1KKLA

L.casei hprk/p in complex with b.subtilis hpr
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
176
structure length
167
Chain Sequence
ERRSMHGVLVDIYGLGVLITGDSGVGKSETALELVQRGHRLIADDRVDVYQQDEQTIVGAAPPILSHLLEIRGLGIIDVMNLFGAGAVREDTTISLIVHLENWTPDEQTQLIFDVPVPKITVPVKVGRNLAIIIEVAAMNFRAKSMGYDATKTFEKNLNHLIEHNEE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HprK protein
publication title X-ray structure of a bifunctional protein kinase in complex with its protein substrate HPr.
pubmed doi rcsb
source organism Lactobacillus casei
molecule tags Transferase,hydrolase/transport protein
total genus 47
structure length 167
sequence length 176
chains with identical sequence B, C
ec nomenclature ec 2.7.1.-:
pdb deposition date 2001-12-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07475 Hpr_kinase_C HPr Serine kinase C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1kklA00
2IXGA 4TZ0A 3THOA 2VTKA 1NG1A 3VU9B 1RKBA 3ASZA 4RFSB 3TAHA 4L5BA 3U5ZB 4C9BA 3ECCA 4G5SA 5DIFA 4LPSA 1FQKA 2ZI5A 2HT1A 4P4TA 4QFMA 3I61A 3RLFA 3WMFA 1K8RA 3N2IA 4IDHA 3RWOA 4BRUA 3NXSA 2O8DA 2YOFA 1XTRA 5K8UA 4DLXA 3EARA 2A5JA 1DAMA 1XFAA 3MWKA 1QVRA 4NYJR 2JLXA 1OB5A 4DCUA 5KTYA 2VP5A 1G5PA 1CIPA 2EW1A 2VRWA 2RGEA 2G77B 3RRMA 1AQYA 2O0HA 3SQXA 4KFUA 1XCMA 4Q4LA 4AKHA 2CCKA 2YYZA 3I62A 2XSZD 3VQTA 2CHGA 4E03A 1NJGA 1SVMA 2PX3A 3AUYA 4RD1A 1NN3A 2J46A 5JMTA 4Q7MB 3X1DA 4BWYA 1MO5A 4GZLA 1UBFA 1UEJA 3IPYA 2N46A 3VKGA 2WSSD 4W9MC 3SBDA 3VHLB 3BH7A 4O0MA 1CS4C 1OHHD 2EYQA 1WA5A 3FMPB 2D4HA 5JS8A 3HPRA 3RAPR 1WE2A 1IXRC 4KODA 1E3MA 1QG4A 4MRNA 4A8JA 5EZ5A 1VCMA 2YC2C 5B64A 2QI9C 1MH1A 1OFUX 4EAQA 1M7GA 4JLDA 5KPDA 3GLIB 2UVQA 4KBFA 1YZNA 3RS5A 4B2LA 2FG5A 1ONBA 1G5RA 3K9LA 8OHMA 3GLGA 1D9ZA 2IX3A 3QBTA 4Q1AA 1DOAA 4LJ4A 3VR4A 1FNNA 4ZDIA 1G3QA 1OYWA 3FMOB 4YMVA 2ZUCA 2ZRJA 3IHLA 4OKSA 3C16C 4B6EA 1Z0FA 4GOXA 4MYHA 5L3QB 4V0MA 1G7TA 2ZJOA 3IBYA 2RAPA 3K0AB 2QRZA 3B1ZA 3IEUA 4FWTA 3KQHA 4DKXA 3GFOA 3RS7A 3LO5A 2GXUA 2WWIA 2FPMA 2ZR0A 2FSFA 2HDNB 2FFHA 4XSGA 5TY0A 1TTTA 1RYFA 5AJXA 1G8HA 1AGPA 1XTQA 2JATA 3GJ4A 1N6NA 2GDJA 4AKGA 5JWOA 2REXB 5AUPB 1DELA 1L4UA 3M0EA 4RZ3A 3QXXA 4A8JC 2ZUBA 1CJKC 2OLJA 2QEQA 3RVBA 4JBXA 3N5CA 2QQ0A 2ZUDA 2D62A 2YWHA 3DHWC 5G3ZA 5BW8A 2WWHA 2Y8EA 1TUIA 4IVPA 2WWYA 1G5TA 5SZIA 1KOFA 3UPUA 1E96A 1A2BA 3UMSA 4DUGD 3QY0A 4V0ME 2E87A 3GLFB 4OHZA 5FTKA 2ZRCA 4URYR 1N6LA 1SXJC 3T1QA 1X6VA 2BBWA 1XEXA 4GSYA 4ACAA 2YV5A 4D4LA 1Z0AA 4BPBA 3OFND 1ZRHA 4IVQA 2GEDA 4LC1A 1ZAKA 4CT4B 1S1MA 2V55B 3B1YA 2IS6A 3F0TA 1Q1BA 4P4UA 4V0KA 2QA5A 1W0JD 2R62A 4DCSA 4Q00A 4Q9IA 4TN1A 5FL3A 2HJVA 2XOKD 5EUMA 4AI6A 3NH6A 2Q3HA 3NC1C 1TF7A 5H68A 1EFTA 2IK8A 2KB0A 3CW2A 3GMTA 2PLFA 3D3QA 3QF4A 3U7FB 2PJRA 1VCNA 4B33A 5FOSA 4HLUC 3KFXA 3ZQ6A 3AP2A 3LBIA 5DI9A 5EQTA 4P4SB 2EQBA 1M7HA 1XEFA 3F8TA 4NL4H 1NVVR 2F43B 4EPRA 3D8BA 3OE7A 4DLTA 4DLVA 3HU1A 1UFQA 4V03A 4WW0A 4B35A 3TBKA 1RW4A 2O5VA 1ZCBA 2SHKA 1P2VA 2IYTA 3O8DA 3SFVA 1HQCA 4PC3A 1P2TA 5JJIA 1GKIA 1OKKD 1DAGA 4QL3A 1SVSA 4Q7KA 1VCOA 4PANA 5CLLA 3NBYC 2YHSA 4FI3C 1R7RA 2Z43A 3QBVA 3TUJC 4O3MA 1U99A 3QEJA 3T12A 3B5JA 5FBLB 3VHXA 1OH6A 5J4VA 4A4DA 2ZI4A 3OIUA 1SXJB 4RFVA 3I8SA 4ZI3A 1EX7A 4TL9A 5FOVA 5IHPA 1NN0A 2PX0A 3OZXA 4AWXA 1NLFA 2BOVA 4LPKA 1NVWQ 3QJYA 5EXSA 2F6RA 5AK0A 2WIAA 2PZGA 1FL9A 4NCKA 2P65A 3UG7A 2OCYC 4Q03A 4NZYA 3EAQA 4CEHB 1JEEA 2W2XA 5DN6A 2QE7D 2XJ4A 5EP3A 4A2QA 1Y63A 1PLKA 2VEDA 4GMDA 2JJ1D 2ZSFA 1KI6B 3WP0A 4IKEA 3JZAA 4IOKA 4JZKA 1E2KA 4EFNA 4DC9A 4F7WA 1G20E 4PZZA 4PSAA 2ANBA 2WWGA 3NKVA 4FCWA 4IRUB 4A0RA 4H9GA 4LYHA 3TW8B 4RCZA 2ZM5A 4KSBA 1QVAA 4KFSA 2OO7A 1QF9A 4EIWA 4LYJA 3PIRA 1W7AA 3EPHA 4HLDA 1ZNZA 5JSZA 2J9RA 4HB4A 4GRAA 1P61B 3MWYW 1N5JA 1F2TA 3FWYA 1GILA 1LVGA 2NZ8A 2WIBA 3VNUA 4Q48A 2G6BA 3GJ5A 4QNRA 2F9MA 2ZRPA 1CF4A 1W4BA 1GNRA 1A1VA 5FPHA 2V4ZA 4CF7A 1I2DA 2XNDD 2GNOA 4KVAA 3RSOA 4LI0A 3FTQA 4PPFA 2W00A 3GJXC 5JRZA 1U8YA 3UANA 2PCJA 3LQRA 3WRXC 3QPWA 4UNNA 5HKKA 2OZEA 2JLQA 4HAXA 2G0NA 3RYTC 3IPXA 4EQ6B 4LJ7A 5CK5A 3W9YA 3TRFA 3A4LA 4Q9LA 3ICEA 4ZV4A 3EC1A 4R71A 3DKPA 2CE7A 1NVXQ 5J5CA 5TV2A 4FCVA 4B44A 4UQOA 5DISB 3CWQA 2ZXUA 5CB8A 2ZRFA 4JIMA 3THXA 1G8GA 2C5LA 5SZJA 3GPLA 4PC6A 1GFIA 2IWHA 5EE0A 1AM4D 2FSHA 1IOZA 4GBMA 2DFKB 1E98A 3LA6A 4QJ5A 4TLEA 1E1RD 3FE2A 1UBCA 2FU5C 4I1UA 1EFHA 4CW7A 3ZZ0A 2J5XA 2VF7A 4DB4A 1EX6A 2G88A 1ZUHA 2QQEA 3AP1A 3QKRA 2GVDC 2OFWA 2ZI9A 4S2EA 1MKYA 4TTQA 4QBHA 2OAQ1 3CF6R 5KHOC 4JSYA 1YZKA 4G3XA 4DXAA 4LJ5A 1KK1A 2BDTA 5GADl 4JJKA 2Z4SA 4MGKR 2JCSA 4OBEA 3CNLA 5HTKA 1Z0DA 1P60A 1MOZA 4EJSB 2FPKA 4JVSB 1DG3A 2LKCA 1A2KC 2VIIA 5GJBA 1D5CA 2ZSBA 3LBHA 5DGXA 1W36B 4P4SA 1QHNA 2ZYWX 2J3EA 5L3RA 1QHYA 1LNZA 2VP6A 1E1QA 3DZDA 4O2RA 1K5DA 3GLIA 1XZPA 4J0QA 1ODFA 2CL7X 2DY1A 2GESA 3HWSA 4KSCA 3Q5EA 4LV5B 1S3SA 1VKJA 2RH5A 3BB1A 5JZVA 1JPJA 4PC7A 4BZXA 2KBEA 1B23P 3OAAD 1OXVA 5E7JA 4BRWA 2JIZD 1EFRA 2Q0HA 2GTPA 3OEED 2FA9A 4XH9B 3WMGA 3PUVA 1CBUA 4OYHA 2ZVQX 4WXPA 3B9PA 5EUQB 4YLGA 1YR7A 4QRHA 2C99A 1G291 2C9CA 2REBA 1X3SA 2VHCA 5EXPA 5BN5A 3U61B 3K09A 4OQMA 2RGDA 3L43A 2JLYA 1ZBDA 1J8MF 