 2ZVPX 4IDCA 5GV8A 1W9MA 1ONPA 4QWMA 1XG5A 4WVFA 4CEHA 3PGXA 1SB8A 3PVCA 1MX9A 1O4VA 1XOIA 1MPTA 1HYHA 1TQ8A 1B43A 1R5NA 2ZYWX 3GFPA 1AZTA 3H4VA 4JT2A 5ENDA 1VDZA 4HPJB 3BBLA 1FZQA 3DMNA 1K3TA 2EP5A 2ZU6A 2REOA 4NEHB 4R8SA 2FFQA 4V1CI 5I7EA 1GZSA 3KJNA 2FW9A 4KPYA 4XEHA 2DUUA 2AI1A 5CDYA 1Y7TA 2V7TA 3HB1A 1N6HA 1I6MA 3CMMA 3G85A 3IQEA 1EFPB 2VYFA 3UCEA 2V59A 5LOVF 1LRLA 1QRTA 3DMYA 1VJGA 2AOXA 4ZJUA 2O7QA 4V39A 2M6KA 4GI1A 3KSBC 3TLMA 2ECQA 3PJEA 4GSYA 4RVNA 4AWXA 4M49A 2JFFA 2JHFA 3AEQA 3BXZA 2VF4X 4J9UE 3CUTA 3DEHA 1PJ4A 1EFAA 4G5HA 2NUPA 2HRCA 3E8SA 2B21A 1AUVA 3HHEA 4MGKR 5KMGA 2ACWA 1VM6A 1I32A 2N3ZA 3B9QA 4G26A 3IBSA 1L7EA 1R6VA 4DR3B 1SXJB 4Q1EA 1XMIA 2F9LA 4UASA 3T5DA 5HW0A 1RXIA 10MHA 3OE7A 2BGJA 1BD4A 3ZI0A 1I0ZA 3RVLA 4LCBA 3ZWPA 5J2UF 4MPDA 3HKEA 4FYPA 4MQ4A 2C61A 4MITA 1J5XA 2P3LA 3M5DA 3PPIA 4KJXA 2AN5A 4NEQA 3QEOA 5EWMB 2WSSD 2VAWA 1IZ7A 2XTJA 3EJ6A 1VMDA 4UAGA 2OORA 4XWTA 3E1SA 3IDAA 4G8JA 5HIIA 5KDDA 1Y0BA 1NONA 3U5TA 3HUUA 4F86A 1BE0A 1F6DA 1M1ZA 1R2QA 2Q5HA 3IRVA 5GONA 4OQXA 5E9QA 5EUBA 4WFKA 2IRWA 3LF2A 4BGVA 5A4DA 1CX9B 4RZUA 1T9BA 1U3VA 2YUTA 1T6BY 2ZIXA 3GRAA 4QBTA 3WV4A 2OUKA 5JZ9A 1EZZA 4ZCMA 1TM5E 3B48A 4KRXA 1TQ2A 2ZJ6A 3L6OO 3NDPA 4HRXA 3ZHBA 1T0BA 3D1JA 4KKVA 1KYWA 2IYWA 1JG1A 3I52A 5CM8B 3VPHA 4Q4HB 2XUHA 3C41J 1RZ3A 3GCXA 5F35A 2Y2VA 4S1TA 3SBOA 3K6JA 4A27A 2QNBA 2E82A 1EDZA 2A9PA 2GLXA 4G0PA 4ZARA 1MGPA 4EA9A 4Y2TA 3LFHA 4L50A 4O0LA 4L28A 4GD3Q 3VYVA 2Q9UA 4JOSA 2RC6A 2X9NA 1M6HA 3P7MA 3IB6A 4E3WA 2Q6TA 2PGLA 5DEIA 1RI2A 2ZJAA 2P4SA 3IV6A 4OLHA 4U7JA 4XCQA 2HLHA 1MQ8B 3EPHA 4Q3EA 4GQIA 3TZ6A 2F1RA 2O48X 3F5MA 1J9GA 1RE1A 2RAVA 3RFXA 5FBVB 2O8DA 2NZVG 1PSDA 1Q3KA 2D7DA 2BUCA 4M8LA 4ZVSA 1IJEA 4CM5A 2J0SA 3JV7A 1HSZA 5ALKA 1XNHA 3AR3A 3I37X 4JL8A 5JUWA 1XZBA 2EDAA 2H11A 3LE8A 4Y6GB 1G2PA 3IMGA 4KJZA 3VRHA 4D42A 3ZD6A 2NZUG 1UM9B 3BC1A 3NG1A 1XJQA 3QKSA 4FYXA 1OYVA 1SQFA 3TMYA 4J0EA 4XM2A 2J3QA 4HWGA 5EIFA 4Q5IA 4E5MA 1XNRB 3O8BA 2D2VA 2G28A 1EHCA 5ADVA 5GQSA 4IX1A 3IAUA 1MA3A 3UMFA 4F11A 2I8AA 4RHEA 5FHRA 3TZHA 3WJAA 1HC7A 1NLUA 4N54A 2H1FA 4XVQA 2R68A 4E1BA 5J4KA 4BMOB 3FDXA 4L15A 4MQEB 1N1EA 2I7CA 4BFXA 4MLPA 5BV8A 5EIHA 1R6TA 2VNIA 5KWEA 1V8OA 2X5XA 1JLSA 5WRFA 4Q4AA 3L7BA 1VKNA 2Q07A 2WI8A 1KK1A 3PGA1 4GECA 4Q16A 1TO6A 4L0DA 2PX4A 3OIYA 4Z2AA 4FCTA 5CHEA 1WPXA 4UJ5A 1JPNA 1VSBA 2ZQYA 1OWPA 4DY6A 2PD6A 5LQKA 1RRPA 4IWYA 4JKIA 4MKHA 4ON9A 1G8MA 5K3AA 3RIEA 4KMRA 2WWGA 3OA0A 4YCCA 1KFKB 1TLFA 4DDUA 4Z7JA 4JEUA 1SCIA 2GPAA 3HO8A 3ZCQA 3R2JA 4EARA 4Y2SA 4DIOA 1PSZA 5K0CA 2F9FA 3TB6A 1YWGO 2O0HA 1ZI9A 5H80A 4PLCA 4DYVA 2PPLA 1NBIA 4EJSA 5L40A 3K8OE 5EEHA 4R6XA 3ONNA 3F67A 3N7AA 5IT9A 1TQDA 2EFJA 2XMCA 4RBNA 3AUTA 4V2IA 1YOBA 4Y9TA 4HJXA 2PD3A 1MW8X 1R6UA 2P68A 4OCZA 3P96A 3BJEA 5KTOA 2JZNA 1VSUA 2DE0X 2MR5A 3A36A 4F3KA 3GWZA 2O5VA 3HDYA 4ZO8A 4BNWA 3RE1A 2QE7A 3UICA 3GLHA 1GZ3A 5IW8A 3FJ1A 3JPWA 3R0XA 3R3VA 4L1KA 4Y2RA 1DEOA 1XEXA 5E0OA 1J99A 4AP9A 1WP9A 3ND5A 4E4RA 1Y48E 2XGOA 4JJ4A 4XDGA 3DC2A 1NMYA 2RJ3A 4D6XA 1OWOA 2GK3A 2VEDA 5JYCA 3CF4G 2BTQB 2IODA 1YGYA 1B8PA 1N2ZA 3RKUA 2EHJA 5FTJA 1J90A 5ALMA 1OWMA 4L5IA 4WK0B 4M4SA 5BRNA 3T7EA 3VNSA 3W05A 4FINA 4F21A 4F3NA 5ICGA 5F12A 3CH6A 1C3XA 5T3YA 1WMDA 4P3NA 4QLAA 3NORA 4JLNA 5JXIA 3X1MA 4HNRA 2OZEA 3QK7A 4MRPA 1MC5A 1O96B 2BEWA 4NNPA 1KZGB 2D5IA 5EXSA 2C4WA 5BYBA 3SC3A 5LZ2A 3INYA 3ADOA 5FI3A 5LQJA 5CNKA 1IZ0A 2LDBA 3HZOA 3F47A 1JQAA 3LP5A 3LQQA 4R83A 2Y67A 3PDUA 2AFHA 3BM5A 4BECA 4NY1A 2A4KA 3EZ9A 1T34A 3G9ZA 5EE9A 3SXUA 1NVKA 2J3JA 3KU1A 4RE6A 3CNLA 1FYEA 4TYNA 2WABA 5EIWA 2VJCA 1V41E 5AWFC 4YRRA 3EPLA 3OZXA 1E9SA 3V2HA 4OH7A 3N7TA 4N5DA 1BQ3A 2ILTA 2FUNB 3CUVA 4JC5A 1NVEA 1LWOA 3WBKA 5I8PA 3CX3A 3U4MA 2BE7A 2VYVA 5E7JA 3AVXA 3DE7X 4DZTA 3GXOA 4PVCA 4UE6A 4FILA 1ACMA 3MCZA 4AMGA 3WGUA 2XCTB 4ITVA 4RD4A 1VL2A 1TW2A 5CA0B 1JILA 5JLJA 1IMJA 2CGEA 1O5IA 2OCPA 2IZ0A 4PY2A 3ZHOA 4EUNA 4CMEC 5BNTA 4OK5A 3W5JA 4DQ0A 2BGWA 1O95A 3CEMA 1JQ3A 1FDIA 1P9RA 3DWEX 4GBED 4LE1A 1HURA 4H6PA 1LQUA 2W2QA 3GPLA 1V1MA 4X8OA 5ITZB 4GC5A 5BSTA 3W4JA 4D9MA 3WHIA 3LHSA 3TW8A 1IN8A 3CNQS 4X3CA 4QEZA 1EE2A 1X1BA 