1KK3A

Structure of the wild-type large gamma subunit of initiation factor eif2 from pyrococcus abyssi complexed with gdp-mg2+
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
405
structure length
398
Chain Sequence
SRQAEVNIGMVGHVDHGKTTLTKALTGVWTDSEELRRGITIKIGFADAEIRRCPNCGRYSTSPVCPYCGHETEFVRRVSFIDAPGHEALMTTMLAGASLMDGAILVIAANEPCPRPQTREHLMALQIIGQKNIIIAQNKIELVDKEKALENYRQIKEFIEGTVAENAPIIPISALHGANIDVLVKAIEDFIPTPKRDPNKPPKMLVLRSFDVNKPGEKLVGGVLGGSIVQGKLKVGDEIEIRPGVPYEEHGRIKYEPITTEIVSLQAGGQFVEEAYPGGLVGVGTKLDPYLTKGDLMAGNVVGKPGKLPPVWDSLRLEVHLLERVVEQELKVEPIKRKEVLLLNVGTARTMGLVTGLGKDEIEVKLQIPVCAEPGDRVAISRQIGSRWRLIGYGIIKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords eIF2gamma
publication title The large subunit of initiation factor aIF2 is a close structural homologue of elongation factors.
pubmed doi rcsb
source organism Pyrococcus abyssi
molecule tags Translation
total genus 98
structure length 398
sequence length 405
ec nomenclature
pdb deposition date 2001-12-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00009 GTP_EFTU Elongation factor Tu GTP binding domain
A PF03144 GTP_EFTU_D2 Elongation factor Tu domain 2
A PF09173 eIF2_C Initiation factor eIF2 gamma, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk3A02
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 1kk3A03
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kk3A01
2IYYA 1WRBA 4Y0VA 4B32A 3AGQA 2FOLA 5CDFA 1WCV1 3KXLA 4PHGA 5FOVA 3NH9A 1N0WA 2QTFA 3A37A 4GP7A 4D81A 1QHHB 1EXMA 1KI7A 1M7BA 4L15A 1AZSC 4AKHA 4G5SA 2ONKA 1M6NA 4RFSA 3NH6A 1KY3A 1GUAA 2GVDC 4AF6A 2Z5FA 1H8HA 1E2KA 1GVHA 1KI2A 1CJMA 3TNFA 5EE0A 3U3KA 1E0KA 5J40A 4KCGA 3D8BA 4URWR 2QT1A 2XOKA 4F91B 5DGXA 1S0UA 2NZ8A 1F6BA 2AKAB 3V9PA 4JVMA 1OPXA 2C5LA 3K8YA 2A5GA 2UZIR 3GMTA 3KQKA 2ZUDA 2GJ8A 4HAYA 3SJCA 3UPUA 4RFSB 2J7KA 3QKSA 4BASA 3ZQJA 2VP0A 3FB4A 3NTUA 4C0SA 1NY5A 1SVIA 4LWZA 1Z6XA 5DI3A 4B2LA 1JXOA 4JJKA 5DYGA 1G3IA 3WMGA 2WJVA 3A58B 1IN8A 3EIHA 4IOMA 2WPDD 2IYZA 1DAIA 3HR8A 1OIWA 2CDNA 3EA0A 2WKPA 4TYQA 3VAAA 2NO9A 4AK9A 1IONA 5AUPB 3V4RA 1NG9A 2QA5A 4JYBA 1FNDA 3FE2A 1SKYB 4JBWA 1HV8A 1KSGA 2IWRA 1DDIA 1ZINA 3UK6A 4IHQA 3TAUA 3GLIA 3CWQA 1UBEA 2V9PA 3HDTA 3P20A 4JLAA 5CYPA 1YZTA 3TGPA 4OK3A 3L43A 4K46A 3VMFA 4OK5A 4NTZA 1RC8A 5AUOB 1N6KA 1LS6A 1SXJA 2ZRPA 3IHWA 4P4UA 2EFCB 1DPFA 4XVRA 2WJGA 4KXFB 4RSGA 4EPXA 1YZKA 3AP1A 5JMTA 4TZ0A 2IYVA 4JL8A 2X19A 3ASZA 1P9RA 4UXHA 1G7RA 2QDXA 3CR8A 4NCIA 1IHUA 4LI0A 5CLQA 2WIAA 5AUNB 3T61A 3SDZA 4MRPA 4NYJR 5AJWA 4D80A 3P4YA 1AQUA 2XTNA 2HEIA 4FIDA 2J7PD 2R6CA 1C1YA 5BYKA 3WYGA 3KKQA 1W48A 2VSFA 3OAAD 5GVSA 2QENA 4U7DA 1OIVA 5AJYA 2VPPA 4MRSA 4TT3A 2W6IA 2OAP1 1YR8A 4JBYA 2OCBA 4TL6A 2H5EA 2REOA 2ZTSA 3TE6A 2V1XA 1T5IA 4ESVA 1F60A 1XCPA 2REXB 2ZJAA 4CEHB 1W36D 1LF0A 4NCNA 2WAXA 1U9IA 4JZKA 1R7RA 1N6PA 2ASEA 1XZQA 4GBMA 3CC7B 1MABB 2P6NA 1Z29A 3QE2A 1AK2A 1E0JA 1Z22A 4QGAA 3SE0A 2EFEB 3QNUA 1K73D 3LW7A 3LW8A 3SBEA 3QSYA 3UKDA 3DHWC 4BLSA 2G1KA 1E9BA 4D2IA 2G3YA 4PZLA 3UXMA 1KJZA 4ASUD 4AYXA 1G64A 5E3HA 1E9CA 1E94E 2DWQA 3OE7A 1GWNA 2FA9A 1US8A 1FX0A 3J81k 3D31A 3RS0A 4MYHA 3MJRA 1Z06A 4V0NA 4AKGA 3AF2A 1VCIA 5CM8B 3NHBA 3L0PA 3SQXA 1WBBA 2IEZA 3QBVA 1I2DA 5DN6A 4E09A 1VHTA 1DG1G 4Y7CA 3B1WA 3F3YA 4LJ5A 2W0SA 3IPYA 4QJ4A 2PJZA 3U7HB 1FMLA 2ZR7A 2R6AA 3PQCA 1ETUA 2FE4A 3JQQA 1MRNA 3PV0A 5FBQB 4ITRC 1ZM7A 2AFHE 2DETA 2JJ1A 3LD9A 1X8KA 2GVZC 4PR0A 1AS0A 3CO5A 3R8FA 2R9VA 1G4UR 1NSFA 3OEHA 4P6VF 1NJID 4B75A 4PQRA 3WP1B 1G5TA 4GZLA 2BMFA 4S35A 2G83A 3DKVA 4LX0A 2F9MA 1I7PA 1HYQA 3F5FA 3PUWA 1Y3AA 4EQ6A 1ONBA 2KJQA 1Z8FA 1KKMA 1GM5A 2EW1A 1T9HA 2IHYA 2BKUA 1G17A 2YJTD 3CRVA 1JPNA 1XXHB 3N2EA 4FMCF 5JRZA 1N8RD 1EX7A 3ES9A 2QP4A 1E2IA 3GEEA 3UANA 4A2PA 4R9UC 3SS8A 3EAQA 2BIFA 4MYCA 4EPYA 3PUYA 3NHAA 4ZDJA 1L4UA 3MRSA 4DCNA 2WZQA 3CM0A 1COWA 5CK4A 4OQNA 5FUYA 1QGAA 4LBYA 2BMWA 1KZGB 3PJRA 3AVUA 1R6BX 2J7PA 5DLQC 2C03A 2QAGB 3VTKA 1U81A 4LJ6A 3VO2A 1AGRA 2JGNA 1NG1A 4CGZA 3KJGA 2BV3A 3CBQA 1IY1A 4NYIQ 3SOPA 1CNEA 4RD6A 2J1LA 4KLZA 4CYMA 5JI2E 1SVSA 4MQBA 3B1ZA 4OI2A 2RGGA 4JLKA 2YOHA 2CEAA 4MKFA 3WHKA 1U98A 1X1RA 4C7OB 3ZBTA 4XTRA 5EZ5A 1ZP6A 4MYTA 1ZVQA 1Z2CA 1XU4A 4JVLA 1IXSB 2ZAOA 4KHZA 4O2RA 5H59A 4PO8A 4K1XA 3TSZA 1QZXA 1UDWA 3OESA 4A0RA 4QGFA 3QVUA 3W3AA 4BLOA 5E7MA 1XEFA 3W2EA 1AQYA 3IUYA 4MYUA 1XTRA 3GFPA 3I61A 4B73A 3ND9A 4WVFA 1E1RD 1O87A 1PZNA 2CBZA 5H1YA 3QUSA 3OEED 3NBZC 2GA8A 4C0BA 3G5UA 1Q81D 2KBFA 5EXTA 2ZM5A 5H68A 4PAOA 3PEWA 4Z54A 1NP6A 4HDCA 5SZKB 2NPIA 1S2MA 4NYIR 4Q1DA 1SVWA 1G20E 1TQDA 2JASA 5J47A 1S3SA 5SZIA 2Q9CA 1BYIA 4R98A 4PC6A 2B6HA 3GFTA 4IRUB 4JT2A 4TL7A 1GFIA 3AH8A 4D4LA 3U61B 1CXZA 3X1YA 1TEVA 2IC5A 3FOZA 2HXSA 1H42A 2F3TA 2REBA 1AGPA 4HAWA 4ESHA 1BMFA 5B58C 2V3CC 4TLBA 3V00A 1FTSA 2OCYC 3TQFA 2WKRA 4D0LB 5KDLA 2OE2A 1SHZA 1XJ0A 4EH1A 4OBEA 1G8FA 5FOSA 2HJVA 3HR7A 5CDFE 2PBRA 2OLKA 1NN0A 2OK8A 3FMIA 1EFUA 4FCVA 4BFYA 3OEHD 4FINA 5J4HA 4HLUA 5EQTA 3HWSA 4RJLA 1DE0A 3E20A 4EJSB 1MH1A 1N5IA 1J70A 5DISB 1Z5ZA 3SU8A 3K70D 4LBVA 1P2TA 4YMWA 3W5JA 5K8TA 4W5WA 3LXRA 2JIZA 1OB2A 1NVWQ 4B3CA 1VQOB 3NVAA 3U44A 1QVRA 4RVCA 5DN6D 