3FMIA 4YMSA 3BERA 2A30A 2IUSA 5G41A 1UBEA 4Q4AB 4LC0A 2XAUA 4LUCA 3SHWA 4WIAA 4BLSA 4KHZA 2PZEA 2BKUA 3Q8XB 1TEVA 2GJKA 3O8RA 2GXSA 5DH9A 4NCHA 4DDTA 2VF8A 4IHQA 1D6JA 2NTYC 4IFBA 3CIOA 2QBYA 4MRSA 3P27A 3KJGA 1XU4A 1NSFA 1KZ7B 2WKRA 4XVQA 1MABA 2WSMA 1UKZA 5E7MA 4IFEA 3FOZA 2FPLA 3WP1B 5CM8B 1N3BA 1Q0UA 1AGRA 2ODBA 4US0R 1Z63A 4C0LA 4Z8XA 1DAKA 4LK2A 1W46A 1N5LA 5KDDA 3FB4A 2GBLA 4S35A 2QN6A 3KKOA 3K0SA 2O8CB 3AVQA 1YR6A 1OF1A 2NQ2C 2XTMA 4WBSA 5ELXA 2GWHA 3EZ7A 1AS2A 4G5GA 4M1KA 2IYSA 1TX4B 3KL4A 3GLHA 4RD6A 2IF0A 2QMEA 3E5HA 2GK7A 3A1VA 1KMQA 2NG1A 3K8YA 4PAMA 5IDVA 2PL3A 3A37A 5HCIA 1KMHB 2CXXA 1A82A 1UF9A 3HP1A 3HYTA 1IHUA 4G5QA 3Q7PA 4BGDA 5C4GB 1KY2A 1EWQA 4KU4A 1S96A 3NBZC 3SR0A 3R7WB 2QTFA 4F38A 2EFHB 4MDFA 5GVRA 5BWMA 4PHHA 2HF8A 2LCFA 3CX6A 1KI9A 1WF3A 2ZE8A 1QZXA 3I8XA 1R0WA 3DKVA 2QT1A 1II0A 3DZ8A 3KXIA 4HEJA 1AQUA 2H5EA 2QPTA 2BMEA 2GBLC 3PFIA 1NL3A 1NIJA 4E07A 1ZD8A 2NGRA 5LB4A 4TMZA 3PEWA 4TL8A 3K9HA 2OUKA 4QXAA 2MMGA 2BJWA 4DDWA 3U44A 4ZCIA 1BMFA 5G3YA 1AS0A 2J7PA 2PH1A 1IQPA 3D31A 4LHWA 3RANA 1Z83A 1CTQA 1KZGB 3ZDQA 1Z0IA 4GPTA 2PBRA 5H8WA 5DNYB 3JZMA 5LD2C 3IGFA 4FW9A 4RZXA 2VYFA 1BKDR 3W34A 4C0JA 2UKDA 2IA5A 2J45A 1NLZA 5CM9C 2XOKA 4TQAA 4GL2A 1SVOA 3A1SA 4M9QA 1T6NA 2R6DA 3VNVA 4DDUA 2A5YB 2VP0A 2JASA 3KB2A 2AX4A 4XD7A 2CLDX 4OJQA 2YOHA 5EXTA 1J2JA 1IBRA 4JJZA 1XEWY 2BM0A 4OHVA 3RDPA 3SJCA 1H8ED 2FH5B 5CYPA 3TVDA 4HAVA 4N3NA 2JLWA 4OQLA 2HXYA 2AD5A 3HYRA 1KI1A 2QAGB 2IXEA 1Q3HA 3X2SA 3TR5A 4MRRA 5M04A 4QGAA 3RRYA 3AF2A 4QC2A 4Q9JA 1TL7C 1E9DA 2IXFA 2GZHA 1C9KA 1OH7A 3FVQA 1FPMA 1U94A 1Z28A 2I4IA 4AG6A 4B3CA 5DHAA 3EX7C 1HE1C 1N5KA 4OHXA 1UM8A 4B74A 2RB4A 4LSGA 5CDFE 1H8HA 4IDQA 2C9OA 1IN8A 1GIAA 3LRPA 4JVNA 1GRNA 3I72A 4F91B 5ANRB 3B8HA 3BC1A 4LX0A 2ZS7A 4HAWA 5JECA 1ZM9A 2H8KA 4KYIB 3VMFA 1JJ7A 3OEHA 3TMKA 4HAZA 2R6FA 2AKAB 2G1JA 3GQBA 4GP7A 5JEDA 3MLEA 4M21A 1E2QA 2CHVA 5AJYA 4A2WA 2IYLD 3MAAC 1SHZA 2IW3A 4QHYA 2WWWA 4N0DA 3EXAA 3AQ4A 2BBOA 3A1TA 1KSFX 2O0JA 2QNRA 4TYNA 1L2TA 3U4QA 3A1WA 2ZSEA 4B3FX 2PJZA 3WHLA 4ILEA 4DLUA 1Q22A 3N70A 4M0LA 5L3SA 1M2OB 3KKNA 4CEJA 1YRAA 3IILA 1ZC3A 1OV4A 5B57C 3IQWA 3LW7A 1ZD1A 4NBSA 3CM0A 3KFVA 4PSVA 2P6NA 5DHFA 4ZDKA 5E4FA 5FH9A 4KITB 2H7VA 1Z2AA 2CJWB 4GMXA 5GJVC 4NYIR 2JLRA 4M1TA 421PA 3WYAA 1LS1A 2RGNA 3TE6A 3K70D 4Q01A 2ZAMA 4DB2A 2Q3MA 1AKYA 1EFRD 4HDQB 4BECA 1O87A 3L0PA 4US2R 4QGGA 1F5NA 2WJIA 1G16A 3L0SA 4ZDWA 1DAIA 1P2UA 3GLFE 4B3GA 2NPFA 5JWRA 1N6HA 5KO2A 2XTZA 2NO9A 4JKIA 1VG0B 2GZAA 2X77A 1US8A 4OHYA 2VHQA 1UDWA 2WWFA 2W6IA 2AXNA 2WMOB 2R6CA 5HPYB 3DL0A 3U3JA 4A36A 1HTWA 2OBMA 2AK3A 3T15A 3DM5A 3ZIAA 4QG7A 4Q4JB 2CDNA 4L9SA 2GXQA 4TYPA 5K8TA 1KO8A 1MR3F 1T9HA 2NOAA 1MV5A 4LBZA 1E32A 1G19A 5FI0B 3PENA 1N5IA 1NKTA 4QJ3A 4DCNA 1G18A 2PEYA 3A8TA 1T8TA 2X8AA 5AWFC 4QKQA 3C4JA 2J0SA 4BFSA 2JDIA 3ADCA 2J0UB 5HKKD 3NBFA 2RGXA 3AKCA 5KPJA 3HPQA 4UXIA 3NH9A 3AVWA 4B3XA 4B2PA 4EPXA 4PO1A 2ZJ8A 2JLVA 2GAOA 4QJ4A 3GJ3A 4JT2A 4PPGA 2ZE5A 4C0HA 1KGDA 4TMXA 3VFDA 5TMPA 2OLKA 2VBCA 2FFAA 3EG5A 4I81A 3DEFA 1W36D 1A7JA 1HV8A 4O25A 2VO1A 4MA4A 2YKGA 4A2PA 1XMSA 3KKMA 3RC8A 2FV8A 1K5GA 3BWDD 2D06A 3QOFA 5FPTA 4B48A 1CU1A 1TEXA 4ESHA 4MKFA 3EZFA 3V00A 2OESA 4FD2A 4FXPA 2FJUA 4CDGA 1FMLA 2AD1A 1JALA 5HCNA 3K9GA 4RFSA 1DVRA 2VA8A 3S1AB 4G0NA 5LD2B 4C0KA 4POAA 4NMMA 1Z6GA 1KDTA 1NJFA 3TUIC 2ZSAA 1ZM4A 3CB4A 1KSGA 4B47A 1Q3TA 4X8HA 2V3CC 2PZFA 3KJIA 3NVAA 1SVLA 5EE3A 3PUZA 1G3MA 3SJBA 2GEUA 4GNKA 4Q1BA 5EJEA 2WVJA 2AFHE 4M1MA 3CPJB 4V02A 4QBFA 5JJLA 2V54A 1DO2A 4RD4A 2W0MA 1PV4A 1T0HB 3RRZA 1WXQA 5JBQA 3MCAA 1G8PA 2GRJA 3BBPA 1N25A 4JMPA 4NH0A 4RZ2A 3IEVA 2DPXA 3RS0A 2QTHA 3LV8A 3ADBA 1E6CA 3B1VA 2H92A 1R0XA 3DM9B 1OFIA 1E2GA 2O0KA 3X1WA 4NYJQ 1KAGA 3MGCA 1L4YA 1EESA 4HUTA 3WHKA 1EGAA 4PPQA 3E70C 1GITA 4W5HA 2OHFA 4TT3A 2RGAA 5BQ5A 2NO6A 3LLMA 1OH8A 1A5TA 1XXHA 4PHFA 4KCGA 1XJQA 4V0LA 3K0CC 1I4LD 1SHKA 2B8WA 1ZVQA 5J4YA 4L15A 1HA3A 3L8ZA 2R44A 4B75A 4HUQA 1KO5A 3EZ9A 1F2UA 1E2MA 1W1WA 2QAGC 3WYGA 1AA9A 3TAUA 5EE1A 2A5DA 1T0JB 2D74A 3L0IB 5GJWC 3LVRE 3GLGE 3QG1A 1G8FA 2G3YA 2Z83A 3LFUA 4MH0R 2IYZA 1Q1EA 2QM8A 4A1FA 3HR7A 2GAAA 1AZSC 5TXGA 1GM5A 3U3MA 2ZYTX 3O47A 2YWEA 3PUXA 4U7DA 4M9ZA 3EASA 2ODEA 1DG1G 4BLPA 4M2LA 1BO6A 1YRBA 4NCJA 4NKRA 1VG9B 1YR8A 3CRQA 1XXHB 1ZD9A 2YWGA 2G9NA 2BCGY 4NCNA 2V1UA 4QHSA 4R9UC 3VX3A 1Z6XA 4Z1MA 1G3IA 4XWOA 2FNAA 1E2HA 4TYWA 2J59A 1VYUA 4HAUA 2C78A 4ZDJA 2O8CA 1D2MA 4LDJA 1TPZA 1CLUA 1RRPA 2WJHA 3GEHA 2Q6TA 3FHTA 1HT2E 3SHFA 5HR5A 3L82B 1W5TA 3UKDA 1BMFD 1TU4A 2BMJA 2QPAA 4ARZB 3SI7A 4BLOA 1KSJA 4UNRA 3C15C 3K70B 4Z51A 3RHFA 3K0EA 1W44A 2O8EB 1DARA 1OW3B 1UJ2A 3KUDA 4DUGA 1OIVA 4Y0VA 3VR6A 2RGCA 4B3BA 1C4OA 4N0EA 3AVVA 2KWIA 5AJZA 3P4YA 2ZJZA 4FWIB 3NWJA 2QSYA 3OF5A 3O8BA 4CT5A 4TLCA 1S0UA 4F4JA 3MWJA 3TGPA 3ZS9A 2B21A 1U8AA 3AVOA 4NE2A 2N42A 4MUBA 1VYVA 2CBZA 4PZLA 1NY5A 3EZ6A 2IF2A 2B6HA 4URUR 1DEKA 4R2IA 1SULA 4ZPXA 3TKLA 2CJWA 3W6OA 4C0BA 3AM1A 2P6UA 4G5OA 3ZVLA 5JFGA 2MSDB 4R2HA 3DO6A 1KHTA 4LJ9A 4CEJB 1CP2A 2WJVA 3NIBA 2OEPA 2OG2A 3UMFA 5KYKA 4NYMQ 1YVDA 2MMCA 3NG1A 4Q5IA 4A82A 5JEEA 4DT1B 