2W2XA 2O8FB 1YE5A 2NSYA 1K6JA 3WIUA 2DWQA 1FMFA 3QEKA 3T41A 2OTCA 3ZE9A 3QPWA 4RGYA 4ND8B 1PDOA 5E3JA 3QX3A 3FRIA 3H2JA 4O2LA 1PHRA 3KS9A 2Y0EA 3ZHXA 5K3BA 5C8YA 1M67A 2W6JA 3DO8A 4RD2A 1SBIA 1W48A 4F1KA 4Z4FA 3DS8A 1K4KA 3KJGA 4I5IA 1U0OC 4G56A 4ZI7B 5EE5B 3NKVA 1SKMA 1GL3A 2IXDA 4O0MA 1A7KA 1MCZA 1I0IA 1KJNA 1SMKA 4MQFB 4ZT2A 4DM7A 3CG0A 2D8AA 4M98A 4A0HA 3EF0A 4B84A 4QATA 1VTKA 2AYZA 3K1YA 1C2YA 3C98A 1JYFA 3OJLA 1E1CB 4YJDA 4KLCA 3LG2A 2C5HA 3I4LA 1NIJA 4LXHA 2Z2YA 2B3DA 4KN9S 4ZVUA 3ZZTA 3RU9A 4X7BA 2RFLA 2XNDA 4OHWA 3K5IA 2ZB8A 4BQRA 1E9EA 1LQTA 1G42A 1MEOA 2XE8A 3C8HA 2DQ4A 3O84A 3R5XA 4M9QA 1PGQA 4UHBA 3BWXA 4NOMA 2R8RA 1N4AA 2DHDA 1FP7A 3ROZA 3L8HA 2TRSB 1SA0A 4PQRA 2YOGA 2HEGA 4M36A 5BQFA 5C18A 3C3JA 3C8UA 4QOSA 5CB6A 1NYLA 3Q7QA 4G4SO 1FLDA 1OX4A 1USGA 2JBAB 3LO8A 3LY5A 1FXWA 1CIVA 2QQ5A 1ZOSA 1GADO 1WXGA 3DHEA 4AQ7A 1JPUA 2IA5A 2RGCA 4TTSA 4YROA 3F5SA 2AE1A 3EAQA 1NATA 3EIEA 1SGWA 3FZQA 3N0VA 2ZUDA 3RTBA 4I8IA 4O4JF 2K5UA 2IEDA 3BWEA 5CX1B 2GK7A 2HFJA 5HILA 4P86A 4II2A 4Z1OA 1RFGE 5G0TA 4ZVQA 2DJIA 4N0DA 4DLKA 3UWSA 2DFVA 1T24A 1TJ3A 2C96A 2WICA 3PVSA 1YBVA 3BD8A 5TJHA 2D2IA 3TZQA 4C4YA 2ZZMA 1DIHA 2ALJA 2VHUA 3EG9B 3V1LA 3MB5A 2HBRA 2VDLB 2ZITA 3PEWA 1P2TA 1Y8CA 2NM0A 3F5DA 5JS2A 4JA0A 4GM4A 4E1VA 1P4GA 5FOQA 1AG9A 1YI0A 2UZ1A 3Q2OA 2AC4A 1I7NA 1KK3A 2P3QA 3TSAA 5LJLA 2W0SA 1DX9A 5DCYA 3F8WA 4N82A 5BNFA 3TI7A 4PZZA 1EKXA 2FMXA 4CPDA 1A9OA 1Q17A 2YVUA 4JI8B 1ZBQA 3TFWA 3P2YA 4XQCA 3KSAC 4R7ZA 3GA5A 2I4TA 5JY6A 4U8HA 2PE5A 1J23A 1MAAA 1YV9A 3G3EA 1VJ5A 3GN1A 3ESBA 2HSDA 2H5JA 1NT2A 2X9LA 2CEKA 1DJLA 2HXYA 3FN4A 3M6UA 3NT5A 4UNRA 1R4MB 2NZWA 4XD7D 2GBLC 5K5EA 1DOAA 3GOHA 4YJFB 3WK5A 4FWBA 4US0R 2D5BA 1AS0A 1P4RA 2D62A 3GR6A 4XSHA 4FMPA 3PKJA 1JEQB 3F3YA 3H05A 1X9HA 3C14C 4UCXA 3THRA 5I6DA 3BMCB 3KTDA 3QENA 2VHZA 4EH1A 2Q8PA 2HO4A 4IHAA 4KH1A 1B14A 2JLVA 3KZCA 5CHYA 1NHWA 2WAYA 1OLSB 2NP7A 1NBAA 3QFTA 4B2PA 1EZ4A 2QX8A 2F55A 2BI4A 2BRUA 3HU5A 1K7SN 2OFWA 4I50A 1JSZA 3D6HA 3C7CB 4HLQB 4Q24A 4UZEA 5IMBA 3WO0A 3ZCPA 1RI4A 3H0EA 4B31A 3TGPA 1NN1A 1S8NA 4FE3A 3MWJA 4RTOA 3V6MA 3K0EA 1JJIA 4PSUA 5EJGA 3OIFA 3H9UA 2WB2A 4M1OA 1N0HA 3K5PA 2AZ4A 2J9FB 2ZI5A 2Q4RA 4BNXA 4W63A 4B3MB 1JZTA 3ET5A 5K09A 2HJWA 3MUNA 4EMUA 4F4FA 1WCXA 3CRZA 1NGSA 4EABA 2AW3A 1LNQA 1T3SA 3ENZA 3RYTC 3L0DA 5CXUA 1SEVA 2IEGA 2OHOA 3BA6A 5A5FA 3LYAA 1AJEA 4AY4A 1Z7WA 4TM7A 3T7SA 1PW5A 3W4IA 2P9YA 4YX9A 3TLKA 4LJ7A 3SZRA 2GI4A 4F92B 1L4BA 2HZBA 5DW0A 4IIGA 3CLRC 2A3RA 2HCFA 3GXBA 2C9YA 3OM9A 3QSGA 4IM7A 4JY7A 2P6RA 2VDUE 3K35A 4TN1A 3TJRA 2Z3VA 2RAFA 2WVHA 5G0VA 3SBEA 4PRLA 3HRHA 1NR1A 1CEYA 2OG2A 3KXPA 3SJAA 1T8RA 5EQTA 3O8NA 5DCLA 2SKEA 5COQA 3FMOB 1O03A 1T6XA 4MA4A 1ACLA 3ENWA 4LRQA 5EG5A 4ZU6X 3GVPA 4BZQA 1QRSA 3RHSA 2QE6A 4KR7A 2C3PA 3QVUA 5FL7A 1L7PA 2DUMA 5EHNA 4AZVA 1XF9A 5U9CA 1DAOA 3K94A 1OT3A 5CDFE 4QVKA 2HLNA 3BE5A 1EH5A 2ISCA 4KE7A 3LYUA 2Y0PA 2AIRA 1SVUA 1YUBA 2J3DA 3RDPA 3TAUA 5I7WA 1OAOA 1Z83A 1N5LA 2GD2A 4O4JA 5HZHA 3GLVA 4B81A 5JXWA 4PS1A 4CODB 1KNQA 3TW8B 3I5AA 5DXJA 2ODAA 1XDGA 2CJFA 4TKUA 3DWIA 4QGSA 1IBRA 4JLBA 3UPUA 1W88B 3V34A 3WRWA 2XRZA 5A9RA 5DI3B 3L7KA 2WKRA 1JBKA 1AN9A 3H5NA 1U3FA 4A5OA 1KI8A 4YQYA 1CR6A 4N3CA 1O6ZA 1WMBA 1N2OA 4QXOA 3FOAA 2AQ8A 3GC6A 6ADHA 1OFTA 4DLYA 5JD6A 2FHPA 4E94A 3ESYA 1KQFA 1SU7A 3OC0A 3UWDA 3HCDA 3A1TA 2J31A 1D4FA 2R4TA 3MINA 4ZU1X 3RTGA 1IZ8A 2C9ZA 1NI4B 3K30A 1APBA 4YDSA 2MYNA 1QTIA 4PYMA 5E38A 5GMOA 5JMWA 1FBNA 2QNIA 2HDNB 3QYAA 2IUSA 2YJ6A 1U5BA 3KXKA 2AHRA 4DLRA 2PXXA 3RROA 1ADCA 1SAYA 2HUNA 3TTXA 1Y1LA 3KLBA 4JC8A 3KT3A 3GF4A 1OYYA 2G9UA 3KV3O 4E2XA 4YCBA 4JT8A 2CLLB 2VAMA 1RJFA 2PX0A 2XKJE 1TE2A 4OHOA 4ZEXA 2YFQA 4HEHA 4KQKA 3EYAA 1E9VA 4CQLA 1R0RE 3H2IA 5CBPB 1IONA 3HPRA 2H7CA 2IF0A 3NB0A 3VKVA 4NCAA 3ZU3A 2CT8A 2G9ZA 3HP1A 3K09C 1PR1A 2JFVA 3O8LA 3ZWBA 2AUMA 1KDVA 5JMOA 4DQDA 5LDDC 2XAUA 4LW8A 3RVKA 2ZTVA 3DTYA 3WK7A 4UXIA 4WJLA 4HPWA 1KH3A 1V6AA 3K6RA 5IULC 2JCSA 4BU1A 2JKZA 3LX8A 4WN9B 5CM9C 3MD0A 4QU5A 5BV1A 3HN6A 5B1HA 3DVAA 1FDSA 2BM8A 2QN1A 4NPCA 2D5LA 3KAJA 4Z5XA 1OZ0A 5IBQA 4MLCA 5TF0A 4W5TA 3WHPA 3JQBA 5F2OA 1VYHA 2WFLA 