1KNQA

Crystal structure of gluconate kinase
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
171
structure length
171
Chain Sequence
TTNHDHHIYVLMGVSGSGKSAVASEVAHQLHAAFLDGDFLHPRRNIEKMASGEPLNDDDRKPWLQALNDAAFAMQRTNKVSLIVCSALKKHYRDLLREGNPNLSFIYLKGDFDVIESRLKARKGHFFKTQMLVTQFETLQEPGADETDVLVVDIDQPLEGVVASTIEVIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Gluconate kinase
publication title Conformational changes during the catalytic cycle of gluconate kinase as revealed by X-ray crystallography.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 64
structure length 171
sequence length 171
chains with identical sequence B
ec nomenclature ec 2.7.1.12: Gluconokinase.
pdb deposition date 2001-12-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01202 SKI Shikimate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1knqA00
2JJ2A 2H17A 3PUWA 3QSYA 1PVOA 1LF5A 2XOKA 5BN5A 3U6KA 3GLHA 4II7A 3EAQA 2HV8A 5F2EA 1XJQA 2W58A 3ZZUA 4PO9A 1S8FA 2V54A 3IBYA 3K9HA 1AZSC 3GEHA 4WIAA 3GJ5A 1G1MA 1W36C 1HY3A 5CDFA 2GWHA 3CWQA 3U7GA 4CT5A 3CX7A 4GL2A 3WNBA 2RGDA 3HR7A 5E3HA 2GBLC 2IS6A 1R0YA 5CB6A 3VFDA 3O8RA 1TUIA 3FMOB 5EXSA 2JDID 1OH5A 1E69A 2ZSAA 3OHMA 4XD7D 2NZ8A 5DGXA 4HB2A 2QL6A 3WRXC 1TF7A 1R8SA 2REXB 4PQFA 2VO1A 1FTSA 2XOKD 1OPXA 2VLIA 5FOVA 1U94A 4KFTA 3MJRA 4XWAA 1CLUA 4TMVA 3QF7A 5JEDA 2JIZA 3KKNA 2F1RA 2X2FA 4NCJA 4B2PA 2KI5A 4OK5A 4ZCIA 2BM1A 4B3BA 1CP2A 3SR0A 2J7KA 4ESVA 4KXFB 1KDTA 2BCGY 4US0R 1G21E 4B33A 3QXJA 3UMSA 1Z6TA 1VPLA 4MQBA 3G0HA 4KCGA 2JLVA 1N6NA 4YC7A 3GLFB 4ZCLA 3OE7A 4LJ8A 3ZVMA 4EJSB 2ZRDA 3TW8B 2OFWA 2ZI7A 3HPRA 3DMNA 2A2ZA 1I2MA 4G5RA 1XTSA 3VU9B 2FFQA 1FL9A 2OCPA 3B1XA 3BFVA 3W90A 1GZSA 3K0CC 4EDHA 3R9IA 2BEJA 2QI9C 3D31A 4IVRA 5AUOB 2BV3A 4M8NE 2QPAA 1NBMD 2ZROA 3FKSA 1RW4A 4DB4A 4F7WA 4GMDA 2W00A 3MJHA 4TLBA 1TF2A 4U02A 3THYA 4ZCMA 5JZVA 