3K0EA 4GT1A 4UXIA 1E2LA 1E6CA 4KI0A 3TBKA 2DFTA 2ZRNA 3LVQE 1YJWB 221PA 2LKCA 4XJXA 1XBTA 4EFMA 1NKTA 3A1WA 5GV8A 5HR5A 1P2SA 2D74A 1IXRC 3QPUA 5UKDA 1NVUQ 2LCFA 3K9LA 4NCJA 4K81B 5FI0B 4TMVA 4OQMA 5AR1A 2WICA 2QU8A 3CXCB 5HE8A 1BX0A 1KYIA 2RGNA 3VU9B 3VKWA 1XXHE 1OXTA 1CR4A 2XJ4A 2V1UA 3BBPA 1D5CA 2IYLD 4B2PA 2HJGA 4HLUC 4FMDB 4D6PA 3TAHA 3RANA 2AK3A 3CCVB 5D3MB 1FNNA 4TMWA 1SGWA 3GEIA 2PMKA 1II0A 3TR0A 5FR1A 3I8XA 4LHYA 2GAOA 4HDQB 4LDJA 4D4JA 3DVLA 1RJ9A 4UNQA 2PCJA 4UNSA 1N5JA 3LV8A 1EFHA 3RWMB 1TL7C 2WM9B 4M8NE 1Z07A 2YV5A 4LGMA 1Y63A 1C9KA 1IXZA 1R0XA 2FGJA 1BJKA 4M21A 4PHTA 2XJ9A 1WB9A 2RGAA 1OKKA 1U8AA 1G8HA 5LD2C 3HP1A 4B43A 2IL1A 4I1UA 4KODA 1H85A 2ZJ5A 5L3QA 1T4GA 1HEIA 4B4DA 4GMXA 1KY2A 1FNMA 2YC2C 3AVOA 1O3YA 1GRRA 3K09A 1JNYA 3QFRA 4C3ZA 4YMTA 5KPDA 1T3LA 2P67A 3EARA 4QOSA 3OF5A 4JIMA 2VHUA 2ORWA 3V76A 5AJVB 2VH5R 4M1YA 3QFSA 1E2HA 3BXZA 3EC2A 1G7CA 1Z6GA 3JVVA 2BOVA 1I4TD 1LS1A 5HCIA 2ZU6A 1P7CA 1G16A 2OFOA 4OYHA 1CULC 1Q21A 4NU0A 3QI2A 4DZZA 2IYSA 1CNFA 4Q1FA 1W36B 3L8ZA 1W49A 1KO1A 1QHIA 3RAPR 4UAJA 3I55B 3T5GA 3MLEA 5G41A 4C4PA 1MT0A 2GBLA 3IIMA 4UJ3A 3CIOA 3QFTA 3U3MA 5C4MA 1XPUA 1ZUNB 1UKEA 3TW4A 4AYTA 2VBCA 4QM7A 4DWJA 3GLGE 1MV5A 2A5YB 2GK7A 5B30A 1KI8A 2NMVA 4KYIB 3IIKA 2BBTA 4MA4A 1AN0A 1QFYA 3A1UA 1XE1A 1F3OA 3CZQA 5FBRB 5KPJA 2F1IA 2IS4A 3U60B 1UPTA 1UBFA 1YJ5A 2XSZA 1XMIA 1DS6A 1RRCA 2QNRA 1HT1E 1MO5A 2G1JA 2CL6X 3RRZA 5B57C 2XZPA 4IDOA 4JLMA 4OQXA 1Q7YD 1ANKA 3EW9A 3BOSA 2VL7A 1X86B 2OBMA 1Z2AA 1JJ7A 1OIXA 2ORVA 4Y9RA 1FX0B 4RKFA 1HA3A 3EPLA 1S72B 1DADA 4HATA 2C98A 3I32A 3REFA 1NIPA 4GL2A 1E1RA 3U2QA 1E96A 1JR3D 3VFDA 2EU8A 3CD6B 4WZAE 3T34A 3OFND 2XTZA 2F7SA 4LUCA 3W6OA 821PA 2BGJA 1H8HD 5HKKA 2IXGA 4PPNA 4B44A 3L0IB 3BH7A 1FP6A 5EE5B 2OXCA 1CLUA 1L2TA 4Z1MA 1J2JA 1OGJA 3V4FA 1VQ5B 4QG7A 2B21A 3WBKA 1KI6B 2GESA 1SKYE 1EP1B 2FZ4A 2R2AA 4Q1BA 4TQUS 4BFTA 3CX6A 5TMPA 2J9RA 4EFNA 4CEHA 2I3BA 1G3QA 4TSFA 2RC5A 1F2TB 1D6JA 2ZI4A 1E9SA 3KQLA 4ZCMA 1XJCA 4DEXA 1U0JA 2GTPA 2BEJA 2KSQA 2CCKA 1VG8A 2J5XA 3LLMA 1JR3A 1XZPA 3R20A 4LBZA 1OFTA 3FVQA 5CB8A 4Q9JA 1TF5A 4WOPA 1HUQA 3GEHA 1IN5A 4DLSA 3U3RA 1KKLA 1JALA 1T3SA 5DNYB 4R71A 1G8YA 2ZREA 3E5HA 5B2ZA 2CNDA 2GZDA 5AWFC 2C95A 3QVVA 3T5DA 1NLZA 2Q6TA 3ADCA 4I4LA 4ZCLA 4DIDA 3KFXA 2OFXA 2VNHA 3ZJYA 1KNXA 4AIIA 3QOFA 1GR1A 1A8PA 2O8FB 4BRUA 1H8EA 1T3HA 2DFNA 3B9QA 2HYDA 5IDVA 4RFVA 4KFUA 4OI0A 2JA1A 4AY2A 2JJ2D 4OQLA 4DUGA 1UFQA 2H1LA 1ZMXA 4A15A 3W8RA 2ODEA 5TR9A 1R0ZA 1M34E 3CRMA 5FR2A 4AKEA 1A5TA 4Q4AB 1WMSA 1LW7A 3BORA 1E1QA 1XX6A 1S4QA 1N3BA 1Q0UA 1ZC3A 1FZQA 1QG4A 2Y8EA 4PHHA 4BLPA 4BPRA 2ZE6A 3K9NA 4RZXA 4C0AC 4A2WA 5K8UA 4FMCB 3FPKA 2O8FA 3VX4A 1P75A 4NYMQ 4JMPA 2XB4A 3KJHA 1XRJA 4H1UA 4C0KA 3ZZTA 1IJFA 2V7QD 1VG9B 3KUCA 5BN3A 5JSZB 1CP2A 4F38A 5K8LA 2PIAA 3I3SR 1J7KA 1W2HA 3Q5EA 1KOFA 1KMHA 4TMKA 1EWYA 2VEDA 3RS7A 4A6PA 4UNRA 2WJHA 1PV4A 3BB1A 3QFCA 4S2EA 2TMKA 4ZPXA 4Q1EA 1OXUA 3ICEA 2UKDA 4ASUA 3H84A 2H92A 2W58A 5JWOA 3MG9A 1NF3A 4D26A 1KTVA 2Q3MA 1TQ6A 2N1BA 2IX3A 1WDTA 3VNUA 3SJAA 1FRQA 1NDHA 1F2TA 2GETA 2DPXA 4HEJA 3B2EA 2ZR9A 4TTRA 3HPQA 1FRNA 2Q3FA 2OILA 2ZI3A 1EWRA 5FTJA 4QFMA 3CH4B 5GJWC 4M1WA 3GJ6A 2HCBA 2PLRA 2HV8A 2C96A 3SC3A 2ZUCA 3KQNA 3NBFA 3P32A 3RABA 4WXPA 1X8JA 1A2BA 5EP3A 1ZC4A 1J9ZA 1QHHA 2CMKA 4AURA 4PGOA 4I1SA 4ZKDA 3K0FA 1TEXA 4ZDIA 4TLCA 4A0GA 1A4RA 1TUIA 1UKVY 4XTCS 3RS3A 1KDPA 3OAAA 1M1YE 4D0NA 2GEDA 1YQTA 4MGIR 2BBWA 1RVDA 4B6EA 1QVAA 2DHRA 3K0SA 4GOKA 4HLCA 1ESMA 2P5SA 1TVCA 2FSFA 2QEQA 3VQTA 4X8MA 1OHHD 2AKYA 4DLYA 1XP8A 1Q86D 4IOKA 4TWZA 1XJQA 2RGEA 4PTLA 3K70C 1QDEA 1FMJA 1JAHA 521PA 4Q7JB 5KSZA 4LRWA 2JLXA 5JBQA 1OB5A 2V7QA 2QL6A 3C41J 3CB4A 1VG0B 3JZMA 4P4TA 4Z1MD 5JJLA 1KI1A 1FFHA 5GADl 1GL6A 4J0QA 3DMNA 3WRYC 2GXAA 1E9FA 1YZGA 3GJ5A 4DLXA 5BW8A 2JLSA 4LY6A 1F48A 1XF9A 4IDQA 3LBNA 3IHLA 3CR7A 3KDSE 2B7CA 2G6BA 1AJEA 3GJ0A 2BWJA 3GJ4A 1KMQA 1BOFA 1JA1A 2YWEA 1TQ4A 2FN4A 2BDTA 1MO6A 3P4XA 1Q57A 1V43A 2VHCA 3KUDA 2BVNA 1XWIA 3PVSA 5CM9C 2OBNA 2ZRKA 4PXAA 3W2HA 3VKGA 4DLZA 3K0AB 4OI1A 2FFHA 4LJAA 4G1VA 4NKRA 2NO6A 4F7DA 3RHFA 1E32A 2XNDD 4DEYA 5GJVC 1QBKC 1IM2A 1UEIA 1L8QA 1R0WA 1YHNA 4WA7A 1G5RA 2ZSFA 4HZUA 3U7GA 3GLIE 5FOUA 2OUKA 2YKGA 3VR3A 4U9UA 4FMDF 4KVAA 4NMMA 4KJZA 4PFSA 1T91A 2ZSBA 3VR2A 3KB2A 2QTZA 4EPTA 1G6HA 4JLVA 3B85A 4EFLA 1DAEA 3EZ2A 3G6EB 2IT1A 2Q9AA 1TADA 4I99A 4DSOA 3QEJA 2IW3A 5BN4A 4KFSA 4YDHB 3A4LA 4AI6A 3MCAA 2P3SA 4E5UA 721PA 4NP6A 5KYKA 3KX2A 4N0DA 2A5DA 5KDOA 1G6OA 2W2XA 2RHMA 1RJ9B 5KO2A 4B3XA 4OJQA 4L9WA 4CEIA 4JLPA 2QE7A 4FWIB 1VTKA 4PC3A 2EFHB 5EJEA 4IXNA 5HZKA 3HJNA 1D1NA 4TYPA 5L3SA 3T06B 2WOOA 3ZZ0A 2WVJA 2BMJA 2O8DB 5FPTA 4ACAA 1DTSA 2DR3A 2PT7A 5E7JA 2J0UA 1OHHA 1M1KD 1U94A 1PJRA 3B6EA 2GCOB 5FOWA 3VU9A 5EXSA 3CC4B 2FZLA 1FW6A 3JVUA 1E79A 2IF2A 3I72A 4IVRA 3K9GA 1RIFA 1CR1A 3TIFA 2W6JD 2JLZA 5C1BA 4XSGA 3RC3A 3FMPB 2CLCX 3G4SB 2J3EA 3SYKA 4A8JB 1W2GA 1QFZA 1KO7A 1YZQA 1ELOA 1HQCA 1R10A 1J90A 1UADA 1ZUIA 3S1AB 3SFZA 4UXJA 3BWDD 3WRXC 3RWOA 1GITA 3FGNA 4QC2A 4OQFA 1II9A 3OZVA 4PPQA 2OG2A 1QUEA 4FWTA 1QHXA 3GLFE 2CL7X 3SI7A 4KVGA 3QBTA 1F2UB 2ZE8A 3FFBA 1G5PA 1P72A 4C0LA 3CPHA 5EP4A 5FPKA 