4TTVA 1PLJA 1IPHA 2XRMA 2O8EA 1HA3A 2B7BA 3WKCA 2C0PA 2CMHA 3E7FA 3AZOA 3ZWYA 2HJVA 3LT0A 3OJFA 3FPSA 4JP8A 3RAPR 3VHXA 1N3IA 6LDHA 4ZYTA 3L5KA 4J2OA 2HQRA 3ZQJA 3ZHYA 4HAZA 4AY5A 4BQSA 4JI6B 4MVJF 5BOVA 3I28A 3UT5B 1C0IA 3IMEA 3KD3A 4HRAA 4PQEA 4IDNA 1EP3B 1BEEA 1MW9X 3PV0A 4UUNA 2L0XA 5DHFA 3H7AA 5IWAB 4QOEA 4DR4B 3VOAA 3MIIA 4DDMA 2ZRKA 3HZHA 4BMYA 2B94A 2FRXA 4Z51A 2XWQA 2EG9A 3EAFA 3OJ0A 5D5PA 1IWBB 2P2ZA 1SU6A 1KP2A 4DXAA 3GEBA 5KU1A 1IQRA 2HMWA 4DWWA 4NR0A 1WD5A 3LHFA 1CUDA 2WIJA 3RYIB 5E2IA 2OQIA 4EMSA 1POWA 4PLWA 4Z3DA 1M8JA 2F4NA 4QOJA 5FR1A 4MW0A 1WAMA 3MOGA 4DIDA 5GZ3A 2G77B 4NHEA 3FYUA 5F4ZA 1ZHHA 2QZJA 1VG1A 1XD8A 2XSZA 1U7DA 1SUDA 1CC1S 2LNDA 4HTFB 3NUZA 1E4OA 2A1IA 3O8RA 1DTWB 4RJ2A 1T8UA 1XXHB 1U3WA 1XZHA 2PWYA 3BXXA 3TNYA 2PS0A 2Z4SA 3HE3A 3K9WA 3QE2A 2AMYA 3RSOA 3W8RA 5KTPA 5FLXA 3JWHA 2UUAB 1J7KA 1R8YA 5ALPA 3AL3A 2OKGA 2GHTA 5JO0A 1II8B 4DV6B 1WY7A 2DBQA 1VGRA 2IXGA 4RKRA 5T41A 2EZ4A 821PA 3FRJA 5GJVC 1EJ2A 4DIBA 5EN4A 3PEEA 4N8DA 3AXSA 5KS2A 1QLJA 2XUZA 2VBGA 1G7CA 2Z5LA 3IT0A 1U31A 1GQSA 3QXXA 1ZP6A 2I2WA 4N3BA 2YQ4A 4Q4CA 3RKSA 3FCYA 4OL9A 3A28A 4Q1AA 1NVAA 1Z0IA 3WL8A 2OHFA 1WVMA 4CIDA 1HK7A 3COSA 3V46A 4ZDIA 1USIA 2WT8A 4FOTA 1Z68A 3LUAA 4LQLA 1MB3A 2ONYA 2VHEA 4P7JA 1FTGA 1TRHA 2RONA 4G01B 2ZTMA 5HYVA 2GN1A 4AB1A 1M6YA 5ELMA 1K4YA 5ISMA 1X1SA 4DRXB 2WAMA 4LYJA 1LCIA 1J9EA 3ZXIA 1E3DA 3GJ6A 5L6LB 5CP8A 3CJTA 4NAUA 4FONA 4NBWA 1LLDA 1ZH8A 4FR5A 3ZQ4A 3FHJA 2O5EA 2EBUA 1H65A 4CM8A 3UJAA 4MUBA 5K4HA 3ISJA 3EXHA 1LLQA 1G2OA 1BQ4A 1Z62A 2R25B 3FFAA 5TVKA 1OXVA 4RTSA 1WXQA 2DMRA 4Q7KA 2W2NA 2JFXA 1SHLA 3VJKA 5BXYA 3RLIA 3AKYA 3E22B 2FR1A 4N48A 1VJRA 3OE4A 3FH0A 1KY3A 4R2HA 4YJ2A 2I6TA 5C8ZA 4Y30A 5HIKA 1JB1A 3IS3A 1I3MA 2O2HA 1RYBA 3ETGA 1U2TA 1M83A 1N9ZA 4EO7A 1ZN9A 4GMXA 2CF6A 3WNCA 3C5CA 2BR4A 1S8FA 1E2BA 4UU1A 3Q1LA 2XB8A 4D5EA 4X44A 5IAGA 3D7MA 2X1HA 3MTDA 3MCWA 3QUAA 4GLBA 4RGQA 2XMZA 2FOXA 4O4HF 1WSBA 5EZYB 2WG1A 4A4DA 5G3ZA 3TK1A 1NMSA 3VHQA 2II6A 1MAVA 3N2GB 4G84A 4B32A 3BRWA 2AZXA 3AOGA 2Z4TA 3IQFA 4M0UA 5DK4A 3ZV3A 1OH8A 2VHYA 4HZIA 5CK5A 3HJBA 3ZBTA 3S40A 1M0TA 4QTZA 1AH2A 1ZKMA 1DAMA 2IITA 3L6CA 5BUCA 1X7GA 2JI8A 4Z7NB 5KOHB 3JZMA 3SYLA 1Q0ZA 4JFAA 3OY7A 2VNSA 4V3BA 2I8CA 2XNCA 3T3EA 4L3WA 3ELWA 3G8CA 5B57C 1PUIA 5JTTA 1YI8A 1CY2A 3NVKI 1MQSA 1KYVA 3LZCA 5E6SB 2BFPA 2MSNA 2RK6A 1XGKA 3DDHA 5D1NA 1XKXA 3NNNA 5JVDB 3A9UA 5F1OA 2C98A 3TIFA 2JANA 5EJ8A 2IS4A 1BVYF 2R6GA 4G4IA 4MINA 2NO4A 3FNBA 3H1AA 2HF7A 4GWKA 2RGWA 1C1XB 1OYWA 2FLVA 1SBHA 1OI7A 2NUTB 2VDJA 4BC0A 3HVRA 4JUAA 1EA7A 1G291 3FPEA 2J0UA 1U80A 2YV2A 5AJXA 2VF8A 4EW3A 2BHSA 4Y6SA 5AK0A 2AQKA 5HNKA 3TQIA 1FFDA 4D44A 1VXOA 4KVFA 1GKIA 2HDOA 2P0AA 4LXGA 2AEFA 3O0DA 3LTNC 2OXIA 2CLIB 3NBAA 1L5SA 2O2YA 1H6DA 4DA6A 2GEUA 1SOUA 1WVGA 2SECE 3FOEC 4G67A 1RQRA 4EB6A 1HE8B 1CV2A 1A7JA 1I4LD 3H2ZA 1D2RA 4RK5A 1X7YB 3LX5A 3ER6A 4YBRA 2POCA 4HZUA 5JV5A 5IAKA 5MF6A 5CNMA 4YP7A 3MN1A 2E4UA 3UJ6A 2QL5A 2DXIA 3OCVA 4C88A 2Z43A 2H29A 3TBFA 4JBXA 2WFMA 3AFGA 2VI5A 4CQJA 1YBAA 4P38A 2BL4A 3B9PA 3N0XA 4ENVA 4D74A 3BFXA 1AC5A 3P2IA 4MKRA 2MSKA 1J0AA 3P45A 1O95D 5AQ1A 4MS1B 5EJ6A 4PSKA 4ZEMA 4CF3A 4OKSA 1JH9A 3U7GA 3D8UA 3IHTA 3Q7RA 3VDMA 1JLLA 3INRA 1PW7A 4GOJA 2ZS8A 2JI6A 1PU2A 3B3FA 4HY3A 4XB1A 5CDTA 4LNUB 3B2NA 1LVGA 5J43A 1VE3A 5HQ3B 1CFZA 2AFHE 2I2AA 2JI7A 3GFQA 3IV9A 2JD2A 1HQKA 3H3FA 2AF3C 1Y8RB 3FPAA 3CVUA 5JAPA 3KEGA 5ERYA 4DSUA 5KQMA 3QF7A 4G5GA 2VRCA 3QKUA 4WDRA 3LLSA 4JD5A 2WIBA 4EGAA 5A4FS 2YHIA 1VBNA 3ZGOA 2O2EA 1OY1A 3SVLA 4CV0A 2XE7A 4TMZA 1KPGA 3UBTA 5I5GA 1GZ5A 2VPIA 4FMDB 5EJ7A 3CPEA 1D0SA 1D2GA 1HGXA 4G24A 3ZBUA 2CV2A 4DAEA 3UAWA 4FD2A 1ORHA 3LRTA 3PQEA 3GLKA 3TLCA 1Q16A 3GK3A 3M5PA 4URFA 3VR6H 3D54D 2Q2QA 4QRDA 3U4DA 4W6QA 3WTBA 1WXFA 1P7WA 5CEJA 3R5TA 2JJMA 2XYHA 4XB6B 4J7CA 3Q10A 1SD2A 3TMAA 1IN4A 1NNSA 2FUEA 2VJDA 3C3AA 3FPFA 4GPBA 4LVOA 4CMKA 4F3RA 5AVVA 4JS0A 1ISSA 2IWHA 1X74A 4EO4A 3NW9A 2OAGA 3N5KA 1R0XA 2RGNC 4MDEA 3SNHA 4EW2A 2VJOA 5H5JA 1XXHA 4GGMX 2DT8A 1C9EA 3GCGA 5AXDA 1PK7A 1MFPA 2XJ9A 3OO1A 4ND6A 3TIGA 2PO5A 3BUSA 3NWBA 3NM4A 3QUBA 2BGTA 4HX2A 2FEAA 1I2MA 