3A6PC 2FSIA 1P72A 2Q3FA 5CB6A 2PCLA 1N2CE 2C04A 5F9HA 4I1VA 4DWJA 2GCNA 4FMCB 4YXWD 1OFHA 4DSOA 1UAAA 2OXRA 1TAGA 2QG6A 5JHHB 1W48A 3QKUA 4TMVA 3SE0A 4DLZA 2OAP1 3PEYA 3BD9A 4ITRC 3W5JA 4HDOB 4C3ZA 4RD2A 1X86B 4HB2A 2ZETA 3B78A 3I1FA 2P6RA 4RY2A 1GG2A 2YC4C 4M4SA 1SVWA 2VL7A 5JS7A 3CNNA 2QROA 2BBSA 4D4KA 3UWOA 1N6IA 4Q4HA 4RKEA 4EPVA 4EDHA 2X2EA 2WWXA 1V43A 2ZRKA 4EFLA 3R9WA 3CPHA 5FI1B 3MJHA 4OQNA 2W0SA 1NKSA 4II7A 2MSCB 4ZIRA 4PR0A 4PSKA 2WJYA 5FUVA 2IYUA 4LY6A 3BE4A 2FOLA 1OE0A 3QKRB 2PEZA 1GNPA 2ZR9A 2QP9X 4D6PA 2OSBA 2J1LA 2QL6A 2ZRIA 3KX2A 1RJ9B 5E95A 3VR2A 3DOFA 3PEUA 1G4AE 2J0UA 4TSFD 1OXSC 2ZJAA 3FDIA 4Q21A 2KE5A 2WPDA 4JLAA 2HXSA 3OHMA 5FFMA 1G6HA 1F2TB 4YXWA 1YZLA 2ATVA 1SZPA 3BH6A 4GP6A 5AUQA 3WBJA 1PLJA 2H17A 2ZS9A 3U7EB 4MITA 3VR1A 3RS3A 2AKYA 1T91A 1W4RA 4Q4JA 1N6KA 2QRNA 4Z8YA 2HCJB 2P3SA 3TJZA 4D4MA 3IKJA 1P9NA 4GFDA 1IY2A 3LXRA 1IN5A 3TNFA 1W4CA 5JJKA 1ZIOA 4B32A 5L3SB 1US8B 2BC9A 4IEIA 5TB5A 1XEWX 2N1BA 3GFPA 3ZZTA 2IYQA 4LYFA 4DHEA 4OQFA 1CKEA 3WNDA 1JEDA 3U4QB 3NHAA 2RGNC 2HEIA 4IDPA 2W2VA 2GK6A 1Q12A 1RFLA 2I1VB 5HE8A 3T35A 1RVDA 1GZSA 821PA 4MGZR 2IEZA 3B1XA 1U0HC 2ZRGA 1NY6A 5C4MA 1JAHA 3IQXA 2QZ4A 2R9VA 4B2IA 2VP2A 3KB1A 2FMXA 2HYDA 1Q20A 2ZSDA 4QHTA 2BM1A 2ZRLA 3CO5A 1OXTA 2A3RA 1M1YE 2KJQA 3QQ5A 1RC8A 4AKEA 2DFTA 2V6JA 2F7SA 3D6TB 4W7SA 2CMKA 4PQFA 4DIEA 1II9A 5FPKA 2CL0X 5FTNA 1CR0A 4OK3A 2WPDD 4Q1CA 5IF9A 2F1IA 1RE0A 2IHYA 3EIEA 2XXAB 1MO4A 4JVMA 4DLRA 1VHTA 2F1HA 4CGZA 4ZI2A 1GP2A 3QF4B 3TW4A 5D3MA 1IM2A 5CIQA 1CR1A 1PZNA 5D3MB 1VPLA 2ZIAA 3RWMB 1G8YA 3KQUA 2NO0A 1SKYE 2CK3D 5AJWA 1E2DA 2GXAA 3KTAB 4HYYA 2JJ1A 4H1VA 4Q4AA 1XWIA 1KDOA 2A5FA 1ZU4A 2E1RA 2JLSA 4Q02A 4NDZA 3C41J 4JS0A 1ZM2A 4KFTA 1GL9B 5FPYA 4ZKEA 4M8NE 4BASA 4HSEA 1GOTA 3LY5A 2OFXA 1S3GA 1B0UA 1KO7A 1JXMA 2YJTD 3KKPA 5KNBA 2H18A 3L0OA 2QBYB 2PT7A 2DWQA 1MO3A 4LHZA 3DDCA 1R2QA 4RZUA 3K1JA 1DADA 4GOKA 2CLSA 5FUYA 3U60B 5FL7A 3P1JA 2EFEB 4A0HA 4CRWB 2PMKA 2BMDA 1TMKA 1RYHA 2H16A 3RNLA 621PA 1MABB 3R20A 4U02A 3GCGA 1G7RA 2H57A 3OEEA 3G82C 4DLWA 2WHXA 5DYIA 4DSTA 1FTNA 5K8IA 4L16A 1FQJA 2QTVB 2LKDA 2D7CA 3Q85A 2AWOA 1Z8FA 4D0LB 1N6RA 3AGQA 1QHHA 1VIYA 1RZ3A 2FGKA 2BKEA 1F3OA 3B2EA 3AGPA 5BN4A 4A0GA 3DPUA 4Q7LA 4AYTA 4PTLA 1HEIA 1TQ4A 221PA 4CEHA 2A78A 2GHIA 2GETA 3BH0A 2O8FA 1FX0B 1KI8A 4RCYA 5H70A 3CRW1 2Q9AA 1TADA 1G41A 3PUYA 1FW6A 3SNHA 2ZROA 3G5UA 4LWZA 4PHGA 521PA 3BS4A 2RKOA 3ZS8A 5IT5A 5IK2D 3QE0A 4TMWA 2A7QA 1JR6A 5EP4A 2ODNA 2ZU6A 3W6PA 1R6BX 1ZM3A 2W6JD 1RRFA 2FEOA 1PJRA 4M9XA 1G6OA 3H2YA 4UXHA 3SDZA 5FR1A 1OH5A 3SJZA 4DCTA 4EKDA 2GJAA 4PHTA 3QUSA 3RS4A 2IEYA 4CVNA 4URVR 3THXB 3LWNA 3BIFA 2OBNA 1HH4A 1XCGB 1X8KA 4HZIA 3WY9A 3GJ8A 1OIWA 1R0YA 2ZANA 3TQFA 5G53C 1XMJA 1P9RA 2A2ZA 1XRJA 4A0FA 3DOEA 3EIHA 1VMAA 1NMYA 2RCNA 1NN1A 3NTUA 1HUQA 2XB4A 2V7QD 3K0FA 2JLUA 4P0TA 1X8LA 3MG9A 4EUNA 3CPEA 2FSGA 5K8LA 4MKGA 4NCIA 2XB2A 2OFOA 2WOOA 3AKYA 4LCBA 1S1CA 2IS4A 4BFXA 1P73A 5J40A 5FR2A 1ZNYA 5KSYA 2CHQA 4IDOA 4AYWA 1FP7A 2JIZA 1BYIA 2Z0MA 1D2EA 1R8SA 2AN9A 3EWAA 3SC3A 5JHGB 4KYUA 2HV8A 4AC9A 4AY2A 4Q47A 4GI7A 4ZO4A 5KOYA 3KQKA 2NZJA 1JI0A 2H1LA 4UJ3A 1NBMD 2OT3B 2QM7A 3CH5A 3I3SR 3W3ZB 4FMBB 1OIXA 4P33A 5C2JB 4JLOA 1Q44A 2GJ9A 2YINC 3D7MA 4RKFA 1R0ZA 1CJMA 4K46A 1SVIA 1P2SA 4TLBA 4UKDA 1KKMA 2FDCA 2ECKA 4ON9A 4ZCLA 4MYUA 3E1SA 4KLNA 3REGA 4EQ6A 5BXQC 3C5HA 3LH5A 2VP4A 3NBXX 2XTNA 3AP3A 3I32A 3R9XA 4OI1A 1VG8A 1XMIA 3KXLA 4FINA 1DE0A 2E9SA 2ZRNA 5A4JA 2HYIC 1ZU5A 3ONWA 2B7BA 2LWIA 2I1QA 3CRVA 5CK4A 2CNWA 4JT4A 1SQ5A 3VX4A 4PZYA 1ESMA 2ZREA 2WTUA 3A58B 3TQCA 2ZAOA 3K53A 1E9FA 2FEMA 2IYYA 1XNJA 2VSXA 4GOJA 3CRMA 3THYA 2DHRA 1JR3E 2ZRDA 4PAQA 1PUJA 1VTKA 3TK1A 1OJLA 5JI2E 3EIQA 3UIEA 1CRPA 1DAFA 2VQSA 3ND8A 5DN6D 1F48A 1G21E 3LVQE 4XD7D 2HF9A 3QEOA 3ZLJA 3L2OB 1KYIA 1KI3A 3QXCA 2C03A 1TF5A 1WP9A 1Z29A 2QAJA 3VR3A 1D2NA 3TLXA 1XD2A 4GT1A 1P3JA 2PT5A 4TWZA 4IW3B 2FN4A 4HI0E 4F4IA 3PJRA 4OL0A 1E99A 1PUIA 4X8OA 2QP3A 4FMDB 1E9BA 1HT1E 1NMZA 4WZAE 1ZUIA 4OK5A 1OLOA 3QI2A 2NMVA 1IJEA 1T3SA 3PXGA 2EFDB 4EPWA 4RJLA 3U7HB 4BQSA 1E2NA 4B73A 2ZI7A 1G3RA 4PAOA 2VHJA 2XNDA 1ZNXA 2DFLA 5TVKA 1LY1A 3T5GA 2FX3A 2P0EA 2QMUA 1KNXA 3J81k 2GA8A 1XPRA 1XEXB 1ZUNB 3T06B 3UATA 2QMOA 1W2HA 2G0TA 5AJVB 1WMSA 4C30A 4ARZA 3PCRB 4B71A 1IAQA 4D0NA 2J7PD 1VDZA 4E22A 1KJYA 1W0KD 3QG5A 3OESA 1GWNA 4JYBA 4B76A 1KI2A 2C96A 4B43A 3IO5A 2QT0A 1NP6A 3QXHA 4MDEA 2XXAA 2AL7A 2CK3A 3K9NA 4HLCA 1XD9A 3QVVA 5FBQB 5B58C 1T3LA 1VYTA 4BZQA 4AKIA 2J7KA 5CYOA 1XTIA 4DEXA 4WXRA 4JYCA 4D25A 3CX8A 1XJCA 1OXUA 1PLLA 4AD8A 5JCZA 1IXSB 3C14C 1VECA 2W58A 3NEYA 4KVGA 3GP8A 3HR8A 4XSHA 4Q18A 1DS6A 2ZRHA 4OJKA 1U9IC 3G0HA 5FL7D 1P75A 4FIDA 4IOLA 1Z2CA 2Q9CA 1QHIA 4TL6A 1HURA 1KK2A 2MSEB 1R5OA 1RRCA 4LBVA 2HCBA 1M74A 2ZVPX 5CLQA 5FOTA 1QHHB 1U98A 1W49A 2Q21A 1P9WA 4TSFA 2ZE7A 2WICA 1U0LA 4DLYA 3ZD6A 4HUQB 4URXR 2WV9A 2WAYA 4LHVA 1GSIA 3VR5A 4TQ9A 3NDBB 5G40A 4JVLA 3KTAA 3AVUA 3T5DA 3ND9A 1I4DD 5A5GA 2X1VA 2BMFA 2IYVA 4I4LA 1TNDA 1UBGA 4NONA 5LBIA 3ZD7A 5F3WB 1H8HD 5FBVB 1YE8A 2W6ID 4I99A 2REOA 5JLJA 4Q1EA 2CLCX 3W8RA 3K0AA 1Z08A 1AN0A 2L0XA 