3H2YA 3VKGA 1ZUIA 1TL7C 4NBSA 4LBVA 1FTNA 2YYZA 4HLDA 1EXMA 4EPVA 4LDJA 2BBSA 1YZUA 1P72A 3K0AA 4CRWB 3GLIE 1T91A 2KBEA 3B85A 4NP6A 1HT1E 4Q4AA 1FUUA 2G0NA 4KODA 3CONA 5FL7A 2REBA 4C2TA 1T3LA 2AWNA 2JATA 2ZANA 2JJ8A 2BKEA 2ZYWX 2F3RA 1JEDA 5JCZA 2VL7A 3OEED 4BLPA 4ZDIA 1E9SA 3BK7A 2LCFA 1HTWA 4BPBA 1ZVQA 1K5GA 3NIBA 1OB2A 1E2GA 3DZ8A 1RKBA 4EAQA 4B44A 1EWRA 2HXYA 3KFXA 3NKVA 3DMDA 1E1QD 4PAMA 4YMTA 2E1RA 2CCGA 1Z2AA 2PH1A 4V0ME 4X8OA 5FOSA 3A4MA 1G8PA 1E9FA 2W0MA 3WMGA 3TSZA 2EQBA 2FPMA 4D4JA 5L8VA 3EZFA 4P4SA 5JSZA 2QSYA 4AYWA 1P2VA 2OCYC 1NLYA 4QBIA 2OEPA 3AKCA 4CEJB 4Q01A 1XU4A 2JJ2D 2P6RA 1JXOA 1SKQA 3EZ7A 1X1RA 1QHIA 3LQRA 4NPHA 4YMUA 1W4RA 3HYRA 4GFDA 2JLRA 1KJYA 4BRWA 1E2FA 3IPXA 4KLZA 1JNYA 4DCVA 2QAJA 3VKHA 1ETUA 2GCOB 1GM5A 3PUZA 1CJUC 1YQTA 2VH5R 4UNRA 4Q4HA 5FTLA 2X19A 4CEHA 2GETA 1JQJC 4S2EA 2ZREA 1QHXA 3KZ1E 3B60A 4B75A 2IBMA 4QBFA 4JLOA 4C0JA 1E94E 1ZM4A 4DC9A 3FWYA 1Z06A 4BUJA 4MUAA 4RJLA 1PLJA 4RD2A 2VIIA 2FGKA 3I8XA 4M22A 4OQLA 4QM7A 3RVBA 1XTJA 2ORVA 3RWOA 1K8RA 3DM5A 5EXTA 4BWYA 4XVUA 4OQMA 4PSKA 1Q1EA 1R4AA 1ZP6A 3T12A 1YZNA 4AIIA 2BHRA 3U60B 3F0TA 4A2PA 1RZ3A 2C2HA 1KI9A 2VP2A 4ILEA 4FMCF 3I62A 4PO8A 3L8YA 1OXXK 1UBFA 2D7DA 3EC2A 4N0DA 4TTQA 4V0OA 5K8IA 2WKRA 1KO1A 4Q4AB 2OXCA 1NBME 1P62B 3QBVA 3I3SR 1DE0A 5JJLA 2WIAA 4HDOB 4DLRA 3UIEA 3QKSA 1ZNWA 3MG9A 4AK9A 4DDVA 2WAXA 3VNUA 2MMCA 3RWMB 3EPLA 1GWNA 2O8EA 2JJ1A 2IUTA 2HT6A 4L16A 3HDTA 1Z29A 4PZZA 3BAFA 4DJTA 4B48A 1UJ2A 1N5LA 3CWZA 3QIAA 1E99A 2XAUA 3EW9A 4RD6A 1KKLA 2QROA 4LJ4A 2ZQ5A 3IIJA 4PHFA 4DIDA 5H8WA 4LHYA 3U3JA 4JVSB 3EIHA 3KQUA 5H70A 4XIGS 4ZI3A 3RS0A 1XZPA 4M53A 2KBFA 2GCNA 3RNLA 1I4LD 1IXRC 1Z83A 2J59A 2ZAMA 4NYJQ 4M1KA 2QGZA 2ZYUX 3KFVA 2IW3A 5AWFC 3Q7PA 2O8CA 2CCKA 2CL0X 3LXRA 1CR4A 3B13B 4PTLA 5CJ2A 3QI2A 3SBEA 4MDFA 2WJJA 2LKCA 1V43A 3B7GA 4DVGA 1QRAA 1FQKA 1HQYE 1ESMA 