4XWYA 5ALUA 4DABA 1DCTA 1GGFA 1E63A 3HXPA 2PPVA 1HDYA 2W9XA 4YJ2F 2Q5QA 3DZGA 5HCIA 3GN2A 3R76A 4MW6A 5DOVA 2XZLA 4X84A 1PGJA 1V7CA 3ITKA 4OJKA 5KDLA 2CLSA 2G88A 4L75A 4QBKA 5CJJA 5DHUA 2VPQA 4LJLA 1AGRA 4LZNA 3ME5A 4CLOB 4RZQA 3JQAD 3NIGB 3VBEA 4IX9A 2Z6UA 1AZLA 4HDNA 1A4RA 5BW4A 2ID7A 4QUBA 3NPMA 4QBIA 4LX0A 1MAHA 5EFZA 1L1RA 3G0BA 4C4PA 1NI3A 3ETLA 1RJ9B 4EY5A 5CLGA 3GH3A 4LDPA 4HDSA 4KQCA 4ZAXA 4HS9A 3T9BA 3VR5D 4GSKA 3TTUA 2XB4A 3EWIA 2UXBB 4PQGA 3I8SA 5KSWB 1A7UA 1EQ2A 5HPYB 4FYJA 4BKUA 2CUTA 3DT6A 3EXHB 5EXPA 4INZA 3RTAA 1A8PA 2Q4TA 1T8WA 2EZTA 4H6VA 4EF6A 2FFAA 3H6KA 3ND6A 4MI1A 1NYTA 3PUIA 3SIRA 2KBFA 1MDBA 3WGKA 5BQPA 3LPCA 1CZOA 5G02A 3AR8A 3D4NA 2B4RO 2OCBA 4Y0NA 4QPZA 1PRYA 4S1OA 1G20B 3BYZA 2MHCA 3H8VA 1GCUA 1RQXA 4X95A 4RPGA 3LX6A 3VJLA 3ECCA 3OJXA 4XTRA 2GTHA 1TTQB 5G0UA 3GU3A 4A8JB 4EHBA 3NHSA 4HX9A 3M2PA 5TF4A 3RV4A 1E6LA 3K1ZA 4QUJA 1N9KA 1ZGHA 1VJ0A 2PGNA 2YNMD 1F7UA 2BDEA 1J20A 1DJNA 1TEHA 4FS8A 1H3EA 3F4KA 4RKQA 5C32A 2ZJYA 3JZDA 4MCAA 4K6MA 3QP9A 4OVKA 5CFZA 3L04A 1FMTA 5BN4A 1JI0A 1OWLA 1U81A 2VHXA 5KOJB 1S0UA 1SKQA 4Z4HA 3B3JA 5LKRA 4NCBA 2YYAA 3L77A 5C53B 2VJAA 4PN3A 3DD5A 1SXGA 5CT9A 1PJZA 1V4BA 3B3AA 4MQMA 4RK7A 5HF8A 3BRSA 2P7HA 5L4LA 2IEIA 1F12A 4EB3A 4JBIA 2JFWA 4ZZ2A 3LS2A 4U7TB 3E3NA 3AJ8A 1B6GA 5JXGA 1HL7A 3NBQA 4E14A 3HWWA 1XVLA 4ROSA 4UHHA 2REQA 3R4CA 3T5MA 5BSKA 1JMKC 4X45A 3AINA 2UYHA 4G5XA 4PVDA 1W76A 3AFNA 4KXXA 4EA7A 4OHYA 1J00A 1VIDA 2ODQA 3K0BA 1E2NA 3IQWA 5G53C 2QL7A 4P8RA 3V33A 3VI3B 5F23A 4L8VA 1MHPA 1ZVMA 2RHGB 3B6MA 5F33A 3SZMA 4Q7MB 2UZAA 4X20A 1KSGA 1H69A 2ZDGA 1RXEA 3DTVD 1R0KA 2X15A 2NTNA 1YFKA 2VK8A 2YWBA 4QRHA 1GTSA 4WW0A 2GNPA 5LR6A 2XOKA 1DV2A 2ZM6B 1R9GA 3JWJA 2B9EA 1U11A 1Z37A 1FU8A 1R4AA 1NLMA 1J0BA 1TZ2A 4KXMA 2QW0X 2QM8A 3LQRA 2AA3A 3I0NA 5SV2A 5IYZB 4UU0A 3O92A 2CXRA 4LTNA 4OI1A 3DBLB 9ATCA 1XB2A 1GGJA 1I3CA 2Z5GA 1F9EA 2NZJA 4JCOA 3TZCA 1IEXA 3C85A 1LC0A 1SRRA 4WLOA 4ZTZB 1U8FO 5E8RA 5HF6A 4CCYA 8MHTA 1HDIA 2R87A 1FDRA 1V3TA 2OILA 1PKXA 2A1UA 4BB9A 5B30A 5AVJA 1XDBA 1RVV1 3IE2A 3PFNA 4UUAA 2LUOA 4FMCB 1J1UA 2ZRPA 1K6EA 3UCFA 4EVRA 3K1AB 3KSUA 3TW4A 3LT4A 3JYLA 1ODJA 3OEYA 5JH7A 3Q5DA 1DHTA 1DRJA 1I2BA 2C84A 1WLSA 3WGNA 2PKQO 3JQFC 3KJZA 1GY8A 3H5TA 1B1CA 1IOZA 5K8IA 2AWNA 3LBAA 4KTVE 5FOSA 3WGYA 2YWCA 4D5GA 4R3WA 4Q7EA 4L9AA 1S2OA 2YUIA 1W2HA 3BULA 1QG6A 2MYTA 2O5RA 3MPUA 3B6KA 3D4PA 3I62A 3LA8A 3L0OA 5I7RA 1XLVA 2Q3CA 3JQFA 3JXEA 1F9AA 1JIQA 1Z3IX 2XQFA 2X4GA 3CLUC 2OXRA 1AGNA 1KY5A 3OEEA 3GJQA 2YN2A 4NVRA 4YFVA 5G4LA 5TPWA 4FWTA 4QUGA 5DXFA 3V8PA 2FW1A 4YJHA 2J48A 2FMFA 1GR0A 1OPRA 4AZ0B 2GYVA 1F3LA 2P2NA 3RABA 5MHTA 2P3OA 4JBWA 2FEPA 4QGFA 2P11A 1K75A 1C8VB 2BFFA 1XA4A 1TTPB 1P9OA 4GR4A 2V4ZA 2IQ5A 2TSYB 1PQPA 1PGNA 3BIFA 4IIJA 4OFWA 4R98A 3EEYA 4RCYA 1OXMA 4A0QA 4BFLA 1HTBA 3HCWA 2JEZA 3ZHUA 2H3HA 1J8YF 2OV2A 4MJXA 1QBGA 4L8GA 1GNSA 1VE5A 3S6JA 1D2CA 3PFWO 3P32A 4PF1A 3ESCA 5LQSA 4PC2A 2PWZA 4P6VF 4P92A 2RCNA 3DBOB 4URVR 1LTKA 4IKOA 1U7WA 2JAOA 3DLPX 4RGVA 2P41A 4O4LF 3RBVA 1I30A 2PD4A 1CE8B 3OM1A 4N40A 1P0MA 2F6RA 1WXIA 2VDOB 2BGGA 1WEHA 4M60A 3TSYA 1ISJA 4C3UA 1D8AA 3QXCA 1JJ7A 5ANRB 3KAKA 4ALJA 3BGIA 4JP3A 3FHOA 5CM2Z 1XP5A 3AM4A 1ZA2A 4ECAA 2ZYUX 1NAIA 2HQOA 3NYRA 3PQ2A 3ZLTA 2NO6A 4LWZA 3H86A 4J7XA 4ZZ1A 2D1TA 1ATZA 3FUTA 3JWPA 4LV8B 3I5MA 2P1RA 3P9NA 3RVNA 4CCAA 1P1BA 5HKKA 2JDID 3RS9A 3PLRA 3MJEA 3TTYA 4ZALA 2RI0A 1YK0A 2D74A 1LPBB 2O0LA 1OILA 1AKMA 1HZZA 3CLSC 3QXSA 2XMPA 3T3HA 3ER9A 3GIWA 3N0RA 5LXTB 1XQWA 3QW4B 1IG3A 3NATA 4Q3OA 2W4IA 4DBLC 3P27A 4C4ZA 4K88A 5T4BA 1FCJA 3NBZC 1J39A 3QV1A 1UDXA 1EESA 2VH1A 2ENUA 3I05A 4JAVC 2AC7A 1TYAE 2YJZA 4FDAA 4MW7A 4MQ6A 1SB9A 1SRQA 1DINA 3R3JA 3ANYB 4IXTA 8OHMA 3S1LA 4I55B 3OIWA 4KOAA 1A5AB 4CTMA 2C5FA 1JDVA 1H8ED 1HTTA 1TF2A 3ORSA 4R31A 3R9XB 2XA1A 2FSPA 2Z0MA 2O8FA 1V4VA 3P9QA 3PE4A 3FSGD 4LJ6A 4OXKA 4YMGA 2WWFA 5HK9A 2B78A 3CVYA 2G4CA 3B8HA 1SULA 3PFBA 4XGNA 3TOCA 3WRYC 1DTSA 2XNSA 5DGHA 1SKYB 5KKAA 4EM6A 3PEUA 1I1OA 2CL6X 3QE4A 1Q14A 1QGOA 2F9MA 3A4TA 5JROA 2ATIA 1XZIA 4DLVA 1U8UA 2XW6A 1YU6A 3N2KA 3M6VA 3ASZA 1KY2A 1B73A 2MT9A 1FPQA 1LRKA 2YXDA 