4IOJA 5TDHA 4HZUB 1OPXA 1P5ZB 4QBGB 4JBYA 3WYFA 2QSZA 3CZPA 3OEHD 2V1XA 3AF1A 3QXJA 3ZZUA 4D26A 1U9IA 3EW9A 1XCPA 5L3VA 3K70C 3SYKA 1MO6A 3TIFA 1JXOA 1SKQA 3LXXA 4Q1DA 4IXMA 4HDCA 3SN6A 3TR0A 4EFMA 6Q21A 3JVVA 3PUWA 5J4HA 3ICQB 1T5LA 3W3AA 2F3RA 3B85A 2RHDA 1Q21A 3AF4A 4ASUD 2C9YA 2BWJA 1YQTA 1JR3A 1E2IA 3GEEA 5EZ6B 2B8TA 2CCGA 2QMHA 4XJXA 4A6XA 5J4KA 3SS8A 1YU9A 1E0SA 1R4AA 1ZNWA 2C95A 2ZRMA 1J90A 2V7QA 2ZITA 2ZRBA 4U00A 1FMJA 3C8UA 1YKSA 1W47A 3CONA 3V9PA 4YC7A 3S1AA 3A1UA 1SXJA 3B9QA 1JQLB 4YQFA 3SZRA 4IJMA 3T61A 3AEZA 2JJ2D 3T1VA 1L7VC 1MRNA 3WMEA 1E2JA 3A4NA 3P26A 3CLVA 2I3BA 1HY3A 3QPVA 4BFWA 4I1SA 1YJ5A 5DO9A 4DSNA 1WB9A 1ZMXA 2FF7A 1CJTC 4XWAA 2PMDA 3EA5A 2XGJA 4KI0A 4A6PA 4F93B 5FTLA 1ETUA 4KO8A 1ELOA 4UXJA 2GEVA 4X8MA 1HE8B 1QDEA 1FP6A 4I1OA 4JKYA 2GJSA 1FZQA 3CR8A 1G7CA 1LW7A 2ODWA 4FMDF 1XBTA 4HLUA 4IOMA 1Z3IX 3Q72A 1U81A 4BFVA 1WBDA 2WBLC 5F98A 1GRRA 1S9DA 4ERNA 2ZJ5A 1D8TA 4KJZA 1W36C 4C2UA 3QNUA 4WOPA 2R2AA 3WRYC 1LFDB 4TLAA 2KBFA 3RABA 5AUNB 5L8VA 3BFVA 1N0VC 3ZYCA 4A9AA 3ASYA 3FFAA 1XD2B 2WSSA 2P5TB 1P62B 4Q9HA 3VKHA 3I5XA 5UKDA 3CRRA 5KNDA 2QPOA 2HT6A 1EWRA 1S2MA 1E0JA 3ETLA 2ZE6A 3QXSA 4PFSA 3X1ZA 3GD7A 1M7BA 3IUYA 1J99A 3V4FA 4DDVA 3AF0A 4JLJA 3B82A 4RSGA 5FPSA 5BN3A 4LV8B 2FGJA 1RIFA 2DWOA 4UNPA 5FBRB 2AHOA 3R7WA 5FBWB 3KJHA 4WZ6A 2ERYA 2F1JA 2OBLA 4IEEA 1IXZA 4YDHB 5CIWA 1LV7A 1X1RA 3FGNA 2EFGA 3U3OA 1KI7A 2AXPA 2D2EA 2ZRAA 4V0NA 3U2QA 3AV0B 1GL7A 4LHYA 5GJCA 2GJ8A 2IYWA 2QU8A 2V8OA 5DLQC 2FWRA 2ZYVX 1R8QA 4M22A 1H65A 4L4UA 4JLMA 3DMDA 1COWD 1UEIA 3T1TA 1U0JA 3ZVNA 1E2FA 1ZP6A 3I92A 3SOPA 2J87A 1NLYA 1XMVA 2J0QA 1XZQA 3CKLA 4PXAA 1KIMA 1H8EA 2CVFA 1E0AA 3T1OA 5EE5B 3FKSA 4OI2A 1AS3A 4M1WA 4MRPA 4US1R 1GNQA 1TQ2A 1G7SA 2WKQA 5CDFA 1CJVC 1RRGA 2BJVA 1UKVY 5SZKB 3RSLA 1N6PA 2BCJQ 2P2LA 5JWHA 1FTSA 1DO0A 4W5WA 1KI4A 4F92B 1ANKA 4C7OA 1ZYUA 3OIYA 4KXFB 1GUAA 1KI6A 3DVLA 1OXXK 5EXXA 2JEOA 3TSZA 1KAOA 3IIJA 4JLBA 4NTZA 1XTKA 1Z0KA 2PLRA 3BK7A 1FOEB 2EVWX 3RS2A 1E79D 4EJSC 3VAAA 2XJ9A 5L3QA 2BIFA 4NPHA 3OIWA 1XTSA 2CNWD 4CIDA 4BLQA 3NHBA 3P4XA 2NIPA 5KSPA 2Z5FA 1U8ZA 3UK6A 5FUWA 4QM6A 4G01B 4XWKA 3W6NA 4DIDA 2ASEA 4U5XA 1BH2A 1QBKC 1QHSA 4C0QC 4QNMA 3Q3JB 4WZBE 5KSZA 3MWLA 4AK9A 2ORIA 4MGYR 2O8EA 2YOGA 1OT3A 3C7KA 2EU8A 1ZW6A 2ORWA 3JVUA 2V9PA 4PO8A 1N0WA 5BYKA 3GEIA 5E3HA 3BORA 2WM9B 1Z47A 2V6IA 3FKSD 1EFCA 2VPPA 4DT1A 3M6AA 1P6XA 4TMKA 1G3UA 1XX6A 1O3YA 2IUUA 2VLIA 5EE9A 4FMCF 5KDLA 2F1RA 1NF3A 121PA 2DB3A 2R6GA 4AG5A 3OFNA 3FHOA 3WBKA 1RJ9A 3CX7A 3F3YA 5LDDC 2EWWA 1TQDA 2IC5A 1E2PA 2P67A 3ZQJA 2FZLA 4NYMR 4HAYA 1XTJA 5BYJA 4B3DA 1E0KA 4KLZA 1LF5A 3AVPA 2GF0A 3B1WA 4DRZA 3ADDA 2BEJA 4CEIB 3VTKA 3DMNA 3SEAA 1G4UR 4LJ8A 4DZZA 3IO3A 4OQXA 5DI3B 3B6EA 1FX0A 1AKEA 4WAUA 4DVGA 3LQQA 2YWFA 3CR7A 3K0CA 3M4YA 4MKHA 3ZVRA 1I2MA 4MKIA 3LD9A 2CL6X 4TZ6A 1Z6TA 1E9EA 3BFXA 1YR9A 5KUTA 3W5IA 4TL7A 3GLIE 4PX9A 1BOFA 2ZS8A 3QSYA 1AZTA 2G83A 1XJ0A 3L8YA 2GVZC 3PVSA 4LJ6A 2QP4A 1E94E 1LS6A 2ONKA 1J8YF 1F60A 3N2EA 3C5CA 4YMUA 2VP9A 1ZM7A 2QENA 3X1XA 2JJ8A 4AYXA 1XXHE 2O52A 5F2EA 5EP1A 2XITA 3K09C 4D0GA 1IONA 1KTVA 1XPUA 1KK3A 4E09A 1YZUA 3TUZC 2UZ3A 4XIGS 2RMKA 2O8FB 4OI4A 1Z06A 1JR3D 4TLDA 2DFNA 3HJNA 2TMKA 4M1YA 4PC1A 2IT1A 4NHOA 2GCOB 3AVXA 1L8QA 5DI3A 4P3YA 3THWA 4KV9A 2W83A 4BFZA 1WCV1 4AIIA 2JDID 4LJYA 1SXJD 1ESNA 3HDTA 2JGNA 4PQYA 3ADKA 5CJ2A 1W0KA 1VCIA 4IDNA 4CZ2A 4XTRA 2ZJBA 1ZIPA 1UPTA 3I4LA 2BBTA 3UG6A 4Q7JB 2GCPA 2OCPA 1NBME 2R8RA 1NRJB 3PG5A 2F55A 1YZQA 3H1TA 5DSZA 4KFRA 3HU2A 1E4VA 1KO1A 1XD8A 2ZTSA 3LX5A 1KDPA 2CCJA 2B7CA 4UNSA 2CE2X 1E9AA 2OXCA 3KJEA 2ZQ5A 3O8CA 4CEIA 2W2TA 4PC2A 3KZ1E 1M6NA 2D7DA 2AFIE 3Q7QA 3K0FB 5P21A 3VKWA 4EPTA 1T4GA 2IUTA 3PITA 4B34A 4WVFA 2JLZA 2NPIA 1NMXA 1Z6AA 4L8GA 5FOXA 3QKTA 1FNMA 2VHTA 4ABYA 4JL5A 1LB1B 1ZJ6A 3NC0C 4M9SA 3AVYA 3A36A 5DYGA 2K5UA 3TH5A 1J7KA 2FFQA 3RRNA 1G64A 1NN5A 2ERXA 2EFCB 3QPUA 4TTPA 5C1BA 1X1SA 2D3WA 1ZINA 1W5SA 1ZCAA 3IIMA 3TSWA 2A9KA 3GFTA 3PEVA 1GDDA 3ZVMA 2O8BA 1W2GA 4JLVA 4Z54A 4ZIRB 3U6BA 5EP2A 2B92A 4HLQB 4MGIR 4BLRA 5J4LA 1NNEA 2C8VA 3PV0A 1EXMA 3H86A 2XX3A 4Q1FA 5KSOA 3AB3A 2O8DB 2FZ4A 3LNCA 4MYCA 3B13B 3CH4B 2ATXA 1E2LA 1GKYA 2X2FA 5D3QA 2P5SA 1M8PA 5CITA 4BE7B 2WMNB 3QVUA 1I4TD 1F2UB 3ZGXA 4EPYA 3FMFA 1U90A 2OILA 2BVNA 1S9HA 1E9RA 2BV3A 3ZIAD 1JBKA 3MJRA 3MRSA 1NSTA 1SVKA 3KDSE 3SBEA 2RHMA 4URWR 5B30A 1IY0A 4LJAA 2J41A 2AR7A 3MUFA 1FFHA 4LOAA 4Q4HB 1W4AA 3FKQA 2OV2A 4B6FA 4Q9KA 2FFBA 2OCAA 3I73A 3UWKA 2DBYA 2DYKA 1E1QD 2YNMA 1S8FA 1Z5ZA 2YZ2A 4M1OA 4RD0A 4XVUA 2VH5R 4DJTA 3BOSA 4JLPA 2QY9A 3U3RA 3EC2A 4N1AA 4OHWA 4PQRA 1NG9A 3OAAA 4BFUA 4YONB 2R65A 3TVTA 5LPNA 1RPZA 3RC3A 1Z22A 2ZI3A 4XOIA 4IXNA 1BS1A 1Z0JA 4JLKA 5IK2A 3AF3A 3PQCA 1HQYE 4LBYA 1E9SA 1WQ1R 4TYYA 1GKUB 1KDRA 1OYYA 1MT0A 5E7IA 1K6MA 4DLSA 2Q9BA 1C1YA 4M1SA 4C0SA 4CYMA 1D9XA 2KI5A 4D80A 5HZKA 1QG2A 1IY1A 1E2EA 5F9FA 5FOUA 3U44B 1OHHA 2JAQA 1JJVA 1HYQA 1XB2A 2HLDD 3F5FA 4BUJA 1SXJE 5C18A 3FPAA 3KUCA 1JNYA 1S4QA 3CF2A 1II8A 3UMRA 4ZCMA 3B7GA 2Z4RA 2IYRA 4JLNA 4HB0A 1OSNA 5SZHB 3W8NA 2IL1A 4MYTA 2D2FA 1TU3A 3BJIC 4BFYA 3IHWA 3ZJYA 3BB3A 