2A5JA 1E79D 4MITA 4TLDA 2P5TB 2V6IA 1PUIA 3QXCA 3TUJC 4XWKA 2F55A 5CIQA 2VQSA 1P6XA 1XCMA 1FNCA 4ZDWA 2VA8A 2GJKA 3B8HA 5KNDA 2GF9A 1VKJA 2Z4SA 4QHSA 2A9KA 4YLGA 2DERA 1KO5A 1IY2A 2QBYB 3U3OA 4US0R 4M1OA 5JCPA 5LB4A 5EUMA 4HLQB 5KNBA 4DCTA 2QA4B 2FEOA 2RAPA 2ZS8A 2WSMA 1L7VC 2QE7D 1N6IA 1JR6A 2OHFA 4JVSB 3FWYA 1Q1EA 1OXSC 1TU3A 1SZPA 4L5BA 1P62B 2RGCA 4ZGNB 3HU1A 2VO1A 4XH9B 3TKLA 1ZRHA 1DO2A 1N6LA 1E1QD 4QL3A 1RZ3A 3WHLA 1AIPA 1XD8A 1YZLA 2VP5A 4GP6A 1G291 3X1ZA 2O8BA 1CJUC 2XTMA 3L8YA 2OCAA 5E7IA 3LBHA 4QKQA 3THXA 2HLDA 2W2VA 3OIVA 3MAAC 4G5OA 4Q48A 1SM4A 4PPGA 4O3MA 3ZDQA 2F9LA 1IBRA 1CKEA 2ZRFA 5G3ZA 1KHTA 3MJHA 3LH5A 3QXHA 1UF9A 3BFXA 4YC7A 1BMFD 2D7DA 2G88A 5JCZA 1GAWA 3Q3JB 1VHLA 4QHYA 4L16A 1IB0A 1HE1C 4RZ2A 2JLWA 1KDTA 1A7JA 3MSXA 1Z63A 4H1VA 2BMDA 3OZUA 3CCMB 1ZYUA 2QBYA 2OTJB 5JZVA 1F5NA 2IS1A 5DIFA 3CH5A 1VQ7B 2CLDX 4JKIA 3AVXA 1NJGA 2ZJYA 4IDNA 5FOTA 3FMFA 1ZCAA 2QM8A 2LKDA 3ZGXA 4G1UC 1S8FA 2MMCA 4RY2A 1Z0FA 2GBLC 1NL3A 4RD3A 1JR3E 3IIJA 3FMOB 2ODBA 1F2UA 2CHQA 3TR5A 1NN3A 4YQFA 2VP6A 5HCNA 4QNRA 2WMOB 4RD1A 2QRNA 4HDOB 1P3JA 4KAXA 1X8LA 1RPZA 3CMAB 2ZR0A 3QENA 5HE9A 1XNJA 2J45A 3DO6A 4V0MA 3GLGB 4XWAA 2QQ0A 5FBLB 1GP2A 3AF3A 2BSAA 2OK7A 3PG5A 3X1XA 3TSWA 4A8JA 1GJRA 1KDRA 3NEJA 2JJ8A 2QN6A 4TMZA 2XZOA 2XGJA 4HAXA 2VF7A 1SXJE 4AG6A 4DJTA 5KHOC 4MRRA 4QNMA 4WZ6A 2XB2A 2FJUA 3G71B 2ZJZA 2N42A 1WBDA 5KSWB 2PJRA 2B7BA 2WWGA 2QSZA 1W0KD 4OI4A 2JATA 1R8SA 2XSZD 2DFKB 5TY0A 3LNCA 3DDCA 1HE8B 3QG5A 4EKDA 2GZAA 4LHVA 2WWYA 3R9WA 5JFGA 4ON9A 5TXGA 2ZJOA 4HB3A 2DY1A 1NBMD 4LPKA 2NPFA 1Q20A 1TNDA 3QF4B 4B3DA 2BMEA 3SJZA 1KI9A 1KSHA 2XAUA 1SVKA 1YITB 4MRNA 2WIBA 3PENA 2Q0HA 3IEVA 4G5GA 2QI9C 1JQLB 2BEKA 4FCWA 5F9FA 3O8RA 1Z28A 4JLBA 4PHFA 1LTQA 4B33A 1GKIA 3B60A 2JJ1D 2YWHA 1MO4A 3IILA 4D4MA 2CRVA 2J41A 2GJSA 5FL7A 3O8CA 4M1SA 4JLNA 4JT4A 4AG5A 4C0JA 2AHOA 1JJVA 4NYMR 4B6FA 2KB0A 4AC9A 4Q1AA 5EXPA 5KSYA 5FBWB 1NY6A 2WTUA 1KK3A 3DOFA 4HZUB 3AEZA 1PUJA 1JEDA 3CONA 1EG7A 3KJIA 3SZRA 1K6MA 4BLTA 2C8VA 2QSYA 3Q7QA 5A0FA 4BGDA 2R6GA 1CQXA 2Z43A 3EX7C 3PXGA 1XMSA 1JEEA 1TLLA 4Q9LA 2YOFA 5IHPA 1UKYA 2JLVA 1ZNZA 1W0JD 3GJ7A 2QGNA 2R6FA 3PUXA 1KD1D 2OFWA 3WMFA 5KTYA 1SVOA 4LHXA 3TMKA 5L3RA 3QIAA 2YWFA 2A78A 2ATVA 2ZRHA 3MUFA 4B48A 4A8JC 1P2UA 2IA5A 3KL4A 4X8LA 2OBLA 4ZKEA 3ADBA 3CCLB 1VQMB 4CT5A 4GOJA 1NLFA 2ECKA 2GZHA 1H8ED 2VIIA 4M4SA 4V02A 4DQKA 4LPSA 2K5UA 1Q12A 1W46A 4YDSA 2OO7A 1SXJB 1A82A 1QHGA 2AFIE 3FTQA 4HUQB 2D2EA 5FTNA 2NOAA 3O47A 3T35A 2B8TA 3C15C 2C04A 4MKGA 4Q1CA 4DBLC 4P4SA 2BM0A 4Q7LA 3SEAA 4W9MC 1CS4C 2Z4RA 3A8TA 1KSJA 2D06A 2NO7A 1G7SA 3A4MA 3W6PA 4AKIA 4YMVA 2YHSA 4JS0A 1NVVR 4P31A 3M1IA 4YMUA 3WYFA 4DSNA 4LV6A 4QBHA 4PC1A 3VNVA 5JWRA 3KTAA 2JLUA 3CC2B 1Q44A 2OM2A 4WZBE 3WP0A 2L0XA 5KNCA 1V5WA 3MD0A 1IY0A 2HMAA 3BERA 1OV4A 4A6XA 4DHEA 3K9HA 3K0FB 4QBFA 3W5IA 2PX0A 1OLOA 4Q4LA 4BEJA 1II8B 2RC6A 5ANRB 5DI3B 5KUTA 4DIEA 5C2JB 4IVQA 1N25A 4EPWA 1DG3A 4LJ8A 1R8QA 1AS3A 2IBMA 1XTSA 2CE2X 3IPXA 4DXAA 2W83A 1QGZA 4N1AA 2ORIA 1WA5A 2BKEA 1K8AD 2FFAA 4LHZA 1EESA 4YHBA 4F4JA 1YHQB 4RKEA 2AR7A 2D7CA 3EZ9A 1I4DD 1CR0A 1ZAKA 4FXPA 2W2TA 2WWXA 2EQBA 2VP9A 2V6JA 3NDPA 1EP2B 1D2NA 3LX8A 1L4YA 3EZ6A 3KJEA 5CB6A 3NC0C 1KIMA 1G41A 1E2MA 2C99A 2QP9X 1E2QA 5FBVB 3QEOA 4B3FX 1FL9A 2WV9A 3AQ4A 1E2JA 1II8A 1SHKA 3FKSA 4R7ZA 2WPDA 4ZDKA 1K8RA 1WXQA 2Q9BA 2XNDA 1UEJA 3W6NA 1IOZA 1E64A 5L8VA 4C9BA 5JSZA 4WQMA 1JJ2B 2JCSA 2ZUBA 4N3NA 2OT3B 3BGWA 2A3RA 1YR7A 1VG1A 2ZPTX 4U00A 5DSZA 2DB3A 1GKUB 1PVOA 3AP3A 3L82B 4BLRA 4BZXA 2XNSA 3I8SA 4KU4A 2B8WA 4Z8YA 2WWHA 3KQHA 1TTTA 3THWA 4Q7KA 2PEYA 1ZUHA 1W2BB 1SVMA 3THOA 5AN9A 3ZIAD 4FI3C 1JPJA 3REGA 2QTVB 2PT5A 4QJ3A 3FFAA 5EUQB 2QTLA 3AM1A 3H1TA 3SN6A 4Q4AA 1NMZA 4P4SB 4MGYR 3PEUA 4MUAA 1RKBA 1T0HB 4D82A 2ZYVX 2WAYA 2CJWB 1H65A 2X77A 1E2DA 2QMEA 2VHQA 5KSPA 4DSUA 3LXXA 5FFMA 5KDDA 1GTVA 2EYQA 4Q4JB 4C0HA 3NWJA 3RNLA 2AD5A 5CK5A 4MRVA 2CLSA 4NYJQ 4Q4HB 3T15A 3KKNA 1S3GA 2R6HA 3TLXA 1I4LD 2ZAMA 1YKSA 3PEYA 3LVRE 3OFNA 1ZBDA 1VQKB 5ELXA 2ZI9A 4XVQA 3RRNA 2WMNB 2KE5A 1K9MD 4BFXA 3A4NA 1VCNA 4XOIA 2H57A 4BFUA 2RMKA 3Q72A 1CU1A 2GK6A 2KBEA 3E1SA 3DMDA 1AA9A 2DYKA 3DEFA 4N0EA 5TARA 1XCGB 2IK8A 1XPRA 5EZ6B 5TB5A 1VCMA 2ZRCA 1NMXA 1U0LA 2ZEJA 2VNIA 2ZI5A 1SVLA 1MO3A 4HAUA 5C46F 4DCUA 3M0EA 1R5NA 2PZFA 4B35A 4O2LA 1FQJA 3GLFB 2EFGA 2H7VA 3MFYA 4KYUA 1K5GA 5P21A 2PX3A 3EXAA 4C30A 5FUWA 4II7A 4PANA 4DT1A 2P6RA 5JEDA 5JJKA 1QRAA 3DM5A 2C9CA 4IDHA 1OH7A 1GRNA 1DARA 4Y9UA 2AWOA 2JEOA 3MMPA 2XNJA 3OJWA 5TDHA 4KLNA 4DSTA 3RS4A 2BC9A 2BN4A 3NIBA 4DRZA 1HY3A 2CL0X 1FPMA 1VCOA 2JDID 2VF8A 1NJFA 2V55B 2VNKA 1ZNYA 4UKDA 3T1OA 3LA6A 2XITA 2F1RA 1OT3A 2GJAA 3TJZA 1BX1A 1AKYA 4Q5IA 4A36A 2XEXA 2KI5A 2DFLA 3OIUA 2EFDB 3JQRA 3QF4A 4JLOA 3LO8A 3VO1A 2DBYA 4A4DA 4CRWB 4DDTA 3QPVA 1G3MA 1U9IC 3DPUA 3DL0A 3ZYCA 4US2R 2ZANA 3N2IA 4PSKA 3BK7A 5DH9A 4URVR 4M1KA 5AJXA 3SHWA 4BFZA 1EX6A 3X1WA 1D8TA 3U7EB 3BJIC 4UQOA 5LBIA 2BHRA 5JS7A 1S96A 1E62A 1U99A 4ARZA 1W87A 3U7FB 1HURA 4P32A 4D0GA 3OIWA 2J59A 1J8YF 2JIZD 4EPVA 5J4YA 5EP1A 5FL7D 5J4LA 3QQ5A 1KAOA 1P61B 2DWOA 3AKDA 3TSOA 2DEUA 3I4LA 3OJXA 4Q18A 4YAOA 4BECA 1ZD9A 1VQ6B 1DAHA 3HYTA 