2HCTA 4MUGA 5DGXA 4IFTA 3TDKA 4Y9DA 4AMVA 4RABA 2F43A 1P9NA 5G1NA 3R7WB 2IOFA 3CUWA 5C3UA 1JDSA 3GELA 5DK6A 1Y6ZA 1RKVA 1TPZA 1HDZA 2VDWA 4NOLA 4A6DA 4P0QB 2ZXUA 1GFWA 2J85A 4M21A 1G5PA 3DM9B 3NBFA 1TPYA 1M1NB 1RRMA 1QAOA 2OLEA 3IAHA 4P3KA 4R9RA 1P1HA 1EBFA 5ALQA 5KMGB 1FXSA 2E85A 4XRRA 2EU8A 3DT9A 1QIFA 1AF7A 4QFBA 2NVUA 2GRAA 4HAWA 5AJYA 3X1DA 2H0QA 3MTIA 3QTLA 3NVDA 3U7FB 5EXXA 3KB1A 3GUVA 1KMHB 1N2BA 3O9ZA 4UHKA 4HC4A 5KVSA 4P2BA 4YJGB 3C39A 1R1DA 3KU4A 4Q37A 1R5BA 2FJPA 4D9IA 2PSDA 2CL5A 5H59A 5HBGA 1BE1A 3BSWA 4M1KA 1ML3A 1R4ZA 3FETA 2NAPA 5IYZA 3DMRA 1UK9A 3KQWA 3LDUA 1U0HC 4F60A 3B6JA 5A3RA 3NO4A 3KLOA 3DBLA 3ZV4A 2VH5R 2ZRAA 3KVRA 1E61A 2IE8A 2X0RA 2IZ5A 2JK1A 4MW1A 4RA6A 1I94B 1TYCA 2V6FA 4H4EA 3WNQA 4EPYA 1N1GA 1OROA 4HGZA 1FDVA 1NLZA 1KAHA 4RL4A 4PC6A 3VXKA 3I2YX 4YECA 3BGSA 3MGAA 3GARA 2HBZA 3BXHA 2NVBA 3WB2A 4PX3A 1YQTA 4RCVA 4AU1A 5JH7B 2GBIA 4D9HA 5FA8A 3DOEA 3PDHA 1V35A 2G1UA 2J67A 2ZJ0A 3DGEC 3L84A 4UMVA 3GMIA 4QNRA 1JE1A 3FMPB 1QYXA 1UQRA 5BN3A 4B82A 2R6R1 2Q1YA 4PNEA 2C1XA 3V4VB 4BFZA 1ULTA 2VS1A 5JVDF 4MB6A 1E8NA 3WQRA 3PTAA 4MB0A 2IP2A 5DDIP 4UEOA 5BV0A 2GMWA 2OZPA 3HB9A 2H00A 3QU7A 4CR8A 1T1SA 2DHQA 2JIBA 3FFWA 3RJ5A 4EZEA 3W6ZA 3AV3A 2ZAOA 4J1TA 4ZGWA 1F48A 1MF7A 1ZM3A 3EA5A 1CY0A 1NN5A 4Z9XA 5TPWB 3O31A 5CVCA 2Y1CA 1ZD1A 3EFEA 4IFEA 5CGQB 3KOXA 3I9V6 3WE7A 4EB6B 4DR2B 1H8HA 2MJLA 1NSFA 3AFMA 4IIJF 5A2GA 2GVNA 4MRSA 4U8GA 4YUZA 1XRNA 1YUNA 2OZLB 3KOZA 4FFDA 3N8HA 1QX4A 3GFBA 2LIVA 3KQNA 1DOZA 3EVDA 3NFYA 3RC7A 3V8NA 2C2YA 3CSDA 3LU1A 4LMBA 4NESA 4X1KB 1YT5A 4BNFA 3QTBA 5HKAA 1GUDA 4TS4A 1P0FA 2AV6A 1RQNA 1PJQA 4L6AA 3RS5A 5LP1A 1A9SA 2WFZA 1AKYA 2E18A 1CR1A 3NAMA 4WK6A 1CY4A 2L82A 4HQOA 4NE7A 2B8JA 2XWPA 3EZYA 1ZN7A 1DKQA 4QDUA 1VJ1A 2NOAA 2OV6A 3TIVA 4G65A 4HHEA 4F97A 1FU7A 3PZRA 1JDNA 2ONKA 5LCXA 3TD9A 4XD7A 4E4YA 3WSWA 1PWHA 1TT5A 3WGZA 1Y3CE 2ANCA 3L6UA 1SXHA 2C59A 4YRKA 1E5LA 1FNBA 2HA0A 1XRLA 4OYRA 1HOTA 5TC4A 4C5AA 4E2YA 4NBUA 2B34A 4Q3NA 4R0NA 4PYQA 3FB1A 1T9HA 2OORC 9MHTA 1W85B 1NHGA 2P69A 4FFWA 4H7DA 3DMDA 4LJKA 4WSOA 5ER9A 3HKCB 5JH7F 3RSLA 3ELYA 1EDEA 1J49A 1GGNA 2Y1EA 2OY0A 3VYSB 3DSRA 3O47A 4ZTUB 1TD1A 1RXUA 4NULA 3A3PA 3VH1A 1E20A 3WIOA 5FULA 3E9EA 5GVRA 5GPBA 1G60A 1WB9A 1CJMA 2IUUA 2OD7A 4JKOA 3T7JA 1ZI8A 1MJNA 1CVLA 2R7MA 3R77A 2GUWA 5KWSA 1YIAA 1DS6A 1UJCA 1ETUA 4P7GA 4BUCA 1KZ6A 4ZV4A 3I12A 2MR6A 1FYWA 4QSHA 4LYFA 2ADOA 1UL1X 2ZUSA 1LGYA 3STXA 3TW6A 4TVKA 3VFDA 2B8NA 1SXPA 1JPJA 1XVAA 2WT4A 2DJ5A 3GLHB 3WLRA 1HZJA 5H81A 2WJ4A 4PSAA 4UAVA 3NBUA 5HTKA 3GA0A 1DRUA 4H17A 3ZWDA 2KHZA 3S8YA 3B9RA 2Q3MA 2MIIA 4Q3KA 1W88A 4D8XA 3DVRX 3E9MA 1QQ5A 3S2YA 3CRW1 2VWGA 4PG8A 1CERA 3B1XA 3O9VA 4O3FA 4PIPA 2QX4A 2VNHA 1UMCB 1C1DB 5LMZA 4M1WA 1Q83A 1AGYA 4O29A 1VB3A 3DE2X 1QSGA 2QLTA 2X6RA 3EFBA 4QWWA 1KQ3A 3V1KA 2Y4NA 3RSGA 4DDWA 1QFMA 4DNFA 1A4UA 3OKFA 3OLYA 1L3BA 3DEIA 4KRGA 2YRWA 4TM8A 3EQZA 2QM3A 2H2GA 2JFPA 2CFTA 2XZPA 4QKQA 3AXTA 4X1YA 2JKVA 2I2BA 3I73A 1MUUA 1RYEA 3M1YA 3QU9A 1U5BB 1IEQA 1ZUNB 2WKPA 3UJBA 3AI1A 1AKVA 3LFUA 3RU3A 2FP4A 3C4JA 4XYMA 3WKAA 4AYTA 3H0CA 3I9OA 4UNNA 3JWIA 5K3EA 5BR8B 1V5FA 4Q3BA 1IJBA 3LQFA 4HVTA 2IYFA 3OEHA 2M1ZA 4YGXB 1MO6A 4KLRA 1KZ7B 3WYEA 3MPOA 5CRIA 1E9RA 3OD1A 1P6UA 2A0UA 3AW9A 4EPVA 3PZBA 5L9AA 4LCEA 4N49A 1EPUA 2YHAA 5EYPA 3T4EA 1GFZA 1ZISA 3EIQA 4DEXA 4F85A 5CFLA 3GGGA 1KF0A 3BAFA 3HDTA 2Z58A 3K6SB 4F8JA 3LPLA 2WNSA 2BFDB 4LQ4A 1FVXA 5IYZF 1EP9A 1FFSA 5LJIA 4G9EA 1EVYA 2QUHA 1F2DA 4G36A 3AVVA 3A1NA 4G1VA 4UDYX 3C6QA 3LLUA 5HQTA 1XKTA 4JB2A 1XTVA 4PPQA 4ZAWA 5B2FA 3RBAA 4C29A 3I6IA 3GQVA 1L9KA 4CL2A 1MLDA 1UEJA 3EG5A 1PBNA 4WY8A 4I5FA 1GP2A 4QXAA 5FWNA 1C0PA 3AF5A 3UQYS 1Z8HA 2NPIA 2PH7A 4BZWA 2D1FA 2PX2A 3X2FA 1PK8A 4TL7A 2PRYA 2IYOA 4Q3CA 1P0PA 5EMLA 1U0RA 1G7TA 4U7WA 4X6YA 5F3DA 4BRWA 5T67A 2H8KA 3JYPA 4TGLA 1KO8A 1H3NA 2BCJQ 2ATVA 3HVUA 3AR2A 3THXA 3PHGA 2QRJA 2O6LA 4F46A 5MN4A 2ZB4A 3RHZA 4QDJA 3LNCA 4EGQA 3WL7A 4ZI7A 5K4GA 2GHIA 3PFIA 3Q8MA 1YL7A 2FG7C 5HRCA 5FFMA 1X1TA 2W2PA 1P3DA 1WKCA 3N76A 2CD7A 1ATIA 3D4OA 3O3MB 3P9KA 4KIFA 4NOKA 3ED5A 3NWOA 1U9CA 4UMDA 1DSSG 3ZH2A 3VV3A 5J4HA 2CE2X 