1TUEA 2J0VA 4C2TA 1ZC4A 3KXKA 5AR1A 1SKYB 1JAIA 4W5JA 2XEXA 4IVRA 3EA0A 4LZZA 2ONJA 4XTCS 3CWZA 1G9XA 4BFTA 1KMHA 3CNOA 4JL8A 3TSOA 1J70A 2VSFA 2XNSA 5FOWA 3FHCB 3KQNA 2OCBA 4NP6A 3U3KA 4A8JB 1FUUA 2CEAA 721PA 1CR2A 2NO7A 4XVRA 3AKDA 3UXMA 2BHRA 1NBMA 3KKQA 4TT3D 1IN6A 2UZIR 4DCVA 3V4RA 1TF2A 4V0OA 1KNQA 4NU0A 1SGWA 3SYNA 2ZJYA 5JSZB 2R6AA 1JQJC 4A15A 1WBBA 4LBWA 1COWA 3R8FA 3EZ2A 3QIAA 2VHUA 4HB3A 4TTRA 5JRJA 4D82A 2HUPA 4LYAA 3SU8A 1LTQA 3I5YA 1YZTA 1DAEA 5HE9A 4GZMA 1NVVQ 4MUAA 3LW8A 1R5BA 1UKYA 2KSQA 4H1UA 2QGNA 3PR1A 2C98A 4JBWA 3SQWA 1CEEA 4QGFA 1AJEA 1IN7A 3GLFA 1R10A 3MFYA 3EPKA 1Q1ZA 5C46F 5B2ZA 3QF7A 1N6OA 2OE2A 4K8OA 4AURA 3U7GA 1NIPA 2WJJA 3EPLA 4KBGA 5LB2A 1VIAA 4MRVA 1M34E 4F4CA 3IDQA 5H1YA 2FE4A 4OK6A 4C7OB 2QGZA 4QM7A 2XZOA 3R8CA 1BYUA 4Z1MD 3SYLA 1E79A 3SFZA 2QUZA 3LLUA 4LHXA 3GJ6A 2GF9A 4PPNA 2QORA 3FYHA 2GKSA 3AKEA 2CVHA 3AVTA 2G1KA 1GTVA 2WOJA 4D81A 2ZYUX 1KSHA 4YDSA 3R9IA 4JSTA 4YMTA 1G17A 5DE3A 2GZDA 5KDOA 3OE7D 5KNCA 2VSOA 5FTJA 1DTSA 3BB4A 1II8B 2IBMA 2X19A 1KO4A 1CXZA 4FN5A 5J47A 1NI3A 3AUXA 4DEYA 2C77A 3EPJA 2QE7A 1OKKA 2YVUA 3MD0A 2F3TA 4UNQA 5FUXA 2XZLA 4RD3A 2WAXA 3IIKA 3P32A 1YHNA 4RVCA 1GRQA 5JCPA 1CULC 2ZJ2A 3EWSA 2DWPA 3THWB 4PO9A 2WKPA 1UKEA 3BAFA 3BRWD 1E9CA 3WXMA 4D4JA 1T5IA 4Y0AA 1XPOA 4FCTA 1JECA 4BEJA 1X8JA 3A4MA 3WNBA 1EG7A 4O2LA 4QOSA 3THYB 1DAHA 2A5GA 2WZQA 3QKSA 1GL6A 4BZPA 1P4SA 3CBQA 4R7ZA 4A92A 3FFBA 3MSXA 3H0KA 2ZEJA 5HZHA 1OB2A 1Z07A 4BEBA 2DCUA 5JI3E 3U6KA 5A0FA 3H84A 1XP8A 2ZI6A 3T34A 3M1IA 4E5UA 1W0JA 2C2HA 3W90A 2EYUA 4UJ5A 5CJPA 4LGMA 4HZUA 4LV6A 1KJWA 2IS1A 1G1MA 4NYIQ 4G1UC 1XF9A 1BIFA 2AWNA 1PVOA 5TARA 1CRQA 4WA7A 1KY3A 4KAXA 2RGGA 1MRSA 3E2IA 4TQUS 4G5RA 2OM2A 1FUKA 3B60A 4ACBA 1U2RA 4HATA 5IRCD 3LAWA 1UDXA 1JB1A 4Q66C 2GCOA 3QENA 4M53A 1EFUA 4ZKDA 4K81B 1OFTA 2NO1A 3CF0A 4X8LA 3CUEF 3VU9A 1GVNB 4URZR 1P7CA 1DBSA 1JPNA 1KJZA 2HJGA 2IS2A 1E1RA 1XDBA 1IJFA 1AIPA 2QAGA 4TYQA 1CJUC 3OIVA 3KQLA 1QHXA 2EWVA 2JA1A 2RGBA 4ESVA 3BXZA 4GDFA 1E4YA 1QRAA 4QGHA 2ZPTX 3WNCA 1T3HA 3ZH9B 4C4PA 3MMPA 4BLTA 1V5WA 3SJAA 2ANCA 3LDAA 1VG1A 2IYXA 1T8UA 2AK2A 4JL6A 3GJ7A 4YMWA 2BEKA 1KKLA 3NEJA 3GLGB 3GJ0A 2Z6VA 1WRBA 3GLHB 2ORVA 3BFKA 3QKSB 3CZQA 2IWRA 1KK0A 1VHLA 4P32A 4EJSA 1LF0A 4P31A 3BGWA 1WDTA 2JJ2A 1N0UA 2XZPA 3LX8A 1DPFA 1EK0A 2DR3A 4L9WA 3Q5DA 1GAJA 3HU3A 1QHGA 3NDPA 2IHBA 2ZR7A 4QBIA 2F43A 2HLDA 1AK2A 1IN4A 1CR4A 1Q57A 4D2IA 4ASUA 5AUOB 2XSZA 1Y3AA 3AH8A 2F9LA 4MQBA 1F6BA 4OI0A 2W6JA 2ZU0C 3X1YA 4DSUA 2GILA 1E69A 1Q1QA 3REFA 3LBNA 3GLHE 1NVUQ 5GVSA 3IBGA 1YZGA 2WJGA 3H4MA 4C0AC 4LRWA 1UADA 4R98A 4Q19A 4DBLC 1A4RA 1Z6YA 1TQ6A 4TMTA 1R5NA 2O8BB 5FTMA 5KU1A 3Q9LA 3P20A
chains in the Genus database with same CATH superfamily
4BQIA 2EKDA 4Y7DA 3THOA 3Q6IA 3MJSA 2E18A 5GONB 2NVBA 4B4UA 3Q9NA 2IBTA 2BP7A 5KTTA 4EGSA 1JIJA 3VU9B 3AEQB 2PANA 2BEUB 4R05A 5GWXA 5COBA 5I01A 4KR7A 4B7UA 1Y4AE 1Q50A 4MUIA 5KEIA 4XFDA 2AEFA 3A6EA 1W88A 4O4LB 4R7GA 2NO5A 4KK3A 3RU2A 3UB2A 2HU8A 2QXTA 1T36B 2A9PA 4G5SA 2D1RA 3FDZB 3KEMA 3LSTA 5DIFA 1DFHA 1FQKA 5GONF 3WGOA 4RVSA 3DDZX 2XMPA 2CNOA 4FPXA 2XMRA 3OOEA 3Q3VA 3RLFA 5JDIA 3N2IA 4X65B 3NXSA 4PN3A 3CYFA 1P2GA 4C22A 5TF4A 1BGWA 1DAMA 3PHBE 1QVRA 3G8BA 4G0PA 4NYJR 2JLXA 1OB5A 3GIDA 4NFHA 5GZ6A 2EW1A 3U3ZA 2O0HA 2FW6A 1IIBA 2FPWA 4Q4LA 5JMPA 4AKHA 2YYZA 2P5UA 2QLLA 1Z15A 3B3FA 5ADHA 2CLIB 4IJWA 5F4BA 3I62A 1NJGA 1SVMA 2PX3A 4RD1A 2J46A 4HY3A 4YP6A 3W5DA 4BWYA 1MO5A 4MJ7A 3EQZA 4GZLA 2ZYIA 3OH8A 1UOPA 4U2KA 2WSSD 4B6JA 4W9MC 4MQ6A 3SQNA 3QUQA 1OBHA 3SGLA 4R2KA 4GR9A 1U28C 1R4ZA 2V4UA 3KXPA 4QRIA 4BU0A 3JWGA 4YV1A 1RXUA 1EIWA 1SOAA 2AX3A 2I5PO 3LGSA 1GAXA 1E7MA 2XWJI 3PDHA 1MOQA 1SHLA 1QG4A 3E9EA 4MRNA 3EEFA 3FMVA 4A8JA 1EAMA 1VCMA 2D13A 4F71A 3ZDAA 1YOVA 4RVFA 1WEHA 4E46A 4JLDA 3GLIB 4E5NA 4PZCA 1SQSA 2VPQA 3MTGA 1D9ZA 1SXIA 1P7PA 1XQVA 2SCUA 3ILYA 3KPWA 1FS4A 4LSWA 4Q1AA 4WZBA 1DOAA 5DN9A 5HKOA 1KYTA 3GRUA 1Z4IA 3P0RA 4G1EB 4ARCA 3B1FA 1E64A 4OKSA 1R8JA 1XTBA 1Z0FA 4E5KA 1AA6A 4H4DA 3T9FA 1RTTA 4YAOA 2I2XB 3ZI0A 3F9CA 1EYZA 2PMFA 3DV0A 2R8OA 1WSBA 4MQFB 2EFJA 3IVCA 2VZ8A 4Q9DA 3K0AB 2QRZA 2A9QA 3ECAA 3KQHA 3KFLA 3ZLUA 4DW8A 3GFOA 3LO5A 4Z7QB 1GU1A 4RMIA 4GP9A 4XSGA 1XCBA 1TTTA 3GBPA 1XTQA 2JATA 3CLHA 3GJ4A 1N6NA 4N9QA 2JKVA 3IJPA 1H2AS 4OLFA 2QAIA 4MW9A 2ZUBA 1SA0B 1SB9A 1SU8A 1ZOSA 4IGEA 5DGTA 4OG2A 3T6KA 4DMCA 5B5SA 2R1VA 5JBNA 4JBXA 3HADA 3ANYB 4MCAA 2D62A 3UXHA 2BISA 2OO3A 5CRIA 1LDEA 1YZVA 5M7EA 1Q2UA 3ZY6A 3E9MA 1DL5A 1GQRA 4EJ6A 1MG0A 1G5TA 2REQB 3ZGOA 4C4OA 2QRLA 3J7TA 4HDKB 3WADA 2PUAA 1A2BA 1ESZA 4FN4A 3UMSA 1ORDA 2AN5A 2O2XA 2FN9A 2E87A 1KXZA 3ORYA 3QY0A 5M3BA 1MX1A 1R6XA 4JYMA 3GEDA 3HVIA 4URYR 5F4ZA 1X6VA 2I6QA 2BBWA 1EUCA 1XEXA 3V34A 4GSYA 1XU7A 2FCRA 3H6GA 4MVJP 4U7TB 3UUFA 3VO8A 1EK1A 2XWBF 1EVYA 1AK9A 2B30A 2O2ZA 3CUVA 1BKSB 4FEAA 4HX2A 3MLBA 4FX5A 4LC1A 2I1LA 4S24A 2V55B 4CT4B 1Q1BA 2CFSA 3HKCA 4V0KA 5ITWA 3VDRA 4EI9A 3JAKB 3LKZA 1YFZA 5FL3A 3AU8A 3WA7A 4AI6A 3NH6A 4BPRA 2VTEA 3I5UA 1INLA 4ZEVA 3WQRA 2OORC 2QW0X 4J0GA 3GVHA 2PJRA 3D3QA 1H05A 2G76A 1VCNA 3TBFA 2P6OA 3F97A 3AEKB 4HLUC 4PFJA 