4EDHA 4DLTA 4YONB 1J99A 2JLQA 4A0HA 1ESNA 2O0JA 4DUGD 1MKYA 4RCYA 1ZCBA 3IBGA 4HI0E 3PFIA 4KV9A 1W5SA 3LQRA 3SYNA 5HXBA 3CCQB 1P73A 1JA0A 2F3RA 3KKOA 3W3ZB 2FNAA 5LB2A 1UM8A 2W0MA 2ZSEA 3E1YE 2FV8A 4I1OA 5AK0A 4G5RA 3L0SA 3GJXC 2G9NA 3ICQB 1IJEA 2A5FA 3D7MA 3PR1A 4FCTA 4NL4H 1GVNB 3W8NA 1G4AE 3E70C 2WBLC 4BUJA 2OTLB 1NN1A 4EIWA 1RE0A 2W6ID 2YOGA 5AUQA 4FW9A 4C0QC 3DZDA 4RCZA 4CVNA 3LLUA 2P0EA 3OZXA 2IUTA 3FYHA 1EP3B 2QQEA 4KITB 2IYQA 2ZS7A 2C9YA 4BFWA 2UVQA 5FI1B 3RVBA 4BLQA 3EIQA 5L3QB 4XVUA 1NBME 1XEXA 4QRHA 1CRPA 4JLDA 4E07A 4JSYA 1Z0JA 4POAA 3SR0A 1XMJA 3LX5A 1HTWA 4KFTA 3ZC3A 2RH5A 2VSOA 2ZSDA 3TVDA 3I56B 5JHHB 1ZM3A 4GZMA 1U8ZA 3UMSA 1OH5A 1LVGA 3A1VA 1DAFA 4LYFA 4M53A 4TTQA 1BIFA 3MWJA 1YR9A 1RW4A 3W2GA 2F43B 621PA 4LC1A 2CNWA 5HKKD 3THXB 1SXJD 5L3VA 5KOYA 1UBCA 4M2LA 1PLJA 3R7WA 3KB1A 4RZ3A 4CEJB 3CW2A 2J0SA 1NIJA 4BRWA 2D2FA 5CYOA 1DBSA 2GXSA 2BCJQ 1TPZA 2QMOA 5LD2B 2O8CB 3B1XA 3CPJB 1BYUA 4O0MA 1S1CA 5DHAA 1EWQA 4JL5A 5DE3A 3T1QA 2ZRIA 1Z0KA 4MUBA 1R4AA 3MWLA 4PSVA 3DZ8A 5J5CA 1S9HA 2QORA 3U5ZB 2YWGA 4JL6A 1HQYE 1FUKA 3QKTA 2HYIC 3W90A 4LBWA 3B82A 1NLYA 2QTHA 3AUYA 2FEMA 5H8WA 1JECA 5GJCA 3CF0A 3AF4A 4OL0A 3FHCB 2PL3A 1Z3IX 5GV7A 1UJ2A 1T5LA 2C2HA 4PAQA 2GILA 4V0KA 1OYYA 1X3SA 2OV2A 4DQLA 3HPRA 4TQAA 1VECA 2OZEA 2QMUA 3RS2A 3LAWA 4PSAA 4R2IA 4OKSA 3K09C 4ZI3A 1E0SA 1Q3HA 4MGZR 4EJSA 1E9RA 2H16A 3LQQA 3O8DA 4M9QA 2ATXA 1QG0A 2CVHA 1EFRA 5G53C 1CJKC 2GKSA 2MSCB 5IT5A 4QGHA 2NQ2C 5GJBA 1KK1A 3ND8A 2GXUA 3CNNA 3S1AA 1YR6A 4G1BA 5A4JA 4U5XA 1CTQA 1K5DA 1GNRA 1XTIA 2R6DA 2A30A 5K8IA 1XMVA 1U90A 1W4CA 2BGIA 1E9EA 2OXRA 5FH9A 4G01B 1E4VA 2D62A 2VSXA 1KI3A 1U8YA 2BBSA 2HDNB 3A6PC 2KWIA 1DAKA 4BQSA 3OE7D 3RSLA 4F7WA 4DCSA 1GRQA 2J0UB 4QGGA 4NBSA 1B23P 1ZD8A 3DM9B 3X2SA 3CF6R 2WSSD 2QP3A 4NHOA 2IYXA 4IOJA 2O8CA 3QE0A 2JDIA 1COWD 3Q7PA 4GDFA 1M7HA 4CW7A 1DELA 1P60A 1KSFX 3R7WB 1E3MA 3WXMA 2O8EB 3TRFA 2JAQA 4CEIB 1VQ8B 3WY9A 4IXMA 3P27A 3LO5A 2ZQ5A 2F43A 3I92A 4TLEA 1KAGA 1WQ1R 1TQ2A 1B2RA 5J4VA 3ZH9B 3SYLA 4GFDA 2ZJBA 3VR5A 3K0CA 3K53A 4M1MA 1E0AA 1LNZA 4ACBA 1ZIOA 3I5XA 3KQUA 3UMRA 3P26A 2W6JA 5CIWA 3TW8B 4GNKA 4A2QA 1W0JA 4ZV4A 2AXPA 1AS2A 4IVPA 4TMXA 2ZRGA 4I1VA 4HE6A 1D9XA 2QRZA 4HUTA 3A1TA 3FJOA 4OK6A 2JLYA 5H70A 1FOEB 1RFLA 2FU5C 2QAGA 1G9XA 4Q01A 4CDGA 3I62A 1ZM2A 2E1RA 3BE4A 4KBGA 1E2EA 2YYZA 3ZBUA 4B3GA 1IN6A 3KXKA 1TAGA 3TK1A 1DEKA 2HT6A 3A1SA 1FTNA 1VYTA 5FTKA 4Q21A 4XD7A 1OJLA 1XTKA 1OXVA 2CHVA 5JHGB 2NG1A 4WBSA 1JB1A 3K0AA 1XXHA 4LZZA 1XEWX 4MKHA 3CLVA 1YRAA 1TMKA 3ZVLA 2ZJ2A 1E2FA 4PO1A 1VMAA 1UDXA 3GLHB 1E4YA 4EQ6B 1LF5A 1KZ7B 1BH2A 5FPYA 1DDGA 3ZD7A 3PUZA 3H0KA 4IFEA 2FPKA 3CRQA 4N3GA 2I1QA 1T8TA 1ZIPA 3D3QA 4TL9A 4B74A 1W34A 2Z83A 4NH0A 1NN5A 1E2NA 2GRJA 3ADKA 1E63A 2OSBA 1BQEA 3GJ8A 4Q47A 1QUFA 3VR4A 4EPRA 1PLKA 4G5QA 1P9NA 1M7GA 1KJWA 2JJ2A 3AUXA 4IJMA 4PQYA 3SQWA 2BCGY 3OHMA 5BXQC 1NNEA 1R5OA 1EK0A 4ARZB 1F20A 3CF2A 2RGBA 2V4ZA 3NKVA 5E4FA 1VIYA 3L2OB 1AZTA 4LJYA 4P33A 5CJ2A 3TVTA 2ZJ8A 3C5CA 5CLLA 1W0KA 3CCRB 1G8GA 5IF9A 4KSCA 5LDDC 4TT3D 1EFCA 2GQFA 3ZS8A 3VX3A 1NRJB 4DLVA 3AVWA 2QY9A 2IHBA 3GCGA 3ZVNA 1RYFA 1VDZA 3LDAA 5FTLA 5SZJA 4GI7A 3SBDA 2VNJA 3FKQA 2J0VA 3RLFA 3SFVA 3BC1A 1JAIA 1P4SA 2XOKD 3UIEA 3ZVMA 2VP4A 2OAQ1 3CRRA 1UKZA 3QXJA 1YE8A 2D4HA 2IUSA 2FSHA 3CZPA 2QPTA 4O25A 2CNWD 4DLWA 5DYIA 4YAUA 3PITA 3QY0A 4HSEA 2PZGA 4LYJA 4Q66C 1IN7A 1UAAA 2XXAB 1E2GA 4EUNA 1G21E 1M74A 1N6NA 4DB4A 2FDCA 1MOZA 5CJPA 3TUIC 1G18A 5JJIA 4DT1B 4TTPA 3BB4A 4LJ9A 1S1MA 2FSIA 2PH1A 4PQFA 4LV8B 2V8OA 4LSGA 3WNCA 2ZIAA 3RC8A 2CK3D 4QHTA 2IUUA 5KU1A 1G7TA 1Q82D 3C16C 5JEEA 1GAQA 1YVDA 5DO9A 3ZIAA 4U02A 3IKJA 2HCJB 2ERXA 3K1JA 1W4AA 4DDWA 3C5HA 2FGKA 4EJSC 2ZI6A 1W35A 2PMDA 3LVBA 3U6BA 1GAJA 4JBXA 4OJKA 1KMHB 2G77B 4YALA 3Q85A 4DB2A 1DAGA 1EFTA 2GXQA 4FD2A 5EXXA 3W9YA 1A2KC 1RRFA 1NVVQ 2FFBA 2Q21A 2ZYTX 4IEEA 5D3QA 5FPSA 1CIPA 2ONJA 4MDFA 1QF9A 2RCNA 1M2OB 1Q3TA 5FL3A 4V0LA 1ZD1A 1YJ9B 2HXYA 3FKSD 4YXWA 2IF0A 4Q4JA 1W36C 1Z0DA 1HT2E 1NSTA 1TF2A 2GCNA 3LWNA 3QG1A 4L4UA 4Q7MB 3CPWB 4HLDA 5JS8A 1OFHA 2GJ9A 3MWYW 4PZZA 2IEYA 2VP2A 1ZNXA 5EMNA 2F1JA 5FPHA 1QHYA 3OZWA 3B13B 4Q19A 5AJZA 2EVWX 1XEWY 3W5HA 2FG5A 3VR6A 2AWNA 4AD8A 3UWKA 2MSEB 2BM1A 1Q22A 2ZSAA 4KSBA 3AKCA 1QHNA 4A92A 1VQ4B 4F4IA 2ZU0C 4JVNA 2RGXA 3THWB 4Q03A 2GDJA 3EPJA 3JQPA 2QPAA 2ZRJA 1U2RA 2CHGA 3C14C 4Y0AA 5HPYB 3CRZA 2QEXB 2LWIA 5IK2D 2IS2A 3C8UA 3LBIA 4URUR 4QJ5A 3NG1A 4BWYA 3QJYA 3AVVA 5TVKA 1JBKA 2ODWA 4YAWA 3W2FA 2XX3A 4IKEA 4P3YA 4LJ7A 3BB3A 1WF3A 1OGIA 4PC2A 2OEPA 1RRPA 3LRPA 3U3JA 5C18A 4BZQA 2H18A 2H8KA 2B5OA 3QKSB 3MHPA 1YRBA 3W2IA 3W5VA 2ZETA 3G82C 3H86A 5G40A 4YMSA 1VIAA 3IEUA 3N70A 1N6OA 3FHTA 3EC1A 3AVYA 1OH6A 3CCEB 1D2MA 4LCBA 5EE1A 2N46A 1IN4A 1OKKD 3AF1A 1IQPA 3EWAA 2O5VA 3CX8A 3C7KA 1E2PA 3UWOA 4Q02A 3CUEF 1BO6A 2O0HA 2ZYUX 5C4GB 1KI6A 2FPMA 2ZVQX 1KO4A 1J8MF 2PZEA 1NBMA 1Q1BA 4PAMA 4BFVA 2XXAA 1CRQA 4TN1A 1Q1QA 1G8PA 1QHSA 2C9OA 1P2VA 5DHFA 1KQSB 1TU4A 1W1WA 3FPAA 4G3XA 5BQ5A 3R9XA 1E99A 1BKDR 1KI4A 4C2TA 1T6NA 4DLRA 4DCVA 4LJ4A 3H4MA 3BFVA 5JRJA 1JXMA 3P1JA 2HT1A 3CCSB 2D3WA 2QAGC 2ZITA 2EYUA 2OLJA 1PLLA 3LY5A 2MMGA 1P5ZB 2BJWA 2ERYA 2IXFA 