1MVNA 5A5GA 4HADA 2YDYA 4PZEA 4CM3A 2QTCA 2PWAA 4F3CA 1U2RA 3OA2A 3PEFA 5AKEA 5E7QA 2C9OA 3TWOA 3ZHZA 4BX2A 2ZWAA 1EK0A 4GYYA 4BVEA 2I99A 4HB2A 4PLPA 3U6KA 1QP8A 1GN9A 3K73O 2MYUA 2QJRA 2Q46A 2W2KA 3H83A 1L4KA 3O2QB 5J58A 1PFWA 2YS7A 5JWOA 2ISQA 3HL0A 4GI2A 3G2MA 1KVSA 3GLTA 4LZZA 2BF4A 4WNAB 1AHHA 1JHPA 3BCHA 4OB8A 3NXKA 3O6VA 2O7NA 1N5OX 1O57A 4GI3A 4LGMA 1BWSA 1WUKS 1H0SA 2EWMA 3DOHA 1JQBA 1NQAO 3F74A 2QTTA 4HFRA 1BNCA 4XUDA 3Q6IA 3PD7A 1ZLYA 3WJ7A 3EBOA 2W6MA 2EWVA 1CUIA 3NHRA 1EQUA 5BWMA 2DU8A 3G13A 5DYIA 2F8LA 2AFVA 3URKA 3HGTA 1X8KA 2I3AA 5DASA 1T4BA 3A6HA 4INOA 1A5ZA 3IVMA 1VPDA 4X6UA 5KREA 1SPXA 1L5NA 4I4CA 4O3MA 1MX3A 3ZY3A 1DQYA 2E4ZA 1HEIA 5I7SA 2PS3A 3H6HA 3S1SA 3QYFA 5TY0A 4EFKA 3DE1X 2G0AA 1Z18A 1NPDA 2XCUA 3DOUA 3MELA 3U4QA 1AIPA 1VL5A 4DBVO 2OPHA 1SIOA 1T1IA 1USKA 2C5GA 2GBFA 2QL9A 3RV3A 3W1VA 3WNDA 1DAGA 4C03A 1IUNA 1YB7A 3HU1A 2CKDA 2AEJA 1QVWA 1YIDA 3FAKA 4J0IA 4E03A 1PWXA 4N8EA 1UMKA 4IHJA 2BR3A 4FOSA 1JHMA 3CZPA 5DGDA 1G3IA 1SOVA 1DKOA 2R7KA 2WIGA 3ILSA 3BFKA 3OOWA 1XMQB 1VGVA 1GKUB 2CZCA 1RR6A 4OD0A 2WYHA 1G98A 3IQHX 3L7JA 4Q39A 1PJBA 1Y9AA 4Z99A 5HM6A 2NXEA 1MQ9A 1N6PA 4KPUB 4PLGA 1YNOA 5AUQA 1YO6A 3C43A 3WGMA 2CLDX 3Q12A 1OLSA 4J43A 3SE7A 2JFNA 1ZINA 4BC1A 5K05A 2OT3B 5BR4A 2GCGA 1AA9A 2XEXA 4MYCA 1K1EA 1QU3A 1KP3A 4O2RA 2GF0A 5J47A 3CEJA 2YDXA 3A9SA 4IIHA 4KXWA 1EUYA 3SHTA 1EG7A 2V7PA 2GPTA 1PVVA 2PV0A 3TW0A 1F1BA 1TECE 2IF2A 2X4LA 2E9SA 1YQ9A 1E2MA 5DHSA 1AMNA 4OY3A 3LWBA 1HLFA 3EAGA 2PYIA 2BCGY 4M0MA 3QEAZ 3E2IA 2H4JA 1Y1RA 3ILXA 4KLAA 1EHIA 3QLUC 1KAOA 1SHJA 1TUBA 1N9GA 1NBMD 3RAFC 1S5PA 2ERYA 2QZ4A 3O3NB 3PD0A 4FN5A 2Y1WA 3BEOA 2EFEB 2ZKIA 4UHFA 4BX0A 3G8YA 4K9OA 2NQ2C 4DOMA 3EDRA 3LQ1A 1SBYA 2DBRA 7YASA 1QIIA 3ZWWA 2XT6A 1L4UA 1XCBA 1L7QA 3ABSB 2V96A 4HNGA 4TV8F 5TJ9A 4ZK6A 1LLCA 2NXWA 3C1UA 5C7IO 2HHAA 3AJRA 4MTLA 5C46F 3U7JA 4O2BB 4JP5A 5AJUA 3K16A 3A9RA 1X70A 4HSGA 1W2WB 4ODIA 5KI6A 2VDMB 4NZNA 1L4EA 3K6KA 3R9KA 4NP6A 2FN3A 1L4YA 1Y1QA 3JQGB 4NE9A 3EISA 5AVKA 1FQKA 1MJHA 4CMBA 3A9CA 1N0VC 4BU0A 3QVWA 3B1FA 3U61B 2XITA 1N8SA 4J0KA 1FJHA 2VCEA 3WGOA 3N28A 2ZI3A 1ORIA 2FZ5A 3FCCA 3M82A 3NHKA 1XCGB 2QKYA 1UOPA 4R68A 4QU9A 1AMOA 3ZXXA 4RVCA 2ZW9A 4UVGA 4WX2B 3T52A 4ES6A 1GU7A 4F5WA 1F20A 1U63A 1CR4A 1MC8A 1PVOA 3IELA 4UARA 3L49A 1MR3F 1VI5A 2GN2A 4ZYYA 2V6GA 2YWDA 4J0GA 2IX3A 3D7NA 4HGOA 4BO6A 1MOQA 3HR7A 2QR2A 3ILHA 3BJIC 4ID3A 4RORA 4F91B 1IEVA 1E89A 3TTVA 1XF1A 3JYQA 4U6NA 1G64A 1NTOA 2NQ8A 2C5EA 3JD1A 2IHJA 1K0FA 4UQLA 2PLRA 4G3XA 4D98A 4B4UA 1NW9B 5IX8A 4L9SA 4TLEA 1JXOA 1NBOA 5FL3A 1CJCA 2VWQA 1ECBA 3HADA 5JBQA 3L7IA 3HXKA 4IMPA 4L57A 4IP0A 1ELOA 4X3PA 4WLNA 3W77A 1JFSA 5CEEA 4F9FA 3UYKA 4HGQA 1BWQA 2Y92A 4KL8S 4FFVA 4I2NA 5F76A 4LFBB 1GPBA 5LDHA 1HXHA 4ZMBA 2XCQA 4HN9A 2JAHA 4NFLA 3OM8A 1KOLA 1FNNA 2BRUC 1I3KA 3T3GA 1RRFA 1ZK2A 3U6BA 3FTPA 5HE8A 3C6MA 2RI1A 5DF1A 3RR2A 2ERCA 1GLNA 2O1SA 1VA4A 2MTBA 5FD8A 1L8LA 5JDCC 1KOJA 1NM5C 4GMGA 4W5JA 3GX1A 3V8QA 2YC4C 2Y0CA 3DV2A 4L5AA 3WLOA 2GM4A 3R8FA 3OHSX 5CG1A 1EEHA 1M2FA 2O23A 2SNIE 4FGLA 1X19A 4BL5A 8LDHA 1KFEB 4CM9D 1R5OA 1THTA 2XCIA 4C20A 4W9RA 1PUJA 2ROQA 3RYCB 1MG0A 1GIAA 3CZ4A 4AJIA 2X7JA 3E48A 4BNNA 1OI4A 2IYNA 3CM0A 3ZZ0A 5C5CA 2QAJA 3LCVB 4TZKA 1GRNA 3DP7A 3IJPA 4G8DA 4WVLA 4X61A 3ZY2A 2EP7A 3PXCX 4YHHB 4ZU3A 2VP9A 2G5TA 3W9YA 2ZBRA 1M75A 3EN0A 1JIVA 2WUDA 2JCYA 1VPEA 3U3OA 4GLFA 1AURA 4ZVPA 4L6IA 4DUYB 3ICOA 2ZUUA 2JRLA 3WMFA 3V42A 4UXHA 1QRAA 2ZROA 3FTCA 2JFOA 1AXGA 3EDCA 1QGUB 3GJTA 4K0RA 5LBUA 4S04A 3E0QA 1OLXB 2AT1A 3AHGA 5DISB 3RRJA 4YLEA 3KZXA 1W5EA 1NMZA 3O8DA 1W581 3QQPA 4JOCA 4K5QA 4NYIR 4RIFA 3HNOA 4JDPA 5ER6A 2GNAA 2FGJA 4DKXA 5HKKD 1QAMA 2NADA 2O3SA 3KFLA 1JQKA 4IJMA 4RXUA 2Y4OA 1OLUB 1Q7CA 1GGVA 3EASA 4EHLA 1IUOA 4LXTA 3H1TA 1F51E 2VK1A 4WOBA 1ZH4A 3C1TA 1IPEA 2ECOA 2IEYA 3MNFA 3E7WA 3P2MA 4KBFA 1I0LA 4QAJA 2NGRA 4WCFC 3WGTA 1SG0A 4Z4EA 4HB3A 3JVVA 1HNXB 2VC2B 1QS0B 3KETA 3EXIB 3GG2A 2ZGVA 5DNVA 1BJKA 2BY4A 5TNXA 3N59A 4O4LA 4YJ3B 4BE7B 1ESDA 3AF1A 3QFFA 3S1AA 4B46A 3CTMA 4IO0A 5JYDA 2JA2A 5JDIA 2O8VA 1FSFA 3N07A 3KHUA 2PS9A 4MEBA 2IP4A 2F64A 5A71A 1H4VB 1DARA 