4YJ3A 4EA6A 3KSRA 4UDXX 2QIOA 3F4BA 3BF8A 2PYIA 1VC2A 4ZVVA 2ILTA 4EMSA 1Z4JA 3R44A 2RIPA 3F8TA 3KYIB 4NL4H 4UEQA 1ZUNA 5HTOA 5TQ2A 2F43B 4WKCA 4BNUA 4HAIA 3L79A 2G9UA 4EPRA 1PE0A 1HL7A 3D8BA 3OE7A 3QELA 5DBGA 1VI6A 4WW0A 1L4EA 4WWHA 3QMPA 3OQPA 4M6WB 3D8UA 3M5CA 1AV6A 2XYQA 2SHKA 2DPMA 2IYTA 3O8DA 2PUWA 3SFVA 2VJAA 1HEUA 3GCZA 1KS2A 1JVSA 3N0TA 5AVVA 1TCCA 4RGQA 3IKVA 5TGTA 1SVSA 5B4VA 4PANA 4EYOA 2Z43A 4D8VA 3GW8A 1BX1A 1XYVA 3C2QA 4WHMA 3RHZA 4QYSA 4BV9A 3KOZA 3JQ9A 1PD1A 5FNZA 3T12A 3A28A 1SUWA 1O6BA 3QWHA 3SXJA 4E88A 4ZI3A 1GZHB 2DKFA 4L57A 5FOVA 2XA1A 1WUTA 2QN7A 3DTYA 2AG5A 3P2YA 2BOVA 1HWYA 1EFDN 1FCJA 1OLSB 3PX3A 4K6FA 1D4ZA 1KMNA 4CMCA 2GCIA 3QJYA 4UQLA 2P75A 5AK0A 3ELUA 2C0PA 4JWKA 2WIAA 1E7QA 1FL9A 4MVXA 2XRYA 5AVWA 2EP5A 1VOTA 5FFFA 1GPKA 3MMNA 2IYAA 2FMIA 3EAQA 3N05A 4D3DA 2W2XA 4PG7A 3L4BA 5DN6A 4E31A 2QE7D 3HP4A 4EMUA 2Q28A 2V3VA 3LT4A 2F48A 1UJ5A 2I0FA 1PLKA 3MWDA 2JJ1D 2WJAA 3WP0A 3G0DA 4IKEA 4IOKA 2HUNA 1CY8A 3GOHA 2J4CA 1L5OA 4RVNA 2WWGA 4KREA 4IRUB 1WUHS 1ZUWA 3TW8B 3ZNNA 2V7PA 2ZM5A 2PWAA 3U37A 1HE3A 4LYJA 5I9SA 5HZMA 3KOXA 1OI2A 5A9TA 4XYLA 2Z6UA 1YS1X 4MVJE 4B46A 4CE6A 1EJ2A 2GTHA 3DW3X 3FWYA 3FVRA 1P7YA 3Q3CA 2NZ8A 4J7AA 3VNUA 1U9YA 2G6BA 1G0NA 3ONVA 1B8OA 3KR0A 3FROA 3K9QO 1WHSB 4GW3A 3B53X 4HFJA 2R1TA 4QNRA 5C8DA 1FFSA 4BQEA 1W4BA 2YMLA 1GNRA 5FPHA 1IJKA 2WUGA 3PI7A 2I4TA 2XNDD 5A06A 4FNOA 5IC5A 1BMDA 1XU9A 4CF7A 4JOBA 3KT0A 2CJPA 2Q6VA 1Z4PX 5JALA 2AFIA 3FTQA 3IEPA 3M81A 1RCUA 5JRZA 2JVKA 3FMGA 2WWTA 4FC6A 4TV9F 1P0IA 3LQRA 4KQFA 3WRXC 5K7SA 5BN1A 3C6MA 3KXDA 3LRXA 5BQOA 3H9GA 2G0NA 4JEMA 2BHTA 1YOVB 4EQ6B 4LYDA 1JIKA 2XPCA 3TRFA 3A4LA 3ICEA 3RUHA 2HM7A 4P4NA 4R71A 1T4MA 4EK9A 4QTYA 4CTKA 3EYAA 2ROQA 3WWPA 1MHTA 4FCVA 4TTIA 4B44A 5DISB 2A7XA 1HG1A 4W8HA 2ZXUA 4CWAA 2ZRFA 4ZQIA 3NWEA 1G8GA 2Y1OA 2CFOA 1KE1A 3RYHA 4QPJC 2R66A 4I2VA 4IG9A 4WADA 4OHMA 5EE0A 3UTCA 1AM4D 2FSHA 1IOZA 5FV7A 3AT1A 2DFKB 2YN0A 3KR2A 3LA6A 2EERA 4TLEA 1CUUA 1SCJA 3FE2A 2PSSA 1N2ZA 1UBCA 5AK6A 1HNXB 4I1UA 1AKRA 5A03A 1QOPB 2BFDA 3H17A 1JQAA 3RFTA 3L7OA 3QKRA 4S2EA 1MO2A 2GVDC 2ZI9A 1QO9A 3KLPX 4XUDA 5DBEX 4YWHA 3W05A 3MRVA 4IX1A 1DZ3A 3V55A 4JSYA 4G3XA 3SBOA 1RWQA 1TOAA 4BNJA 5IVDA 1KK1A 2BDTA 1GUYA 1V4NA 4JJKA 2Z4SA 1KQPA 3PDUA 1MIOA 4UHHA 1TZBA 2JCSA 4XFJA 4UTXA 5HTKA 3TL3A 4N76A 1P60A 3N39C 3AM4A 1MAUA 2FPKA 4JVSB 1RJGA 2D1FA 2JKZA 3M83A 5TQ0A 1HMPA 4DBLE 2VIIA 1HDEA 2VNKA 1E3DA 1U1IA 3B7PA 4JLSA 4PYRA 2JB9A 3UAWA 3WGKA 4OB7A 2ZYWX 3CLTC 4IJ5A 5H02A 4H1TA 5L3RA 3LIIA 2WFLA 1ZNQO 4TKUB 3FUUA 3GLIA 3DZDA 3R5TA 3E7WA 4GPBA 3I6BA 2DY1A 2VJLA 3JV7A 2A92A 3C3BA 1DTWA 1RBYA 3MRXA 3TJMA 4BCCA 4B8YA 1IZZA 1S3SA 2RH5A 1XROA 4CETA 5FLYA 4D79A 1Y34E 4UOZA 1DDGA 4PC7A 2ZUTA 2KBEA 3ZCTA 1GPH1 1U2EA 4BRWA 2JIZD 3WMGA 1E5QA 3JQGB 1PW7A 2FA9A 2VS1A 5HNKA 4BDTA 3GF4A 3K2IA 5EUQB 1Y0BA 3FUWA 5CJJA 1MCZA 4K0RA 2EATA 1QCYA 2ZBDA 2REBA 1X3SA 2UXBB 1N92A 4RJ2A 5BN5A 2O2DA 4MIYA 3D1JA 3K09A 2RGDA 4OQMA 4U0KA 4E1VA 3OLQA 3LMKA 1MLDA 3FMIA 2IUSA 2YN4A 3RYIB 3FPEA 5LOVA 1JEQA 4MI6A 4Q4AB 1O5OA 1E6KA 2XAUA 1P39A 4LUCA 3ID6C 3SHWA 1Y9JA 3ZHOA 2EEPA 3S7ZA 1ZRMA 3EXHA 2PZEA 4B3TB 1YTUA 1GFSA 3Q8XB 1TEVA 2CD7A 2GJKA 2PR2A 3DT9A 4FWBA 1ZDMA 2J9XB 4BWVA 2PRYA 2C9MA 4M6WA 4RTMA 1UBSB 1D6JA 1EM8A 1JYSA 5E9QA 4IFBA 5BO5A 4MPDA 4ZVSA 2AOVA 3CIOA 3HZZA 3SYRA 1JMKC 3NHMA 1CK4A 1NVMB 2J6CA 3I09A 3KJGA 3FCUB 1I36A 4NX2A 1L1FA 4FFPA 3SX2A 1IMJA 1IUPA 1KMCA 1N3YA 5CDHA 5EY5B 1OR8A 2O1WA 3LZ6A 5ETJA 4X97A 1ETHA 1PW5A 2XODA 3TD2A 3UPTA 3ONNA 4S0XA 2GWRA 1YFKA 3WP1B 5C1OA 2JK0A 1NJ1A 5IHXA 4OV6B 3D6HA 1Z63A 1YBMA 4C0LA 4PLGA 1FRZA 3M6UA 4O5OA 1D2HA 1ZMOA 3WK6A 3GT4A 1JMVA 1FDWA 3GRKA 3OTGA 1SJ9A 1K08A 2WJ4A 3AVQA 3E7XA 4G81A 5LXTF 1BU8A 3ROTA 3SF8A 3DP7A 4WBSA 2C4MA 1Q0RA 4LJLA 4CM9A 4M1KA 1AS2A 3RVMA 3GLHA 1LSUA 4PAMA 3I2IA 3A1VA 3C3DA 3NGXA 3PUIA 2RBGA 4PYLA 1JLSA 5IDVA 3LQFA 2QSUA 1KMHB 2NUPA 3K8ZA 3KE8A 1A82A 2HBRA 1QFJA 3TIVA 1U0SY 3QXGA 4BMCA 4Y6GB 4NCXA 2O7NA 3H1PA 1PR5A 2R751 3DFFA 3HP1A 1KKUA 4WY5A 4G5QA 3DGFC 2YN2A 5CU7A 4BGDA 1KY2A 5IYZA 4YRIA 4DGQA 4HNTA 1BW9B 1L0BA 1S96A 3H13A 3MVEA 3R7WB 4P86A 3R75A 1IAVA 2EFHB 3NUQA 1A7AA 4RPLA 1DGQA 3W5SA 2O3JA 3HGMA 1D7AA 4PXSA 1WF3A 5G2OA 3S2EA 3N2GB 3I8XA 2GT1A 1PFYA 1AQUA 1PL0A 3TOVA 3TOZA 4ZGGA 4R4JA 4U2GA 3EA4A 2GBLC 1NQOA 2FX2A 4FGJA 4KRGA 4U2CA 4PU0A 3RTEA 4E07A 1I14A 3GG2A 4N7JA 3W7AA 4TMZA 1QIMA 2O48X 4TS1A 3S2IA 4XQCA 5B3JA 5LYJF 1K7CA 4QOIA 5JQWA 3I1JA 1SURA 3AILA 1YA8A 4RGYA 4WCDA 2UDPA 2WUFA 4QT4A 3U44A 1R6AA 1YQUA 2O6HA 4X3OA 1QH0A 4X1YB 3FCXA 3GGDA 4B4DA 3NVMB 5KAPA 3I0MA 1H4QA 4L85A 4QEDA 4UPVA 5CNMA 3RANA 1QTIA 3AI1A 1UWVA 2XXJA 3TGWA 3IP5A 1KZ1A 3OPYI 4RACA 4EITA 3U09A 3KPVA 5AHRA 4XM1A 1OLUA 3DS8A 4GPTA 1JILA 1ABFA 5IS2A 3IGFA 4DBVO 1BHQ1 2B9VA 1KY5A 2NUTB 3W34A 2PT9A 1I3LA 2UKDA 2IA5A 4TLLB 4WUVA 3TG2A 3HHPA 1NLZA 2J45A 5CM9C 5F9MA 3LHIA 2XOKA 4Y1GA 2I91A 3JQAD 3HNPA 1AHHA 3BMOB 1FNSA 1T6NA 1ML4A 2R6DA 3IA7A 5AESA 2LE0A 5IDQA 3X0DA 3E5RA 4P7KA 1NBOA 4LN1A 4EX6A 4OQPA 2VP0A 3WGHA 1L7OA 1L7RA 4DV7B 4HNSA 4XD7A 4OJQA 5EXTA 3OOHA 1J2JA 4OHVA 1EBUA 