3KTAB 4EAQA 3KZ1E 4DDVA 1QFJA 2QPOA 2ZRAA 3FDIA 4CF7A 5LPNA 1AM4D 2QG6A 1GG2A 3CX7A 4OHXA 3W34A 2IYRA 3EWSA 5J4KA 2X1VA 3AKYA 3CNLA 1GILA 2A2ZA 3ZZUA 1N6RA 2FMXA 3ZQ6A 4JSTA 2FFQA 2JLRA 3GLHE 5KSOA 4TSFD 1KC8D 1A1VA 2R44A 3CRW1 4Q9KA 1CEEA 4PC7A 2BF4A 5GVRA 3EA5A 4M22A 4V03A 3GQBA 1Z83A 4W5HA 2C77A 2AK2A 4HB4A 4HUQA 4OHYA 3Q5DA 4IEIA 4NCHA 3RRYA 2VTKA 4IOLA 2AD1A 3BH0A 3EZFA 4C43A 4NPHA 1EFRD 2PLFA 4HB0A 3SHFA 1FP7A 2GPJA 3Q8XB 4KO8A 4ZI2A 2R8RA 1AMOA 4LC0A 3AGPA 2PCLA 1T8UA 3NBYC 4WIAA 3I73A 121PA 2RGNC 5FUVA 1W4BA 3GLHA 4LYHA 1YZUA 2G0TA 1MRSA 1VYVA 5JECA 2CE7A 4C2UA 4HAVA 2XNCA 1YU9A 5E95A 2SHKA 4BEBA 3WNDA 1FUUA 1OH8A 3AV0B 1HH4A 2OCPA 3GJ3A 4WXRA 1WE2A 4HYYA 1LY1A 1G1MA 3ONWA 5BYJA 3DOEA 4UNPA 2IYWA 1DAMA 1ZW6A 4GOXA 4NE2A 3WYAA 3ZS9A 2WWIA 1VQNB 2EWVA 3UATA 3Q9LA 2GF0A 2OESA 1EGAA 5H5JA 1W4RA 3BAFA 2X2FA 3CNOA 4Q00A 3TH5A 2CCGA 2HLDD 4PPFA 3X1DA 3IBYA 2ZS9A 1S9DA 3QPWA 2FX3A 3R8CA 4WAUA 2QZ4A 1TF7A 1N0VC 2HF8A 2IXEA 3GD7A 2H17A 3QKUA 1WP9A 1T0JB 1OSNA 4R2HA 1ZNWA 2B92A 3BD9A 2NO1A 6Q21A 3EPKA 1KK2A 2CXXA 4IFBA 3T1VA 3B1VA 3ETLA 4DC9A 2FF7A 4JYCA 2QUZA 3CWZA 4RD2A 1N6HA 4URXR 1LV7A 4TL8A 4MH0R 1GNPA 4CZ2A 5HZHA 2NO0A 2NTYC 1OXXK 2O52A 4XD7D 5EE9A 2O8EA 2FPLA 3NXSA 3MWKA 5D3MA 2ZRBA 4FN5A 3IQWA 4PO9A 3F8TA 1GIAA 3D6TB 3QF7A 2ZXUA 2YC4C 1UMKA 2VYQA 3T1TA 1R2QA 2YVUA 3A36A 3CKLA 3B7GA 3MGCA 5BN5A 3M6AA 5F3WB 3TQCA 1YZNA 4B76A 1VQ9B 1JB9A 1XFAA 4BFSA 4RD0A 1KJYA 1OFIA 1GNQA 2VRWA 4ERNA 3ADDA 3F0TA 2IYUA 1GKYA 3KXIA 2ZE5A 2X2EA 2WKQA 4A1FA 1YI2B 1W7AA 3ASYA 421PA 4CIDA 3RS5A 4HZIA 2E9SA 3BIFA 3ZLJA 2Z0MA 3U44B 3KKPA 3EPHA 3GLGA 1NKSA 3U6KA 4TMTA 4FK8A 5DI9A 3THYB 1MR3F 1KDOA 2QAJA 1N0UA 4YAFA 2F1HA 3PCRB 1KRHA 4ZGQB 3AP2A 3PUVA 4URYR 3I1FA 2YNMA 3PIRA 4PZYA 4URZR 2IWHA 4D4KA 3WBJA 1NVXQ 1GSIA 2GAAA 3U4QB 4LV5B 2J46A 1XD2B 1OFUX 1E9DA 3C4JA 4B34A 4F92B 3BRWD 3IDQA 2WSSA 4KFRA 1XB2A 1FDRA 3EZ7A 2QM7A 4KBFA 3VHXA 2BBOA 2AXNA 3CMEB 1M8PA 1SULA 1B0UA 3B78A 1W44A 5JWHA 4TYYA 4RZUA 2QMHA 3R9IA 4IW3B 2E87A 2HF9A 1VQPB 1YJNB 4K8OA 3VKHA 3QKRB 3B1YA 2IYTA 4AWXA 4LK2A 1Z6TA 3NDBB 2CVFA 4LYAA 2WWFA 2ODNA 5TV2A 3AKEA 3IO5A 1KO8A 1SKQA 2BJVA 5IK2A 1G3RA 4BPBA 4NZYA 5FA6A 4HAZA 4L9SA 4F4CA 4QBGB 5JLJA 4ZIRB 1OE0A 1ZU5A 2PEZA 4G0NA 3IO3A 1P9WA 3PEVA 4B71A 2WWWA 4BE7B 2DCUA 1ODFA 2WHXA 4GRAA 2XZLA 1ZM4A 1R5BA 1N2CE 3VR1A 4TZ6A 2AX4A 1ZM9A 5SZHB 4OHVA 1DO0A 1G19A 2GNOA 2J87A 2FWRA 2O8BB 4Z51A 1KNQA 1I2MA 4JJZA 4UNNA 4V0OA 3CPEA 2VYFA 3KKMA 4CEJA 3K0CC 2ANCA 1KK0A 1XD9A 4DDUA 4E03A 3E2IA 2HUPA 1GZSA 1LB1B 3K70B 4M9XA 1VQLB 1TX4B 4QXAA 1E69A 4YXWD 1Z6AA 1R0YA 4ZIRA 2DWPA 2A7QA 2Z6VA 4TLAA 3RRMA 3I5YA 4X8HA 1CJTC 4LHWA 4C7OA 4NONA 1AKEA 2QROA 4OHWA 3DKPA 2NZJA 1XEXB 1FQKA 1VYUA 5JI3E 2F6RA 1YIJB 3HU3A 4MKIA 4MGKR 2P65A 3ECCA 3UMFA 5CITA 1CF4A 2R65A 3QKRA 4M1TA 3RDPA 1N5LA 1CR2A 3B5JA 4V0ME 1KGDA 3AVQA 2ZROA 3SJBA 3AVTA 3GP8A 4D25A 1Z08A 4A0FA 3AF0A 4GMDA 3QXXA 3ZVRA 2FH5B 3FHOA 2RKOA 4XSHA 2CK3A 1X1SA 3L0OA 2Q3HA 1XDBA 1E9AA 1E98A 4ZCIA 1XD2A 4B47A 3U4QA 4RD4A 5BWMA 2GEUA 4M9SA 1W47A 2QT0A 2QGZA 1Z0IA 4ABYA 3KFVA 1Q1ZA 1XPOA 1W5TA 1QH0A 3THYA 1GL7A 1SXJC 4US1R 3GPLA 3AVPA 4W5JA 4L8GA 1Z47A 1U0HC 3ZD6A 1G3UA 1GOTA 4DLUA 5A5GA 4X8OA 3CCUB 4Z8XA 2ZRMA 2X8AA 1XTJA 2ZVPX 4BZPA 1FNBA 3CCJB 1DVRA 1IAQA 2RHDA 4GPTA 4XWOA 3W5UA 1X6VA 4DVGA 2GCOA 2FSGA 4XIGS 2WOJA 4I81A 3BH6A 1QVFB 2ZE7A 3NEYA 3QXSA 5M04A 2O8DA 3JZAA 4QBIA 2ZRLA 1CJVC 3SNHA 5L3SB 1QVGB 2GEVA 4TYWA 1C4OA 3BS4A 5F2EA 2AL7A 3EASA 4AF7A 1BS1A 4CT4B 3RYTC 1US8B 3NBXX 2IS6A 1CBUA 1LFDB 3H2YA 4W7SA 2X3UA 1QG2A 1UBGA 2V54A 3WMEA 1GDDA 2MSDB 2WJYA 5EP2A 1M90D 3UG6A 5THXA 2WJIA 4QM6A 4H9GA 1D2EA 5F98A 2C78A 3OEEA 3B9PA 4F93B 4TYNA 1ZU4A 4A9AA 4HE5A 3M4YA 1SQ5A 2EIXA 3VHLB 1QX4A 3O8BA 1ZJ6A 4IDPA 2EWWA 1XTQA 4M9ZA 3GFOA 1MABA 4ILEA 2I4IA 3UG7A 1OF1A 1GL9B 5IRCD 4A82A 2GHIA 5FTMA 2CCJA 2VZLA 4HB2A 1NMYA 2O0KA 2AN9A 4P0TA 3IQXA 3GLFA 3G0HA 4ZO4A 3AB3A 4B2IA 1RRGA 4LOAA 5FUXA 2W00A 3IGFA 4UJ5A 2WJJA 2GCPA 2VLIA 4WW0A 2RGDA 1TUEA 1JQJC 3EIEA 4FMBB 4JKYA 3HU2A 1NI3A 3BFKA 2P6UA 3OIYA 4E22A 5B64A 2VHTA 4NCKA 1QGYA 2YINC 4B3BA 5F9HA 4JLJA 1VPLA 8OHMA 4Q4HA 5FOXA 1JI0A 4Q9IA 4OHZA 1N5KA 5G3YA 3EG5A 4AYWA 1OYWA 5EE3A 3OW2B 4TQ9A 4GSYA 3TUZC 2ZI7A 3WNBA 1Z6YA 4NDZA 1Z0AA 2YZ2A 1DOAA 3NC1C 2CJWA 2VHJA 3N5CA 4PX9A 2I1VB 5HTKA 1OW3B 2ZYWX 4MDEA 4DKXA 1RYHA 3LFUA 2RB4A 4M0LA 2R62A 2ZRDA 3T12A 2BPOA 3HYRA 1D9ZA 4Q9HA 2J0QA 2NIPA 2UZ3A 3GLIB 2GWHA 3RSOA 1GO2A 2P2LA 2G0NA 2ANBA 2NGRA
chains in the Genus database with same CATH superfamily