1TRKA 1ZEMA 2AR7A 4UEJA 3RUDA 3U39A 4BFCA 2FN8A 1RTTA 4ZC1A 3ZGYA 2WTEA 1US8A 3D2BA 4NMWA 1UK6A 2WJ6A 3EC1A 4X66B 2ZZKA 4J16C 4EDHA 2XWBF 2Z8YA 5D00A 2C4KA 4I4NA 4B3CA 4XWGA 5I4KA 1HBJA 1A9TA 2ZAIA 4IJ5A 5BN5A 3C3MA 1PP4A 3Q3VA 3W7AA 3C6BA 4O25A 3RIMA 3RVMA 2ZSDA 3L4EA 5DYYA 3GDWA 3A8TA 2VKQA 1U7HA 3E5NA 3U3ZA 4KGZA 5I9LA 4AXBA 4F2DA 3DZBA 3HABA 1RADA 2R4QA 1ZMBA 1ZXXA 2AMLA 4X1IB 3JYHA 3LBHA 3RUEA 4MIEA 4BAGA 4QG7A 5A5VA 4A2PA 1T5HX 2NXNA 1SVNA 3FDJA 2TMDA 3CLTC 3WBJA 4X41A 1ZNXA 3H2SA 4GDFA 4LZPA 2FEMA 3CSSA 1V1RA 4WOCA 5AW9A 1IATA 1U7TA 2OBMA 3HFJA 2Y8EA 3R0JA 1JBEA 4XASA 5JAZA 1I5EA 1IM2A 4YRAA 5FA6A 1XQ9A 3UT0A 1D1SA 1HMYA 4WZZA 2WSMA 4O2BA 3CSUA 2EJWA 4EECA 1A4XA 2Z8ZA 2FF5A 1WX1A 4KQ1A 4OIMA 4PE5B 2CJWA 3BMNB 3OLQA 4G1UC 3NWEA 1CLUA 2RKBA 5HF5A 3Q9LA 3T7TA 3ZK9A 4MAMA 3WIEA 5CVTA 4NABA 3BVPA 4HB4A 2FN4A 3H18A 4ZPJA 3ZU5A 1R18A 5F1KA 3DKKA 2J0VA 3LYLA 4FXPA 1FVOA 1UIMA 4I3GA 4X93A 4DIFA 2B6HA 1S4MA 1UAYA 1T5OA 1ST3A 3W79A 1JFFA 1UM8A 5FBZA 1RBMA 3KNZA 5F21A 5FYDA 2Q9BA 4TL8A 5CT6A 4PX9A 5E4TA 1RP1A 3I01M 5EMMA 4LY9A 2P1ZA 3UN1A 1NPYA 1YZLA 3AERA 4ICIA 4JLUA 1P6QA 4MI6A 4RVDA 3RKRA 4EKYA 2V9ZA 1EFHA 2RMKA 4ZOAA 4CCYB 3QMMA 2G82A 3JAKB 5C1OA 3QI7A 2Q6OA 2IIVA 4UTZA 1R8XA 1VMEA 2KQUA 4UC0A 4B43A 1ZS9A 4HQ0A 1BW9A 4XOUA 2AFIB 3WQQA 2O52A 7ABPA 3GGPA 2HLDA 4QNNA 1R00A 1WXHA 3O7MA 1NBME 4I2VA 4JZYA 3H9CA 2FX5A 4PWZA 3VAAA 4RPKA 4MOWA 4PS0A 2D54A 2VLIA 2P6PA 1F6WA 1B00A 3OX4A 1RKUA 1WPRA 4OSOA 4DCPA 1KZ1A 5A1TA 2BFEB 1TJNA 2H5IA 1QLHA 3V8MA 5B53A 3FY4A 1MC4A 3W2GA 1C1XA 3EOBI 3W8DA 2PJDA 4MHSA 2DETA 2VA9A 1H8HD 3H2GA 3SF0A 4MKZA 1JR6A 3W8NA 1FRQA 4BRSA 1IM8A 5J4YA 2FPMA 4FNMA 2BDTA 3TQOA 1XEXB 2X4IA 2IDKA 4NJOA 2NUAB 4TL9A 2EFDB 1F38A 2RHOA 4OK3A 2A67A 5CNJA 2ZE6A 3FPBA 2ZT7A 1TM3E 3FDIA 3JQ6A 3OUUA 2C1EA 1JEDA 1CUCA 1UXIA 2IC5A 4R7TA 5EYPB 3W2FA 4N1AA 2AD5A 1U4NA 3H3XA 3IHWA 1IZZA 4OKIA 4AFNA 1HE2A 4YPOA 1N5JA 2BKAA 4C9BA 1O77A 4G9BA 3RPEA 1OTXA 3TH5A 3ZBQA 1U1IA 3ZNNA 1CUSA 1B0ZA 2FMHA 4WKPA 4BTVA 2JVJA 4D3XA 5JQWA 2GAIA 2NX2A 4DC1A 4PGAA 4CMHA 1YQDA 2WPDA 3H5LA 4B3TB 3P0IA 2QD3A 4S2EA 3HACA 1G55A 2XDQA 4CIWA 3FCOA 4RDXA 3DMFA 2CUNA 4PC1A 3NV9A 2UYYA 1WEKA 3NIBA 2ZLBA 1VIMA 3VTZA 1ZR2A 1DCMA 5C5IA 2IS6A 3IEVA 2O1WA 1DAEA 3UEOA 2HU5A 1K68A 3RT1A 2ZR8A 1L5WA 1GTL1 3JRXA 2RH5A 5IZ4A 1PS0A 3MWEB 2VP3A 4Y6OA 5EOVA 3O7WA 4RTLA 3ADDA 3X1XA 2YOFA 5FPKA 2XKBA 4R2JA 3P2EA 1ZHFA 4S35A 5TSDA 1SG9A 5A06A 3MFYA 1Y8RA 1XZGA 2ORIA 3AJEA 3GJ0A 4UUOA 3AMVA 3UOWA 3ZZUA 1E6CA 4XCXA 4NH4A 3OESA 4BGUA 4ER5A 1N0WA 4A15A 3AY7A 5K3FA 1DP4A 3PPWA 4A2QA 3O9MA 1RYNA 2E55A 3NOQA 3JQAA 4FI3F 1XKQA 4U2KA 4YS6A 2IY7A 2W37A 3M4ZA 4IDDA 4WY2A 3RIYA 1R64A 1WULS 1BVUA 2XNDD 3FRHA 2RK3A 1CUJA 5AOBA 1TXGA 3E05A 5CAEB 1DBPA 4C7OA 1OIVA 2IXTA 1Z5NA 4MWEA 1WIWA 4U3JA 1GRCA 4FYWA 2CFSA 3L8GA 3DWFA 5A05A 4C5BA 3KK0A 4UPVA 3OE5A 4I3HA 4OHUA 3CRQA 2ZBGA 2BHRA 3IHLA 3LKBA 3M70A 4XYEA 1I36A 1ZMXA 3HVKA 4N7JA 2IYTA 1SK9A 4WGGA 4LJ4A 3RF7A 4OLFA 4YMUA 5JNUA 4HS4A 4JYMA 5C37A 1A76A 1YC2A 2BFAA 2VYNA 4R81A 4FCVA 5G2OA 4C6HA 3H19A 3ZBPA 1EK6A 1N2JA 3P8ZA 3WP0A 2DG2A 3OBBA 1QGZA 2FOLA 2ARKA 2QAGC 4B40A 3S2FA 1CEQA 2B36A 2VDKB 3AZPA 3PR1A 1E8DA 1N1DA 1XEWX 2IYAA 2GTPA 2WYVA 4MAFA 2OGSA 3NHWA 3B1YA 3LPAA 4CWAA 1BXKA 2ZI4A 1H0HA 1UIRA 3KC2A 1U9IA 4TVBA 1CPYA 1VPVA 3WKBA 3RUHA 2CDBA 5FV4A 1B16A 5IKEA 5EMHA 1QGYA 4AAYA 2P9ZA 3AM5A 4Y1GA 1LW6E 3O8QA 1MX5A 3Q72A 4N6GA 4WCFB 1YMUA 4DN6A 1QVAA 4J2HA 4NK4A 3AB7A 3DHNA 4LYAA 3WV5A 4EOGA 2D7CA 3C8DA 4IV5A 5KJEA 5JEEA 3TOVA 3FVWA 4K8RB 3DEKA 3X1JA 3QI2A 1L7AA 2HRBA 3W1EA 2F3RA 2BKUA 4PZ9A 3BH6A 1HR0B 1UZUA 3IDQA 2N47A 5EJFA 2FSUA 3S8MA 2GKGA 1QC5B 2FE1A 2O7RA 2Q3EA 1P62B 2VYVD 2ZYAA 4I1IA 1S96A 4QUAA 5ALDA 1CP3A 2F00A 2QXYA 3TRFA 4KQMA 1SM4A 2B8EA 3FGOA 4DC0A 4RF5A 4R9SA 3D7SA 4YMSA 3FYCA 2HV8A 4J3NA 4AJ1A 2VCHA 3RVPA 2QN6A 1IXZA 2QRQA 3NETA 4KNWA 3RGWS 2V3CC 1YS4A 4IDBA 4DCGA 1C9MA 4X00A 4C08A 5CCXA 5A4JA 5IANA 1RWVA 1V37A 5IAJA 1BFKA 3N2EA 5FOUA 1OXBB 3IOBA 2QROA 5D5HA 1JKJB 3OZWA 1Y6JA 1W0CA 1ZNZA 2X3UA 3G2OA 5FCDA 3T0FA 1VE1A 1ETHA 1MDFA 4ZOLB 2RGGA 3RREA 4AJPA 4WZBB 1AE1A 