5KB3A 3UTDA 1LBSA 1TLFA 4MEBA 4JX9A 3D4IA 2NU6B 4KLCA 4HAVA 4N3NA 2RC6A 1RLUA 4TXJA 3N6RA 2JLWA 3MOIA 3MCZA 4OQLA 5JSKA 1KI1A 1NMEA 1RYNA 1COZA 2QAGB 3HKEA 1TVMA 2IQIA 4MRRA 4O4JB 4QGAA 1C81A 3EXG2 1FDUA 4OYRA 4CTNA 2NVUA 1TL7C 1E9DA 2D59A 1P1RA 2IXFA 2JGDA 1N9KA 2O1XA 2HQBA 2Y0EA 3O9ZA 2DY0A 2GM5A 3BKWA 3C6YA 3FI0A 4UDOA 1C9KA 4P5DA 4FQ5A 3Q15C 5MHTA 1FPMA 1GZ3A 1U94A 1Z28A 5HOQA 2RHBA 2ALJA 2FMKA 3R6WA 4OHXA 4B74A 5BSWA 5KNCD 2RB4A 4JNKA 4LSGA 5IZCA 5CDFE 2DAPA 1WMEA 5TQ0B 2JG3A 4UTRA 5CXQA 1E1DA 1GGMA 2IW1A 4CLDA 1IN8A 1GIAA 4MVJG 3SKXA 4JOCA 2RB5A 3I34X 2QVXX 3IXLA 3ZBQA 3AW8A 1WOMA 2ZS7A 1ZD4A 4HAWA 1X15A 1ZM9A 3B6MA 1JG6A 1KPHA 3TMKA 4HAZA 1M67A 3JVDA 2ZDGA 4A0SA 1PDOA 3GPCA 3GQBA 1GZ7A 2JHGA 3HCFA 3JQ9C 1EVKA 3EVBA 3PC8A 3PTZA 2VWHA 4M21A 5ALQA 5JNUA 4PNZA 5AJYA 9LDTA 2QRMA 5AKHA 4ECEA 2TSYB 5JZMA 1N2IA 5D5QA 3MAAC 1SN7A 1QV6A 2IOYA 4QHYA 2HU5A 5K51A 4UVIA 3ZNOA 4QE3A 3EXAA 4ZEXA 2DFDA 5AVYA 1X74A 3KRTA 3QITA 3C8MA 4EAAA 3GPBA 3T54A 4TYNA 1GPJA 2X0KA 4FILA 2DGDA 1SIUA 4NPCA 3A1WA 3WFIA 4B3FX 2PJZA 1M6HA 3B3JA 2Q46A 3DEHA 4MW4A 2P4UA 4EMTA 1Q22A 1NUQA 3OM0A 5AQ1A 5FEMA 4CEJA 1MPTA 1XV5A 1YVEI 3H8WA 4YO8A 3MBKA 1QLHA 3IQWA 3LW7A 4HO1X 4QA9A 4NU6A 5ITSA 3HCWA 2QLFA 1H2ZA 2CJWB 3BGSA 3L1UA 1S2IA 1GGFA 3HA7A 3O2SB 3HO6A 4GMXA 4NV1A 4MGEA 1ORIA 2PYDA 4Y6SA 3W0LB 421PA 5JXHA 3K70D 3HBJA 1E92A 2PUGA 1ZLYA 2Q3MA 3QJGA 3SI7A 4AP5A 3PJDA 4E14A 3IUSA 3PE4A 1AXGA 4NCAA 5D5HA 5IARA 2P8SA 1Q7RA 1A96A 2NWQA 1QHEA 2FRVA 1F5NA 2WJIA 4B3GA 3BSSA 1DAIA 4J4HA 3VZCA 1C3XA 1Z6QA 5A4KA 2NO9A 3ESQA 4G8JA 2HJ9A 3QFCA 4ENQA 1CUBA 4OHYA 2ZXFA 1UDWA 2I2FA 3ENQA 4FB5A 3CSSA 2P2NA 2R6CA 4J0KA 3SJUA 4LK3A 2L2QA 3SY8A 4WNIA 2EBHX 5I3ZA 4A36A 2RH9B 3B12A 1ICIA 4INOA 1X2EA 4ML3A 1NNLA 4ME6A 1UBUS 4B9AA 2EF1A 2I2AA 4TYPA 3ZWYA 1MR3F 1FIUA 1MV5A 2HK9A 1B2LA 4H15A 4JGBA 4PRKA 3ZY2A 1SIBE 3K20A 3PENA 1PJQA 1G18A 3KZOA 3ZE8A 4AW9A 1SM4A 5HQJA 4YMHA 4QKQA 1MQ9A 2J0SA 4BFSA 3ADCA 7ABPA 2J0UB 3PQ8A 5GP1A 4G84A 1DT5A 3I8OA 3AKCA 3Q10A 3HPQA 3BXPA 5KJCA 4O0LA 4NMXB 5ALTA 2VQ6A 4B3XA 1Y7TA 3KLMX 2ZJ8A 4OPMA 4PO1A 4QJ4A 2PD4A 4RZIA 3UAVA 2JLVA 7MHTA 4ZJUA 4PPGA 5AI9A 2ZE5A 4L8FA 5TMPA 5G0TA 4NRDA 3ZX4A 5HVNA 3N2GA 1OI3A 3RTGA 2CVOA 4I81A 3VUFA 2BI8A 1A7JA 2YV2A 5GAJA 3UV6A 4O25A 4C01A 3PJGA 4A2PA 4G0UA 4C06A 1YNOA 2J9FA 2ZIUB 4B48A 5TJ9A 3WV4A 1EI9A 2EG9A 1GY8A 5KUTA 5KVQA 2C5GA 2XQJA 4YV0A 2HQSA 3V00A 1O6ZA 1Q83A 1IY8A 3QFRA 1GG8A 2IZ5A 4UBJA 4KRFA 4NDAA 4XWWA 2FJUA 1VIMA 5DPMA 1FMLA 4CDGA 3ZBUA 3K9GA 4PRYA 2VA8A 2WLSA 4XIYA 3GFBA 3PPVA 1Y1RA 5LD2B 1TK9A 3GEBA 4BO3A 4Z49A 3NYWA 1LRJA 4F2DA 5TRTA 1ZM4A 3PIIA 2FW8A 3FCAA 2P7IA 4I50A 4TM7A 1L5WA 1Q3TA 2WE7A 1KJ8A 1HLGA 2GF2A 2I4RA 3V4SA 3GG9A 1G3MA 2AW5A 5ALSA 2GEUA 2VJDA 4FHGA 4Q1BA 4QUGA 1ULAA 3ZX5A 5JJLA 3CPJB 3ETEA 3IEIA 2V54A 2F8LA 5IVIA 2GKOA 2WFZA 3CUSA 5I7OA 1T0HB 1T8PA 5J63A 1WXQA 3U9TA 3OCXA 5AKIA 5LN1A 1N25A 2IYEA 3URMA 3RIEA 3OLCX 2QTHA 3SQOA 3I01A 2GNPA 3W78A 3DO8A 5FF9A 2M1ZA 4ZT2A 4H7IA 2IH2A 1GVHA 1R0XA 1OFIA 1XRLA 4F7DA 2Y1FA 2EARA 6YASA 1Y37A 4ZVPA 2IY8A 2VHEA 2FFRA 3DQPA 1T9BA 2O2GA 3HG7A 2QL5A 1GPWB 1L4YA 2D00A 2R4TA 4LYYA 2K2QB 2HPVA 3QM1A 3WHKA 2Z30A 3OZIA 4O2AF 3S2GA 1LVHA 4FXOA 1UFRA 1OOEA 3FVTA 1JZQA 1OA0A 4GKJB 2OHFA 2C5EA 5BQ5A 2NO6A 4GM1A 3V8QA 1G55A 1OH8A 1Z75A 5AVSA 2PL9A 4YV2A 2C4TA 3PHLA 4PHFA 1SA0A 3BWCA 1SHTX 2FQXA 1NV8A 1U8XX 1FXSA 3FXAA 4RPGA 5B6PA 1H85A 1HA3A 3QOXA 3SX4A 3WRWA 1Z2OX 4B75A 1KO5A 1MDFA 4BEVA 3WGYA 1QS0A 2NW6A 3JAMA 2PKXA 3FTEA 3TAUA 3RVKA 5EE1A 3L0IB 5JFOA 3GLGE 2JI9A 3QG1A 2WHYA 2Y66A 3G9TA 3LFUA 1BDJA 3NB0A 1U0BB 3V2UA 1UXKA 1Q1EA 1G63A 1PR6A 2W6NA 3CSUA 1TRHA 5J43A 1P2BA 2C94A 1Z18A 1AZSC 1TZCA 5TXGA 4DN6A 2YMMA 2ZYTX 4FSDA 5CBPB 2YWEA 1GM5A 2VWQA 5M34A 4M36A 4H7PA 4BMXA 2DU8A 4RH1A 1RQPA 1TLTA 3H3JA 4IXWA 5KCZA 4M9ZA 1FVHA 2AEEA 4D41A 4CDRA 4IIUA 5CVEA 4M2LA 2HBYA 2HIGA 1FU7A 1W34A 3B9RA 3M82A 4KXUA 1V71A 2NP6A 1YR8A 4KYTA 4TKLA 2ILVA 2GN4A 2XTAA 1ZD9A 1LU9A 2ZIEA 2SCUB 3KQTA 1C3OB 4NCNA 3SX0A 3AI3A 1HZJA 1P4GA 1SXHA 2V97A 4R9UC 4XWOA 5C1PA 2HMTA 3BCUA 3KEFA 1SC1A 2Y9MB 3KVRA 3QVWA 2A9RA 2J59A 3FNGA 5LBTA 5EN4A 2UXDB 5F7OA 3KU4A 4HGNA 4EA7A 2BN4A 3E9RA 5ILOA 1BRTA 5DHSA 1SR8A 1Z5VA 1KFBB 3K1ZA 3JD3A 1RRPA 4RZSA 3BIWA 4G36A 3BUSA 3GEHA 4TS9A 3FHTA 4FS8A 4BNTA 4M0UA 1HT2E 1E1CB 3SHFA 4KAFA 4ZGBA 2DULA 3JQ7B 5HR5A 3QTTA 3F6RA 1TU4A 3CLSD 4PX5A 1HFJA 1ARZA 4HS4A 3V4LA 1KTIA 2AMFA 1IRXA 2ZYSA 5ALOA 3K0EA 3RHFA 4Z51A 3HV2A 4HPXB 4RQUA 5FCDA 2MJLA 4FQ7A 3ZVKA 4W63A 4RK1A 2I3AA 4Y0VA 3VO9A 3WLPA 2RGCA 5J59A 3ND7A 4FUQA 3IRUA 5AJZA 5IBCA 2ZJZA 5LQJA 3BJZA 3O8BA 3OF5A 5T8KA 3ZTTA 4CT5A 1XR3A 4E3WA 5B3JC 4V0RA 2AYZA 2NV0A 1YDMA 2A86A 3T8YA 3R3UA 5IDXA 1UXIA 4W99A 4MINA 2N42A 4PWZA 1VYVA 3GGSA 4PZLA 2VAVA 1YQWA 2XD9A 4URUR 3AU9A 3RUIA 1R9MA 2O1SA 4E94A 4MVJD 2EW8A 3W6OA 3OQHA 3GRVA 5J5AA 4G5OA 3JWEA 3W1WA 2H85A 3M1AA 3IAFA 4W1PA 5FPPA 3L7NA 5JFGA 1XDUA 1TJ5A 1W76A 2MSDB 4UHBA 4UW9A 4BNKA 4MJLA 5F78A 1KHTA 3I4CA 3RT9A 1ZH0A 3MERA 1A71A 1E8DA 4KQ6A 1U3FA 1YI1A 4MHOA 2OEPA 3WS7A 1RCTE 4EYQA 2PUFA 4HNHA 1YVDA 5JEEA 3NG1A 