1JHZA 1QV6A 2Y1LA 3AX6A 5K2OA 4X1OA 3VHQA 3AGQA 5CDFA 2FOLA 2IITA 3F4KA 3KXLA 2I3DA 2GKOA 5G2OA 4WX2B 3NH9A 4QDTA 3OTWA 1L5KA 2QTFA 3A37A 1RI5A 1Y5RA 1ZN2A 10MHA 1HVXA 4EGJA 3MUEA 2GDZA 4DUZB 4PZUA 3W9BA 3EGXA 3H8VA 3Q1LA 2UYGA 4X93A 3C3XA 2ONKA 3I1JA 5JS6A 2R8OA 1M6NA 3SYRA 3NH6A 4QYWA 1GUAA 2OV6A 5TVGA 1NRKA 4RAQA 4X8IA 4JXKA 4UEJA 1GDTA 4AF6A 2VDVE 3R5JA 1E2KA 1QLHA 2F3UA 3E3LA 4ND4A 1V5EA 2CNKA 5LLSA 4TUYA 3TNFA 2GNAA 2QIPA 1B6TA 1BOOA 2QT1A 4U2FA 4F91B 3FGZA 5EINA 1S3IA 1QCZA 1UMCA 1I5RA 1F6BA 2NZ8A 2AKAB 4DAOA 1FQWA 4Q3EA 5CDUA 3HK2A 2A5GA 2UZIR 3PS9A 2EQ5A 4JI6B 2RDMA 5ERYA 4DMHA 1TUGA 2J7KA 4PPYA 4BASA 1HNNA 1P91A 5ECDA 4YUAA 2I78A 2D2VA 4C0SA 4CPDA 3PI6A 3EGXB 1KS2A 4X95A 4LWZA 4B2LA 4JT9A 4WH0A 1SU7A 2FUCA 1G3IA 1NP3A 2I2XB 4FHFA 4TX1A 4GZ3A 4X61A 3ROKA 4V2IA 3PLAE 1U8UA 1I1HA 2VK1A 4FFBB 4HG2A 4DNXA 1OIWA 2EJVA 4CUJA 1IZ0A 1QP4A 4WWHA 5JSHA 1CS0A 5M34A 4JXZA 2NO9A 2P7HA 3CTMA 2DTXA 2PKXA 4P5EA 4NK5A 2ZWVA 5AUPB 1LV8A 3QEBZ 4WTOA 1DO8A 4JBWA 5T5QA 1J49A 3WKBA 2HHHB 1HV8A 3I0MA 1KSGA 5JD4A 3DAOA 3GLIA 1GAXA 3RD5A 4YJFA 4IHQA 3DBLB 1UBEA 2V9PA 3Q0EA 3E22B 5BXYA 2PL1A 2PV7A 3HDTA 1NPTO 3DWIA 4RYLA 2BDEA 3T3DA 4ZJPA 3GA5A 4BKQA 5CYPA 1YZTA 3PWKA 5CNKA 2RG7A 4K46A 3VMFA 1YZYA 2P4UA 3VUEA 4NTZA 2WTBA 4E1BA 1J1ZA 1JSRA 3B7PA 3RIYA 1T36A 2WD8A 2JVIA 2GJ4A 1IHXA 5F4JA 4IV0A 2XH8A 1WLSA 1WOYA 4LMRA 4NZPA 2WJGA 3M1AA 4XVRA 5BY2A 4TZ0A 3AP1A 2Q41A 2IYVA 2EEPA 3PGLA 4BO8A 3CR8A 3LE8A 4NCIA 1QH1A 4Y2TA 2JCXA 4LI0A 8MHTA 1WMAA 2WIAA 4LVNA 1AGXA 4MRPA 4NYJR 2YWCA 5AJWA 4B2YA 2OKGA 4K9OA 2A35A 3P4YA 3NHRA 1AQUA 2ZXIA 4OATA 1V0JA 2FWIA 2HNBA 1DKUA 2F8MA 3L92A 5KI6A 1U7UA 1RHJA 4GYYA 2J7PD 1ABFA 4OMUA 1PYGA 1Y9EA 1W6UA 2G8NA 2RI1A 4U2CA 5E7QA 1XFDA 1DG9A 5SV2A 3DCJA 2QJTA 2VSFA 4ZAVA 3GCXA 1LA2A 1NA5A 1OIVA 1WMBA 3KT6A 4OL9A 4RK7A 4U7DA 1O96A 3I6ZA 2W6IA 2OAP1 5ALJA 2P6OA 1MHTA 2X6WA 1AQ6A 1SVUA 3L4BC 2ZJAA 3UICA 3HJAA 1G2QA 2OCGA 1PKEA 2ONZA 2QTRA 4Y2UA 5EIOA 2IH2A 4CEHB 3L6EA 1FB5A 4IM7A 3ESZA 3UBTA 4KLCA 5HIMA 2V6MA 4ZP1A 4ZAYA 4BO9A 4YTEA 1AK2A 1UD2A 1UM9A 1WVIA 1GA6A 2R86A 2P6MA 2XCQA 1BXZA 3NHZA 3WGTA 5IAAA 1K73D 4CG0A 5T67A 4KUGA 3U0BA 3LW7A 3LW8A 2IY8A 2VPQA 3QSYA 2AJTA 1NXXA 5EJFA 5ADUS 3FPPA 1L8XA 3WGUA 3A26A 1TJPB 3DL4A 3OLQA 4MYDA 4YGXB 3UJPA 3DQZA 2X5OA 4ASUD 4ZT2A 1GPYA 2OBXA 2X58A 2RJ3A 2AG8A 3B3QA 3N2KA 1E9CA 1J0AA 1E94E 4Q16A 1CY7A 5L4NA 4IMIB 3EGDB 1EU1A 2D8AA 2IYNA 4IINA 2O54A 3J81k 4U0JA 4A2CA 4DMFA 1Z06A 1K4YA 4AKGA 3KEOA 4EYGA 2PXCA 1VCIA 3CURA 3QEMA 4LEIA 4UHBA 5ALNA 3RK0A 4AJ9A 3WRYA 1OLUB 3L0PA 1VCHA 1V1JA 3DQQA 3I28A 4HNAB 7MDHA 2AMFA 4O02B 5I6DA 3C3BA 4ZCPA 1YIDA 2J4CA 4YHHB 2L82A 1ONPA 3F3YA 2H4HA 2BTQB 3IPYA 4GS5A 1N1GA 1M2EA 2XVYA 4RTJA 4JJ4A 5ALSA 3JQQA 1MRNA 3C3MA 4IGAA 1QPGA 3INYA 3G8DA 2QN2A 1UODA 3DCNA 3H5LA 3PV0A 5FBQB 3RWBA 2V59A 4AZ0B 2JJ1A 4QE3A 4WK0B 1C9YA 2OR3A 4IHJA 4D8TA 2CKDA 5JY6A 4MJ3A 4B75A 3JQ8A 3AFNA 4QDOA 2G6TA 4K2AA 4QWMA 2B4TO 1G5TA 4GZLA 1KPIA 5HM8A 2IIVA 4ZZ0A 2GFHA 1BJTA 2F9MA 2P1ZA 3C39A 4OOXA 3IQEA 3PUWA 3U9LA 3A1EA 3FNFA 3UK7A 3VR5D 2KJQA 1XVIA 3W0LB 1HQDA 5KYTA 2ZB3A 2JJQA 3SLGA 4WCDA 1XXHB 4HN4B 5A3JA 4KOEC 4FMCF 3NBAA 1N8RD 3ES9A 3LUDA 3KR1A 4MYSA 2I8CA 3KZOA 1JR4A 3N0RA 3NHPA 1E89A 4BP8A 3HRHA 3L6RA 1XOIA 2BIFA 3KM0A 5HZAA 4JQSA 1BEZA 1FTWA 1YOVA 4YI5A 5FADA 4ZDJA 1DPGA 2GHTA 4KDEA 4F4FA 4DCNA 4JA2A 4COKA 2C9ZA 4LBYA 1KZGB 3EYWA 1MAUA 3V6LA 1VPWA 1PGQA 2O2HA 3FRIA 1V11A 1EQUA 1M6VB 1WXXA 3VO2A 2RK4A 4CGZA 1NG1A 2EGGA 3R0ZA 1M2HA 1TGYA 2BV3A 2BFEA 3CBQA 3LOQA 4CYMA 1CNEA 1V5FA 3MT9A 1J06A 3ON5A 3B1ZA 1RS0A 1C4WA 2XIQA 4JLKA 5GM2A 3V8NA 4FC7A 3ROFA 4MKFA 5INTA 3Q6MA 5MFZA 1X1RA 5LJIA 2CXUA 1ZP6A 3J81A 3BD6A 4JVLA 2ZAOA 3DB1A 4O2RA 3QE4A 3TSZA 2WV7A 1UDWA 3OPOA 3HADA 3SIPA 4QGFA 4BLOA 3SXJA 4Y6OA 5E7MA 5LZ2A 1A1SA 3EW7A 3IUYA 5IJ0A 2UVPA 3GFPA 4GKJB 1GZVA 1LI5A 3GCDA 3I61A 2WJAA 4A73A 3ND9A 3VPSA 4GUAA 4REOA 4WVFA 1PZNA 3D43A 4NNOA 5LYJB 3QTLA 1YTLA 2WE7A 4TKMA 4ZJUA 3NBZC 1BDBA 3GEGA 3KE9A 1M1ZA 2PUTA 4GVPA 4J9UE 4FJ2A 3WK4A 4BUCA 5EWJB 4R7TA 1YBMA 5A9SB 5KNBH 5H68A 4PAOA 3PEWA 1IRXA 1XZFA 1J20A 1IOWA 1Y9ZA 2V7XA 1DBIA 1KEEB 3TX2A 3ULKA 1G20E 3ASSA 1K28D 1QIFA 1KYVA 4YAGA 3RVRA 3GGCA 4KFCA 3EQ9A 3WE7A 1OOEA 1QONA 2H4YA 3H2ZA 1G55A 3LKDA 3U61B 2JGLA 3X1YA 2ES4A 3RFVA 3WNZA 1OWOA 4TWIA 5BWNA 1QQAA 2F3TA 1G66A 2REBA 5CRIA 1EHIA 3S40A 4ESHA 1M73E 2J9ZB 3V00A 2XD9A 3CXRA 3E81A 5BUSA 4L3OA 2BR5A 4GQIA 4RHXA 3BCSA 4KPEC 2I91A 3ENQA 2XCSB 4N01A 2OE2A 1SHZA 2VG8A 4EH1A 2V7PA 1G8FA 5FOSA 3UTCA 3KQPA 2HB6A 3MWDB 2PBRA 4F9EA 4BFYA 1XZCA 3CTAA 1JDVA 1HOXA 2A1TS 3COVA 4FINA 1A7UA 2NSLA 5J4HA 1C9EA 3G0BA 3HWSA 5EQTA 2ZZNA 3F3SA 1MH1A 2WYUA 2AN4A 3Q10A 1Z5ZA 4ITUA 5FD8A 1EIWA 3KIPA 4Z4UA 1N34B 5C53B 4LBVA 4GX1A 4WCFC 4LZLA 1VHJA 3S4YA 3SQDA 2AMVA 1IIBA 3W5JA 4A8TA 5JDCA 4BLWA 3UAYA 4RORA 1KQNA 3U1VA 4UVEA 1ZLYA 2DBRA 3IOMA 1NVWQ 3F9IA 4LMBA 3DE2X 5CH8A 5CT8A 1Z26A 1L7XA 2P9YA 4KQMA 4PONA 3K0EA 4OYLA 5D51S 5DN6D 1MC1A 4KI0A 1A9XB 5AM5A 3LVQE 3BH4A 2ZXEA 1BRTA 4XL9A 1Y8QB 1ZJJA 2X22A 4J1TC 4EFMA 3D8RA 3NBQA 1YXMA 5UKDA 4QT4A 1YBHA 4NCJA 4RGVA 5J2TF 3WKAA 1GCIA 3OCWA 4BWFB 5I4CA 4Z4GA 4X0CA 2DJ5A 4KR7A 3CXCB 13PKA 1KYIA 3ILHA 3ZTWA 1N8NA 1Q7BA 1UMDB 2NV0A 3VKWA 1RPTA 2X41A 1PTKA 4IRMA 1EB9A 2PL5A 3H1AA 4PVCA 2DULA 1JIUA 4UVGA 3TN7A 2PHZA 2V1UA 4W5NA 3MIZA 4B2PA 4EEXA 2EV9A 3JQAB 3TAHA 5A3QA 1AHIA 3R0XA 3KG2A 2CLMB 4ZVPA 4N5MA 3WSVA 1OI7A 4DWWA 4TMWA 3TIGA 1TMGE 3RPEA 5FR1A 3TR0A 1SQGA 1C5KA 3BGDA 2PX4A 4IF4A 4U7GA 3B1JA 1JDJA 1WPXA 4EHHA 5COBA 1N5JA 2O2GA 3SSAA 4B6GA 3SXUA 3OJEA 4MW4A 1EFHA 4UUAA 3A27A 3ITKA 2PGOA 2WM9B 4MCIA 4QUGA 2C54A 1Y6QA 5DBIA 4QLAA 1E6UA 3RY8A 2R1VA 3A9SA 3EGWA 4EEKA 1IXZA 4ZREA 1H05A 1BJKA 4LK3A 4P98A 4CF6A 1OKKA 1J2TA 3JQ7A 1YS2X 1UZAA 