2QXUA 1FEZA 3KQPA 4B76A 4C7VA 1EGQA 5FOVA 4F45A 5JANA 3L7YA 5K4AA 1NKTA 1QH0A 3F6EX 4XIJA 2XLBA 5KEIA 2PN1A 2YWJA 5T4HA 4M9ZA 1G5RA 2J7PA 4F6RB 4NU8X 4YRJA 2WJZB 1SCNE 4Y9RA 4EQ6B 3IAM1 2HTFA 5HMMA 3D0OA 1YDWA 2V8OA 1SUAA 3V1TC 3QKWA 2V8BA 3GNSA 5BSEA 1P45A 3DL4A 3TGLA 1S2IA 1CNFA 1R6AA 4U2BA 1Q19A 3GRCA 1PQWA 4L85A 4MUXA 2E87A 4HPXB 1W59A 3DXFA 3HEAA 4GRAA 1O6GA 4XE5A 3OZFA 3M4NA 4JK3A 4N9QA 4P32A 1BYIA 2YWHA 4RLSA 2ZANA 5TQ0B 3NT2A 3VYUB 2XYVA 2W2LD 4HWRA 1Z74A 3QELA 3MM4A 1T1RA 1V5WA 5CVEA 1Y9JA 3DOJA 2P90A 3E9CA 1ISGA 4M8SA 4CKBB 5BNZA 1X0VA 4D80A 2IHTA 3NOXA 1GNQA 2XECA 1HDGO 3LT1A 3TL2A 4E22A 2F3SA 3D6JA 1AB5A 5KX5A 2DBYA 4PYJA 4LTMA 2ODNA 1JFTA 5FQOA 4EEXA 4RH0A 1FLVA 1R3UA 3K8ZA 5LA6B 2FSVC 2IP1A 1T4DA 3H9QA 3QLVC 4J49A 4XXHA 5B4VA 5AVWA 5C7YA 2F90A 2R5WA 4RQBA 2AG0A 2BJWA 3DTVB 3GJZA 1NWCA 1KSHA 1Z7EA 3LOQA 4RS4A 3SHFA 4K05A 3VQTA 2MSLA 3PXUA 1U1EA 5DULA 4ZAVA 4BNHA 2B92A 2X13A 5BOSA 4KXYA 4RXTA 2X8JB 5CH5A 4NFSA 1UZMA 2LE0A 4K6GA 3UMRA 3WK6A 3OMLA 4PCLA 4XFJA 4ZI5A 1D5CA 2OESA 1M74A 1XZDA 3M9WA 4KWHA 1ZWLA 1LX7A 2J3IA 4O8ZA 4ZYUA 4PBTA 4RKEA 4G0XA 3S0JA 2RGBA 3D3NA 4H59A 1ZD3A 4L4UA 5KYNA 2YYYA 4U1RA 3UUGA 2WB4A 1IHPA 4PX5A 4JWKA 4CG3A 3LUKA 1FS4A 4BGEA 4BJ1A 1B8VA 3G2NA 5DHRA 2C0QA 1L1EA 4M89A 1SWVA 4ZZ0A 3UJ7A 5AI6A 4CDNA 1W93A 3LTEA 2UVQA 4QYXA 1Z8NA 2QVGA 2WWIA 2YWXA 5KPDA 4RANA 3IJEB 4OQ4A 1G2IA 1W85A 4MCJA 3ZQKA 1TFUA 1PUXA 2IHKA 3DEJA 1L0BA 4B17A 1DKUA 3WLTA 1Y33E 1ZIXA 3PNSA 3N2IA 2PAFA 1EK5A 1U04A 2HRZA 4WLVA 4P4TA 1GSHA 1B3BA 3FVQA 4R51A 5I3CA 2YMLA 3AR4A 1Z2OX 3K4QA 2EGGA 1Q74A 3C3DA 1DIBA 4B85A 4LJSA 4PYRA 1NQ5A 3LSYA 3IR5A 4BV8A 4M8KA 2Q3HA 2QOEA 3ASVA 2UXCB 1W1UA 4F2WA 2NTEA 5SYNA 4ZRDA 2PJUA 3ABIA 1RIIA 4U7HA 3SHOA 4FYYA 1EK2A 1I7PA 4OREX 5JZBA 1ZHOA 2ODEA 2BVNA 1UWVA 2C4VA 5ALLA 1ORRA 1SD5A 1MHTA 1WM1A 1XZJA 2IYLD 3HDJA 1KS2A 1E7QA 3B1KA 4GR5A 4ZEOA 3E3OA 1NL3A 1WOMA 2BLLA 2M6LA 4NNJA 1GQQA 2H0AA 3V1UA 3RJTA 1CQXA 1B2RA 1TYBE 1JQJC 2V7WA 4IH4A 3K9LA 2W7TA 3R4VA 4KYUA 4QJ4A 5KYXB 3GIDA 2JBHA 1AS2A 3EOZA 2KYRA 3VH2A 2BBSA 1V8DA 4IV8A 3OZSA 4H6WA 1S2NA 5DBIA 3ZTYA 3ZE2B 3FOBA 4R3UC 1SQSA 1TKBA 2W71A 3NWJA 1H2WA 3MILA 3VYWA 3BZWA 2ZM5A 1F4LA 1GU0A 3AGPA 5FIUA 1M5RA 1PT9A 5M5BA 3CF2A 4IH9A 4EHIA 2JIRA 4LOLA 3VTKA 3NDJA 1XA0A 4Z4CA 1GKKA 4TMWA 2QZSA 4DG8A 3AM1A 1E1YA 1UKVY 4MMXB 2AJLI 1DU4A 4DV0B 1MH1A 3CNNA 3ELBA 4AKTA 3E70C 1GM5A 3GJRA 4YWJA 3A1FA 5GZ1A 1QM5A 3R3YA 4B8ZA 2RAUA 3VMMA 1F8XA 4I9UA 4F04A 3A3OA 4LV5B 3ZD8A 1SBQA 3OECA 4FHDA 3PC8A 4HLUA 1UMDB 4DMCA 1G16A 1R50A 1Y9EA 1BEZA 1U1DA 1RXSA 2IFTA 1F2UA 3FNGA 3AUFA 4MV7A 1LBHA 3ONVA 3JALA 4QUDA 4DPLA 2WTMA 2VP6A 2ONZA 2WV9A 2B1JA 2XUAA 3AR5A 3I76A 4UNIA 3NYIA 3S3TA 3ZK7A 1W96A 3RS2A 1VLLA 4QFDA 5HJ5A 4CEJA 5DKFA 3A3NA 4LN1A 1G6Q1 1IXRC 1Q7RA 2HIAA 1C4OA 1JVBA 3ST7A 1GPDG 3UNXA 1FFEA 1ZMOA 2BFCB 1PTJC 1Q92A 1CF4A 4V24A 3V4PB 2FK7A 3STWA 3AESA 2VR1A 3ROTA 4M7RA 5K03A 1N6IA 3ZDZB 1SBZA 2HOQA 3DVQX 4I9NA 3W9SA 1UK7A 2Y3IA 4HD8A 5ICCA 1U6JA 2PTGA 3LXXA 3B1VA 4LRSB 1V8FA 5EVJA 2BM1A 2YBDA 4OXXA 4QQNA 1TW3A 2XD4A 1RACA 3QKTA 1WCWA 2H06A 4WA7A 5DM4A 3MT8A 4ALLA 4AY2A 2HGZA 4UZFA 1DBIA 3EWAA 4AVYA 2VTBB 1PL7A 3VHLB 2CNOA 1M34B 1SCUB 3QOWA 3FIUA 4URYR 1ZCFA 4GVPA 5D3ZA 5AMXA 3REOA 2PUGA 3DVSX 2BMJA 2I1LA 3HO1A 1RRVA 4C3OB 3THXB 3T7AA 4EENA 3OQMA 2F43B 4LI0A 5DRTA 1MB2A 3SYRA 1Z82A 3MCAA 1AB6A 1Y8ZA 4W99A 5EGSA 2OV8A 5CBPA 1TEZA 3EGIA 1JN0A 2VSNA 4Q19A 2JIQA 2ZQ5A 1DDIA 1P2DA 5A4MS 1I6WA 1WQ4A 3CGWA 4C6SA 3WGGA 3VKGA 2WW8A 2VDWB 1FDWA 1EJ0A 3QFRA 3KZOA 5EE1A 2B99A 3QEJA 4U5XA 4R71A 5F2EA 2EGHA 1I6LA 1LVHA 2YR0A 3I6ZA 3RIHA 4KO8A 1E79D 4A92A 5ENVA 5AW8A 2A92A 4WXPA 4P3YA 5CXQA 5JSZA 2QTZA 3KKQA 4G0YA 4HZGA 3P0FA 4I99A 1WBDA 4YLGA 3FNFA 3DVLA 1JVSA 2V55B 2XX3A 1KBZA 1Q7TA 2XUPA 3GAZA 2GEFA 1SKUA 4IJ6A 1B0PA 2HDHA 2W2KB 1Q1QA 6NULA 2R62A 3F8TA 1JLHA 1BGVA 4PZPA 2OHVA 4GC9A 3VZBA 3NI2A 4RZSA 2O2DA 1H22A 3E0XA 5FWXB 2GBCA 2IPMA 1UKZA 1YDGA 3KVOA 2PG3A 3EMVA 3RYFB 2X0KA 3S5UA 3TINA 4A73A 4KPEC 1RAAA 4MAAA 4LJ5A 1LV7A 1I2CA 1ODKA 3RYHA 2DLCX 2J32A 1Q7BA 2MSDB 2NYUA 2YIMA 3N5CA 1YZNA 2Z08A 4GPZA 4M0PA 4G5SA