1GZ5A 3JQPA 1NW4A 3L7YA 1YB5A 3HKDB 4A82A 2R5WA 2GEKA 4W5TA 2O8NA 4ER5A 4P7JA 1JDSA 1CB0A 3O82A 3PC7A 1P80A 1Z5WA 2FSIA 4GR4A 4UE6A 5DP1A 5CB6A 1N2CE 2IHTA 2C04A 2ZSKA 5F9HA 4I1VA 4FMCB 5CVUA 1V4VA 3D3EA 2KPOA 3G17A 2QG6A 2ETVA 4AJ2A 4AYWA 4TMVA 4BMSA 2OAP1 4EA8A 3W5JA 4ITRC 4C3ZA 5EMJA 3BMOA 4J16C 4X63A 1Z13A 1UOOA 1I6LA 5F1OA 3TPCA 4YIHA 3NIGB 5ECDA 4YCNA 4HB2A 1YFJA 1CQIA 4F4UA 2GX6A 2JI6A 3OCZA 2ZJ4A 4Q1VA 4ZEMA 4QO7A 3OQOA 4INZA 3ZCQA 5EIBD 3RGWS 4CIBA 4KX3A 4AO7A 1JI3A 3MCTA 4BKMA 4D4KA 1X7YA 4RTOA 2BEWB 3O1JC 5JD6A 4NDNE 1ZWKA 2X2EA 3N6XA 2ZRKA 3CEAA 2D2VA 5AYVA 4BX9A 4AQYB 5FI1B 4OQNA 3FPFA 4KR6A 4EEKA 1VP9A 5COAA 4ZIRA 4PR0A 2PLNA 3JYNA 5ALIA 3OTOB 3U4DA 2IE0A 4WE3A 4V1CI 2BFWA 2PBFA 3WGJA 2UZ4A 1U63A 2HK7A 3E22A 2FVYA 3VUEA 4D6PA 2G8LA 3F2IA 1ZOOA 2HMUA 1R6VA 4R16A 1B16A 5E95A 3PEUA 4GGOA 4WUTA 4TSFD 4UD2A 3UJPA 2PZJA 3G7UA 4JITA 1SUFA 4EUFA 2J6IA 1RNLA 2OHIA 1F2TB 1PJCA 2HQRA 3BH6A 5IW8A 1SZPA 4GP6A 4YB8A 3WBJA 2W8BA 2ZS9A 3U7EB 3KV1A 1F06A 2C5SA 1JE0A 1EWKA 3FTFA 2AKYA 3DV2A 1E7WA 4NVRA 1ODJA 5ALYA 1N6KA 2QRNA 4R69A 3D0OA 3DMTA 5DNAA 2IH4A 2MSWA 2CLFB 5JJKA 1ZIOA 3P9PA 4B32A 1XHEA 5K3CA 4BBPA 1US8B 1T5DX 5L3SB 1CDDA 4MLZA 3N8HA 4UMVA 1A4UA 2YQ5A 2RHRA 3I4FA 4DHEA 2DERA 1MIOB 3KAJA 4IG4A 1JEDA 4X24A 5EESA 3ETCA 1BG6A 5ILGA 4XUEA 1DIRA 2GK6A 4DNXA 4EW6A 3P45A 4YS6A 4EVRA 1RJDA 2PWZA 2VJOA 4K26A 1AVTA 3QWAA 4L0MA 4B6OA 2IEZA 3B1XA 1GA6A 1U0HC 3EQ8A 1NY6A 1YSCA 1JAHA 3AIMA 1ODCA 3OX2A 4X1IB 1V11A 3O90A 1Q20A 3S27A 1U2SA 1CCWA 4QHTA 3CO5A 2FPGA 2BZ0A 2R84A 5HIIA 3LPMA 2Z56A 4EB6A 1RLIA 3ND6A 4AKEA 2DFTA 2NUPB 2WINI 2F7SA 1TD1A 2C2ZA 3ANTA 3CEPB 3MYYA 4WI1A 4AM8A 4DIEA 4V1CB 2B4RO 2CL0X 4R2JA 4U6QA 5FTNA 3W77A 1XK6A 4Q3KA 2WPDD 5HHTA 2G9ZA 3T3GA 1VHWA 2A59A 5JS1A 4G6ZA 2RFLA 3ER6A 3ACCA 1VHTA 4OF4A 5FNVB 5JADA 3I2YX 3QF4B 2C3YA 4P58A 4RHEA 3TPZA 4DV2B 5CIQA 4I9GA 2B2NA 2VT6A 1XVVA 2HF2A 2BKLA 1TT5B 3LLVA 1M5RA 4C5CA 4KPUB 4PZUA 1UZNA 4RQBA 4WXEA 3TTXA 3I5MA 4R83A 2C9ZA 2GXAA 2W93A 1L4KA 3AL0C 1QVWA 4Q4AA 1XWIA 2DR0A 5BN3B 3DDNA 1ZU4A 1M2VA 3P52A 4CIAA 2Z5VA 3RQIA 4MR7B 3UHPA 2IRWA 4YCCA 3B6KA 1ZUD1 3H2BA 4KE9A 4OLBA 1DBVO 1MAVA 2DH6A 2OFXA 3V42A 1B0UA 4QWWA 4EHKA 1NQWA 1AV7A 3KKPA 1NE2A 2H18A 4V24A 4G0VA 2I6UA 1PI3A 2PT7A 4M1EA 1N2GA 1MT3A 3K1JA 2CLSA 5FUYA 3KYDB 5FL7A 4IIGA 2XB8A 5TSDA 3U60B 2DXIA 2P9JA 2E2WA 4CRWB 1R6UA 1S2OA 4ZI7B 3RNLA 4D4IA 1MABB 4EHAA 4O29A 1AKMA 3FNRA 1QH8B 1G7RA 4OHRA 3O4IA 5LKRA 1R8XA 5ECGC 1A04A 2WHXA 1FTNA 3KZVA 2X0DA 1SQFA 2AWOA 3PLNA 1YQGA 4B84A 1NJ6A 2BFFB 5FXMA 1PNRA 2WG1A 1E6LA 1VIYA 1RZ3A 3D9QX 3FZNA 1F3OA 3HYLA 2QZSA 3O7WA 6ABPA 5EXEA 1S2LA 3DPUA 3L4BC 3RASA 1PQPA 1U5AA 4PTLA 3GCDA 1TQ4A 2FLVA 3KUKA 2O8FA 1EVIA 1KI8A 2ZYDA 4A3SA 1JIUA 3V1YA 3RRBA 3UF0A 4U8HA 4BGIA 1TADA 3RO7A 4C3UA 4DSZA 4ZC1A 3S70A 3G5UA 4LWZA 4PHGA 1C7QA 2HA3A 3ZS8A 2C29D 1L5KA 5IK2D 3QE0A 1M2HA 1NFRA 4TMWA 5KX5A 3TIIA 2QXUA 3O4HA 4M0EA 1TJNA 4ZOQI 2ZKLA 1K7XB 3EFOB 4ZTBA 1CV2A 4COOA 2W6JD 2ZVDA 3E5MA 4GRDA 3R5SA 4I4IA 3MF4A 1G6OA 4M9XA 1VJTA 3N2NA 4OIFA 4UXHA 5EWJB 5J23A 2NT4A 1H4TA 4BP8A 1OH5A 3IOBA 1V3VA 2BFBB 1UT6A 3HWX1 1F8YA 1AD2A 4QIHA 2EJBA 3MB5A 2E37A 5F51A 3RS4A 3WGUA 5CA1A 3W4IA 1HH4A 1X8KA 4HZIA 1KOLA 1XZMA 4G67A 4JCCA 1KDYA 1P9OA 2D4AA 2EC5A 4E13A 1UMDB 1R0YA 5LQMA 4P38A 5G53C 2H1HA 3AG5A 2ETXA 2QMYA 3HDVA 4HDSA 1W19A 4BX8A 3OMLA 1BHJA 4FW8A 3H2KA 2A2ZA 2W6QA 3WRXA 1VL1A 2Z2IA 3EIHA 1NMYA 1XRNA 3WNQA 5U4QA 4W6ZA 1ISIA 4QG3A 2JFWA 2XB4A 2E4YA 1JLLA 3VKFA 4JHLA 3TZ6A 1W9MA 1XMOB 3C5VA 1ICEA 2YRXA 2ZM6B 2XB2A 3G7NA 1Q0ZA 3TR6A 3EQ6A 3LYHA 2PNJA 3DGEC 4ARZB 3C6QA 1R0SA 1TM4E 3HB5X 4I4TF 3FOAA 4LCBA 5NLLA 3ZU4A 3HB9A 2IS4A 1OFVA 3Q0IA 4KQ1A 2Z58A 1ZNYA 7GPBA 5IPFA 4CM8B 5JNRA 3RIMA 1N34B 1MGOA 1HT3A 2VYCA 4FSHA 1LK5A 3I6MA 4M9UA 1OX4B 4JN6B 3OT4A 4X0EA 1XZFA 2NZJA 1JI0A 5IJ9B 1EDEA 2H1LA 4GYJA 3ZBPA 1H4SA 1PFUA 3VV3A 4UJ3A 2B8JA 4ZXPA 3BMCA 2QM7A 4FLEA 2PV0A 3CH5A 4E3ZA 4FD3A 4GLJA 4FMBB 2WIJA 4LRUA 1A3CA 5C2JB 5ELMA 5DEOA 3CJRA 5E3JA 1EVLA 2Z2KA 1RWPA 4C2AA 3CR3C 1PKEA 1W0CA 3I1IA 1CJMA 1THMA 1B93A 1JHUA 1SVIA 1UAGA 3FAZA 2FDCA 2AJDA 2ECKA 5EJMA 1HTBA 3F96A 1EA7A 1IMOA 4CNQA 2QLNA 4KLNA 3L8MA 3RBAA 4JJIA 2F62A 3C5HA 4DMFA 4QPNA 2GYWA 2JBAA 3AP3A 2I7CA 2JCYA 3KVVA 3ON5A 4D3XA 5JO0A 3DTVB 3GVCA 3KXLA 3AUTA 4QJIA 4UE3S 5AI4A 5E2IA 5ARCA 2H3HA 3GB9A 1DWUA 4D45A 2YS7A 3FUXA 5IUKC 1C4WA 2LWIA 2H29A 4DNOA 1V7ZA 3AI2A 3ESYA 4TKVA 3VX4A 1ESMA 2ZREA 3KAKA 2WTUA 2ZUFA 3TQCA 1QP4A 2ZAOA 4L3WA 3NTXA 1KFEB 4XJSA 3CRMA 3LL4A 1UBJS 3RSGA 1JR3E 1NQTA 2C84A 3HGTA 5CB4B 4PAQA 5GTDA 2DUMA 3BA6A 1K3FA 3CH6A 1EK2A 1FDOA 3TK1A 4F06A 5BSFA 5IAJA 5JI2E 3GAFA 4L50A 4L3VA 3ZDCA 1CRPA 2VQSA 1MJFA 3H5IA 2FPUA 1H69A 3I6ZA 2HF9A 3DOJA 3K31A 3V1NA 1Z17A 2WAOA 1BDBA 2FN3A 1UKAA 3OM8A 2V5AA 4II3A 2LIPA 1SCNE 3AEUA 3OIGA 1G2IA 1QC5A 4QOGA 1M83A 4S05A 4YV7A 1WB6A 1VKOA 4D8TA 2GAFA 2IUFA 4Z0PA 3TKAA 4M0PA 3F7MA 2A67A 1F9EA 1M5UA 2ZTLA 4UEJA 4OHCA 4OL0A 2HNAA 1PUIA 4FKBA 4BVKA 4JX8A 1WEKA 1U7TA 2R8XA 1E9BA 4LKOA 1IJBA 1ZUIA 1OLOA 2Z98A 3QI2A 4GC9A 4QWMA 3WL3A 4LZAA 3MGGA 2NMVA 1OBOA 1T3SA 5D8