2BGRA 3HP1A 3NYIA 4WZBB 1J4AA 2IL1A 3EK2A 4LDQA 1H85A 4HWTA 2JRCA 5L3QA 4O0LA 3A8IA 1T4GA 1HEIA 5KWIA 1I2CA 4GMXA 2G1PA 3AVOA 4NOLA 4KXNA 2DPYA 1C0PA 1O3YA 2IHZA 4YMTA 1KXJA 3VPCA 5J58A 1SBYA 1JIVA 1T3LA 3Q6QA 5AFSA 3I39X 3EARA 2P41A 2CXQA 3E05A 3IUMA 2IHNA 4QOSA 1KZ9A 1VJCA 2HRDA 1OREA 2P2ZA 2VHUA 2O9JA 3H65A 3K6RA 2X15A 3NR2A 3LCMA 5AJVB 4RDJA 1VPVA 3FROA 2YJGA 3BXZA 1Z6GA 4TKUA 2BOVA 1I4TD 1LS1A 1EE1A 1WAMA 4BKRA 3NDJA 1U3DA 2C5FA 1DKLA 3FCAA 3SVTA 2P2GA 2X42A 2VXCA 1XTVA 3EY9A 1Q21A 3T7IA 3QI2A 1AU9A 4Q1FA 1CNFA 2AG5A 4MQEA 2P3QA 3PFCA 5EY5B 4UAJA 2VCYA 3HVIA 5G41A 3FDZA 3DHYA 1Q92A 5BSYA 3IIMA 2GLXA 4UJ3A 5E2BA 5AHKA 1FJHA 3SZMA 4D8VA 2EP8A 2QB5A 3PNYA 1V7QA 4X1IB 5C4MA 4OCZA 3MAJA 4D3FA 4E5SA 3TW4A 1Q7GA 2Q29A 3VKHA 1CUBA 4H7FA 3OPYB 2AJCA 1IU9A 4K86A 5IJZA 2H2HA 3DJYA 3PD7A 4XI9A 4DWJA 3GLGE 1U1DA 4BATA 4YDQA 3L79A 3TRKA 4B09A 4KYIB 2IUYA 3IIKA 3F6SA 3FNEA 3K8QA 5TQ2A 2VWGA 3DE0X 3KYCA 4KRXA 2X2PA 2JAUA 4IYRA 5FBRB 2XMPA 4BYMA 4PW0A 2OYRA 1YJ5A 1PJQA 3QQPA 5CGZA 3UK0A 4N6GA 5LOVA 5KMGB 2WKSA 1Z7YA 1ODLA 2G1JA 3OOCA 1PYDA 3AF5A 4H4DA 3TLZA 5E4JA 4AP6A 4B87A 4JLMA 5B57C 2XGSA 3ZV4A 1RWNA 3U4AA 4GOND 4DBLE 1Z2AA 1OIXA 2LCIA 2ORVA 5KX5B 4Y9RA 1C2YA 3EPLA 1RLTA 4NXMB 4P2NA 1DOZA 2IIBA 3I32A 3PYLA 5KJ6A 4RELA 3IAXA 4BQPA 2NVUB 3BSSA 3HI4A 3VFDA 2EU8A 5KCMA 3AY7A 5HJEA 3MJDA 1RXEA 4FMPA 5KYYA 4EKIA 4WZAE 2C7RA 4LF5B 3S81A 3OFND 4LUCA 1K6JA 3IR6A 3PQ6A 2UUAB 5CDGA 4FUTA 4PPNA 4B44A 4XQEA 3L0IB 1UP4A 4X65B 3N39C 3QV2A 5G0VA 4RPKA 1KP9A 3NTQA 5HJ5A 5KNLA 2DE0X 4HLNA 1ZIDA 2C5SA 2XCLA 3PNBA 3R0VA 2FZ4A 4MS1A 1OD6A 3TTVA 2ATIA 5KVSA 5KKNB 5TMPA 2J9RA 4B8ZA 3EF1A 3P0HA 5KTNA 4CEHA 2DR0A 1TXGA 3HBNA 5I7EA 3T5AA 4KKXB 1XJCA 3EUAA 1Z68A 1Y1PA 1U0JA 2HA3A 4G5XA 4DEXA 3AL0C 4NIMA 1NQ5A 1JEAA 2BHTA 1OI3A 1SEPA 1IBKB 3PFFA 5JAZA 2Y27A 1FIUA 4W4TA 2X14A 1JBEA 1GV1A 1ZJZA 2EZTA 5T4FA 3K8ZA 1TF5A 4PWYA 1FMTA 3I12A 3HN2A 4MMXB 4MR8B 4N3BA 2XXJA 5DIZA 4AMZA 1W9MA 5B2ZA 4DADA 4E46A 2CNDA 5DNYB 1YFLA 2BHLA 1NU6A 3D2BA 2DIEA 2Y1OA 4XFKA 5FNVA 3AFIA 5AWFC 3QLUC 2YJ6A 4DIBA 1L7RA 4W1PA 3M49A 5MFPA 1LWOA 4FFDA 1UC4B 2Q6TA 3ADCA 4DR5B 2ID4A 2Q1XA 5T4EA 5JZMA 2OFXA 4HFRA 4CR8A 4TS4A 2E5WA 2FLWA 1CIJA 3AI2A 1A76A 5CFOA 3ABQB 3IEPA 4YREA 1S2DA 5K0BA 3QUTA 2FWMX 4BJ1A 2WTNA 4U2EA 5IDVA 2DFNA 4LWOA 3IODA 4PRYA 4OI0A 4EL0A 1Y34E 1WUHS 1N2XA 3M33A 4YYEA 2YWDA 2H1LA 3Q7EA 4JZYA 5BP7A 3IL2A 4UTRA 4XQ9A 5TR9A 2YH2A 2ZT8A 4RLZA 1LD3A 2NU6B 2DR2A 2W98A 3BORA 4XGKA 5TEVA 1E1QA 2Y8EA 4FDAA 4UZSA 4PHHA 2EKQA 4G4JA 3IOYA 3DPIA 2O50A 1ATIA 2DRIA 4D1YA 2WHEA 4FMCB 3GA0A 4JITA 3L6DA 2P27A 1WG8A 3GY0A 2R47A 4YJFB 1ETHA 1Y1SA 1P75A 2WLTA 4B5LA 2FCAA 4C7MA 2FMIA 1OVGA 3F47A 3OY2A 4JMPA 1HMPA 3FFTA 3FYTA 1E18A 3N8HA 4BZWA 2AXEA 2DQ4A 4WN3A 2DF8A 5CCEA 5EHZA 1PNTA 1MZPA 3UVEA 1P2BA 4DLNA 1USKA 2ZR8A 1VG9B 5J23A 5H9VA 1CP2A 1MQ9A 5FQOA 3QPAA 1S2LA 3EEQA 3NAZA 5BPHA 1JLHA 1TT5B 3Q5EA 4AN1A 1AA6A 1KOFA 3CTPA 2ODQA 1FY2A 4TMKA 3RS7A 1T5EA 3C70A 4K9NA 4UNRA 2NXEA 2IH4A 2C7PA 3BB1A 2IPMA 2Q8NA 1H2XA 1ST2A 1PJ6A 3KWJA 4ZVRA 5LP6F 4ZV7A 2Y4OA 1ZSYA 2XUFA 2H92A 2W58A 3GZJA 4GR5A 4IJ5A 4QUBA 3PD0A 3ANSA 3I45A 1KTVA 2Q3MA 1TQ6A 2HIMA 3PDIB 3FI9A 4MTCA 2IY7A 5EKXA 1WDTA 1FSSA 5U1PA 4BEVA 2WSBA 3UH1A 1NX6A 2J5QA 1FRQA 5ICGA 2GETA 3B38A 3B2EA 2HPVA 2IYEA 2Q5OA 4CQJA 2VRNA 3FPJA 4RO0A 2OILA 1YR2A 2ZI3A 2YHUA 3OWXA 3UCEA 4PVDA 1ZWKA 4LW8A 4M1WA 5REQB 4MQ4A 2PLRA 2ZUCA 1QLWA 4KXUA 1NC3A 3PNLA 4LOIA 3L7NA 2OYSA 4Q4DA 4QAJA 4N0MA 4ZGBA 2UXCB 4C20A 5B7GA 3ZDBA 4P7BA 2PR2A 4X20B 1YASA 1J9ZA 1Q0ZA 1QHHA 2BCEA 2CMKA 2SNIE 4O4HB 3C7CB 1G6Q1 5F1KA 3P7MA 4TLCA 4A0GA 1A4RA 1TUIA 1UKVY 3RS3A 4C0XA 1KDPA 3CW9A 4UUQA 3ZCXA 5AP9A 2FQQA 4CR6A 1YQTA 1QIDA 2QQGA 1OZGA 1RVDA 3OWOA 1ENOA 2RAVA 1QVAA 2B4RO 2DHRA 4AJOA 4EGFA 1I33A 3EUFA 3H5RA 4F3CA 4ZFNA 2QEQA 3VQTA 5AVQA 5KVCA 3L07A 1XP8A 4IOKA 3K1ZA 2RGEA 4PTLA 3QU7A 3T1NA 3WLKX 2DYIA 3FVWA 3ZKWB 2PBLA 5EJAA 3WHPA 3CUUA 3FYDA 1N2EA 2EX4A 1WM1A 2QX7A 2TMDA 1CZLA 4FNMA 4AF8A 3D4OA 3GELA 4KQGA 1Y4ZA 3JWGA 4CMHA 1OB5A 4RA9A 3WLQA 4E2FA 2X1HA 1VG0B 4P4TA 5B12A 4CMJA 5JJLA 1KR2A 2X76A 3L8CA 2VZ8A 1B73A 1NBHA 2BMAA 1HI9A 1QU2A 3KLNA 4GEGA 4DLXA 1A8SA 3NE5B 3FXAA 2XKJE 1A5SB 1NFQA 3LU1A 4IDQA 2NSDA 4LY6A 4OUKX 2F3QA 3IHLA 3RH0A 3K0KA 4M1EA 5D1NA 1AJEA 2JB9A 3GJ4A 1SIUA 2PKYX 1JA1A 4KYVA 4O1MA 1FZTA 1ZMRA 2P9ZA 1V1MB 1SXHA 1PJ5A 2FLKA 1O08A 3P4XA 3PPVA 2O14A 2VHCA 3TQQA 1EI9A 2NLOA 3ZCUA 1LGYA 5AH0A 2XI4A 2IEAA 4PXAA 9LDTA 1WCWA 3EXHC 3OOYA 3Q3AA 3A6EA 4BVJA 3T4UA 4EY6A 3RHFA 3ZV7A 3B70A 3OH8A 2GBGA 3MTDA 3PE3A 3GVJA 2W7TA 3QEKA 4RJ2A 3CRNA 4L74A 3OZRA 4BNZA 5B2EA 4WA7A 1ND5A 5KJFA 4L0MA 2HF7A 4YH1A 3M1YA 3GLIE 5FOUA 2MCFA 2H29A 4WLOA 3UZUA 3MINA 1QQTA 2CLEB 4HEHA 4JROA 5K3DA 2JKVA 1X2EA 1CLEA 2DP4E 2XCIA 1KL7A 2AFVA 2G9UA 4LN1A 4PFSA 5D3KA 5EIBD 3W5DA 1BCSA 1SUAA 3NM5A 4JLVA 3T3PB 5EN4A 1SFRA 3EE6A 5IKEA 5JADA 3F98A 5LZ5A 1WCYA 3ZNPA 2Q9AA 4I99A 1GGHA 4RMJA 3QEJA 4LRUA 4L9AA 4KFSA 2P3SA 2PRKA 3S2FA 3T5PA 4NP6A 4KGZA 4LHSA 4TROA 4EB0A 1UJCA 1W8DA 2DWCA 3KX2A 3NAQA 2IY9A 4FZ3A 1KH1A 2EBHX 4N0DA 4MVYA 4O4IF 3E48A 4WY2A 3Q6RA 1RJ9B 4YRKA 2GI4A 1TCCA 4M0MA 4WNYA 4AS2A 1DBPA 3H42B 5KO2A 5KIAA 1O6GA 4W5OA 3ZCTA 1R8XA 1XIVA 3EMDA 3NT2A 3VHRA 4EW3A 4IXNA 4MS3A 4MLDA 3HJNA 1D1NA 1ESEA 3BK2A 3FDXA 4B6QA 2FF5A 3T06B 4BQOA 5L3SA 1G63A 2WVJA 3ZR4B 4R0NA 4TOIA 3A2MA 5EIEA 1SD2A 1EP9A 2VC2B 4OYYA 2PT7A 1GG9A 2HF2A 4UDNA 4UTZA 1BDIA 2YJ4A 4BP9A 5TS2A 1UPXA 3HBFA 5FOWA 1XVUA 2VPYA 3CZMA 3R41A 3SDBA 3VU9A 1IEQA 4QU0A 1M5TA 2X0EA 4LZWA 1A9ZA 3JVUA 4R6XA 4UHDA 4IVRA 3MTGA 3K9GA 3ZCPA 1CR1A 3TIFA 5B4VA 1ZL2A 1TMOA 3FRJA 1V1RA 2QZPA 3FMPB 4LQDA 3RC3A 5C1BA 4UFPA 5KYUA 1EINA 5EKUA 5IDWA 3SZLA 1CUYA 5D5HA 5B1YA 4ZYUA 1ZNQO 5FWYB 1IBSA 4LQCA 2XWBF 3INNA 1U2TA 4AU1A 3N0WA 1GYRA 2AOUA 3BWDD 3JAMA 3WQBA 1ZICA 3TTWA 4QC2A 4OQFA 3GIRA 3OZVA 3VDMA 5AW6A 1IDN1 2G06A 5K1ZA 3EFEA 3K72B 3WLFA 3OLCX 4GI3A 1C0LA 5TJ9A 3SI7A 4OAOA 4KVGA 4EG7A 5A8AA 3U7QA 5J9FA 2PRSA 2NQTA 2RGYA 4RY9A 2XVXA 1P72A 4OHKA 4DV6B 2YFKA 2Q2QA 4JNCA 4MITA 1BA2A 2P5TB 2CC2A 2V6IA 5BRNA 2NV4A 4MW1A 4WECA 2VQSA 1XZJA 2O3TA 1KARA 5IEJA 4R1UA 3OCYA 1RQXA 4ZDWA 1K92A 2O7NA 1U5AA 2IYPA 3I2FA 3MXOA 2IUEA 2DERA 5L45A 1IY2A 4N48A 4Z6KA 3VYSB 1YB6A 3KKKA 1FP4A 3T7JA 4QOEA 1TAHA 1BQ4A 2QX4A 4HLQB 1XJWA 1B41A 1KMCA 2ZS8A 3AYZB 3CR3C 3FWYA 1MX9A 1OY1A 1PZHA 2YQZA 3U3DA 4NRDA 1KEEA 5AQ1A 4P12A 3VM6A 4ZGNB 1JHRA 2GPNA 3RUFA 2PN1A 1XTPA 4F2GA 3PQ7A 5LMUB 4CL8A 1BPLA 1L7NA 4IXTA 3IIEA 4XGIA 3V8VA 4AW9A 4HV4A 1C81A 4CDMA 4MJ7A 5GONB 2EHDA 3RSHA 5DLPA 2X8WA 1FDWA 5FF9A 2O8BA 1CJUC 3TOXA 3M6XA 3L8YA 2OCAA 3QOYA 3GRCA 1GTRA 3THXA 2B5WA 3OIVA 4G5OA 4O3MA 2J67A 2WUVA 3K73O 5HFJA 1D4ZA 5HK9A 3L41A 5ITSA 2OV8A 5A0TA 2R60A 3OZDA 1GD1O 4BNDB 1I9CA 2YYYA 3MJHA 3WWEA 1LJUA 1UF9A 1BMFD 1E3XA 1CHNA 1Q6YA 1GHTA 1UOEA 3MUNA 2G72A 1HE1C 3FYUA 5JZBA 2JLWA 1A7JA 4ZVQA 2YQ4A 5E1DA 2R96A 1Z63A 1XDWA 7MHTA 1SZDA 3GLGA 1FJXA 2BEVA 4EVSA 1ZYUA 1NW9B 2OTJB 5FIUA 1TYCA 5KJEA 1V41E 1GTZA 3F1LA 3ZDAA 2VCHA 2CLDX 1Q15A 4CFZA 1XCBA 2VPXA 4WN9A 4QIHA 3AVXA 3REOA 4OMCA 2ZYDA 1XDGA 2C4MA 4IDNA 1YMVA 2I62A 3ELYA 3MMNA 2Q3DA 1WKVA 3MYRA 1Q0PA 1ZCAA 4EATA 2QM8A 2AW5A 2QT9A 1WWKA 2PKWA 4G1UC 1S8FA 1T2UA 3RFFA 4B83A 2GBLC 1NL3A 5KHLB 3WC4A 2NYVA 5DCWA 3K5HA 3TR5A 1CV2A 1R15A 3C4QA 3HKEB 1FQOA 5L40A 4O2AB 3IERA 1BHO1 4BO3A 4FDVA 2DPGA 1GGEA 4RD1A 4HDOB 2DGDA 1GARA 4QDJA 2BP7A 1HZEA 3QENA 4J0DA 1TCBA 1ZH2A 5HE9A 3GLGB 4V0MA 3VV2A 2QQ0A 4PS1A 2OK7A 1X7WA 2HD4A 3PG5A 2FHSA 4OGKA 3TSWA 3Q8WA 3QP9A 4N5IX 2O2IA 4KQFA 1FYWA 1KEWA 3QY9A 5ALHA 1QCDA 3J7TA 4TMZA 2XZOA 2BHSA 2XR1A 3JSXA 3EFHA 2XGJA 3DBVO 3QVGA 4A10A 2H5JA 4UOEA 1E1CA 1NRXA 2VF7A 4JK3A 5E3JA 1T26A 1UT8A 4YRRA 4AG6A 3TLMA 2VAMA 4TMFA 4JJ6A 4MRRA 5D5QA 2B78A 3G71B 2ZJZA 3RTAA 4P38A 4J6FA 1SU8A 4OX9B 3ELBA 2ZL5A 3KQQA 1TTPB 4MI3A 2Z5VA 5C7YA 3QA9A 2QSZA 1W0KD 3LPLA 4OI4A 4J16C 3HBMA 4FHDA 1Z2OX 3TTYA 3FZQA 2DFKB 1S8NA 4XYBA 2Q07A 3DDCA 4P6YA 2PDAA 3FWPA 4C7KA 2OMEA 3LTEA 5JFGA 3M6WA 5TXGA 5FUMA 1XALA 5BT8A 4FT4A 5LP6B 4GM0A 3T9FA 2NPFA 3G23A 5E9WA 1F4VA 4KXXA 4H0NA 1N0HA 2J5RA 4B3DA 4JJ7A 2FW0A 2IZOA 1TPYA 4GXRA 5C8XA 4ZXPA 2XY4A 3I3OA 3IEVA 1EVZA 1TZJA 4G5GA 3R3UA 4MTLA 1JQLB 1P5JA 4NESA 3KU4A 1BMDA 1PT8A 3BMXA 5CW2A 1Z28A 5BN4B 4JLBA 4HGNA 2TMGA 1UXIA 4P22A 1Q83A 1C3LA 4HP8A 1E66A 3B60A 2JJ1D 1YS6A 3PL1A 4C22A 1XDDA 1SN7A 2ADMA 3ML1A 3VZPA 5ERXA 2JVKA 4Z4TA 2E48A 3G05A 5D7NA 3AUAA 4MK4A 3HVHA 1JJVA 3LP8A 4GEKA 4RPIA 1PWXA 2CVQA 5E38A 4DYDA 5EXPA 1NY6A 4HZUB 2AHRA 4U1RA 4ZEOA 1KQGA 1YS7A 2EBWA 4FWBA 3SZRA 3C0KA 1QO7A 1K6MA 5DVZA 3Q7QA 2P9QA 3HI6A 4GMKA 4X1KA 4BGDA 1G21A 3H9UA 2Z43A 2I6GA 3JR7A 1T0IA 3PT5A 1GGKA 4H3KB 2DLDA 2I7VA 3KEGA 1I3MA 4WFKA 1N8SA 3CC8A 3I5UA 4PYRA 3RSFA 4Q9LA 5CFMA 1U7WA 4DPKA 1AH2A 2YOFA 2NWQA 4IDCA 3G6KA 3KELA 4IQ8A 1PIWA 1UKYA 4LA4A 1Q14A 2QGNA 4GF5A 4KGXA 4ADSG 1MNQA 4R8KA 2LZ0A 4I1RA 3WMFA 5JU6A 3IEMA 1UAYA 3DV9A 2GN8A 1CUVA 2ATVA 1GUDA 2DFVA 4Z4VA 3DXZA 3ZXSA 4KQ6A 4X8LA 2CXOA 2GTHA 4ZI5A 1VQMB 2VBIA 4ZYVA 1NLFA 2GZHA 1H8ED 5D84A 2H0RA 4BNMA 4X66B 1ZH6A 2GERA 4C4RA 5I4IA 5B3LA 2K5UA 1DWOA 2JI9A 3PC3A 3MJFA 4KLAA 4M9CA 1YQXA 2BZGA 4LMPA 4W1RA 4ZQGA 1IZ8A 2J6CA 5PGMA 4CMCA 4EZBA 1PVVA 3O47A 3T35A 2B8TA 4Q1CA 1JI3A 4DBLC 3HUFA 1R6XA 2XBUA 2OD9A 1IC6A 2EWMA 3BXOA 4N49A 4AJKA 1WZ2A 2XV1A 1DDOA 3A8TA 2JI8A 3P9RA 1NYRA 1B15A 5I3ZA 3E22A 3G5AA 5CIYA 5HP4A 2ZIXA 1NF8A 2YHSA 4NBLA 1W5EA 3E1KA 4JS0A 4P31A 1RBZA 1GFZA 5ADWA 1XPJA 2H7YA 2J31A 4PC1A 3VNVA 1EK5A 4OPOA 3CZ9A 3KTAA 1DV1A 4RQTA 2WU4A 1Q44A 2OM2A 3FCOA 3MLAA 2Z04A 3EGEA 2ZIZA 4YT8A 4YX9A 3MD0A 3CLKA 3GUZA 3BERA 1NQWA 4L75A 2MYUA 5DMHA 3I0ZA 1JHDA 3K9HA 3TXAA 1HXHA 2F00A 1ZA2A 1FW8A 1RLJA 3KLMX 4GQNA 1NBOA 2CUZA 3ECAA 2G4VA 3QX8A 4MRMB 2VDQB 4M8IA 5ANRB 4BBAA 1Y3CE 1DIOB 4RH3A 5C2JB 3G7UA 1N25A 2EC5A 1Q95A 2OCDA 2BKVA 3GJRA 3HB5X 4XN0A 3RS8A 1RJWA 3EVFA 4DZTA 1R8QA 1AS3A 5E9JA 2QN3A 5B55A 3OPQA 5REQA 2OO3A 1OX4B 1ECBA 1DZIA 2W83A 1QGZA 4PYLA 3RFCA 8GPBA 1H9CA 2ZYIA 3HXOA 1K8AD 3O7WA 1BN6A 1FFXA 1KVRA 3R3YA 5AKZA 3TEFA 1SBHA 3AHGA 4F4JA 5LQCA 1YHQB 1SK9A 2I03A 4BO7A 3X1KA 1DQZA 3EZ9A 1U7HA 3DDYA 4XOPA 1CR0A 4RXUA 1K3TA 5FYQA 2WF5A 4I9NA 1SRQA 2VP9A 4NAUA 4ZVKA 1HDOA 3WMXA 3R7LA 1EP2B 1L7EA 1T2CA 1D2NA 2F1OA 2VYCA 3DR3A 1DL5A 4IV8A 2DOGA 3EZ6A 3COWA 1LPSA 4KPUB 1KIMA 1S01A