2QN6A 1JPJA 4MYUA 3B6EA 4AI6A 3A1WA 5G53C 4FCVA 2OE2A 2GAOA 2QEQA 4M0LA 3RHFA 5DHAA 1TU4A 2GEUA 3Q9LA 4XTCS 3LXXA 2OCAA 5FUXA 2JLSA 1T0HB 1Z2CA 3HYTA 4OHVA 2G83A 4EUNA 1QF9A 3LV8A 1NVVQ 2QA5A 1G8GA 2CL7X 2WWWA 3FDIA 3P4YA 3EPJA 1OFTA 4C7OB 1H65A 3DPUA 3ASYA 1CXZA 1II8B 1OH7A 1W0JD 1XMJA 1KI6B 2C9CA 3KL4A 1S4QA 2RKOA 4UNSA 3T06B 4DKXA 5IHPA 2O8CB 2NQ2C 3AVOA 3ZD6A 4D4MA 3THOA 4HB0A 3SS8A 2ZJ5A 1QHGA 1VMAA 1OFHA 1QHYA 2FZ4A 3U3OA 3N70A 2GZHA 5CLQA 3MSXA 1IN6A 1GUAA 4O2LA 4LV6A 4YMVA 4JKIA 2ZJZA 1RE0A 2JIZD 1CTQA 4NMMA 1KI1A 2QU8A 2KWIA 2Z6VA 3CRMA 1XJCA 3ND8A 2OM2A 4ITRC 4L4UA 3TGPA 1AK2A 1GRRA 3PG5A 1N0UA 2OAQ1 1LVGA 3NTUA 5KO2A 4MYHA 4XD7A 1E2HA 3TVTA 3I1FA 1MV5A 1MO3A 2QTHA 4BZXA 3FHTA 3NDBB 5E7IA 4LJ6A 2X2EA 4ARZA 5JRZA 2ZI5A 4BLSA 1YR8A 2J0SA 1ZINA 4XH9B 1DAHA 1Z6GA 3AB3A 3IBGA 2I4IA 2KB0A 4Q00A 1XPUA 1PUIA 4TMXA 1TPZA 4B3GA 5CM8B 3U7HB 3ZVRA 3WNDA 5JECA 4EPRA 1S1MA 5JI3E 2Q3FA 4QL3A 2OSBA 4FMDF 3ZVNA 2C78A 2YOFA 2ODEA 5E7MA 4A0RA 1F48A 4TMTA 4DWJA 4P31A 4RCYA 1K6MA 1UBCA 2WM9B 4H9GA 4DCNA 1Z5ZA 4CIDA 1EESA 4OQXA 2F43A 5LB4A 2R6FA 2BMJA 2FFAA 4ZDKA 2OV2A 1II9A 1NRJB 5FR1A 4DSNA 1MRNA 2O0KA 5BQ5A 1S3SA 2J0VA 1T3SA 4L9SA 4Y0AA 3VX4A 3AKYA 4EIWA 3A1SA 2QENA 3RYTC 3IEUA 3SDZA 4O25A 3SHWA 3CH5A 3MWLA 3BBPA 3QG5A 1C4OA 4ASUD 5KHOC 2C9OA 1T0JB 5JLJA 1T8TA 1KZ7B 4BEBA 3BWDD 3BIFA 4CZ2A 2HF9A 2ZRKA 3W6PA 1U8YA 3ZS9A 4OQNA 1Q21A 1YJ5A 4RKEA 5GADl 3ZZTA 4UJ5A 1JR6A 1IXSB 2ZRGA 3GEIA 1WBBA 2DYKA 2HXSA 3DM9B 3BERA 1ZUHA 4GI7A 4E5UA 1T8UA 4DLXA 1WE2A 4OL0A 2V8OA 4JL6A 2OCBA 4MRSA 2OO7A 2ZUDA 1KI7A 3L8ZA 3LLMA 5DYIA 4AY2A 4GPTA 3AVUA 3TUJC 1OLOA 3K8YA 1XF9A 2AKAB 1BOFA 2ZRNA 3ZS8A 4QKQA 3I61A 1KNXA 4QNRA 3THWB 2GJ9A 4AKGA 3ECCA 3GJ4A 1OF1A 3ETLA 1KO8A 4A2WA 1XD2A 1AM4D 3EPKA 4IOKA 5CK4A 4HSEA 3HJNA 4LJYA 4Q18A 1E32A 1K5DA 4AWXA 3ASZA 3MWKA 5DSZA 2N1BA 2R65A 2B7BA 3LBIA 2AK3A 2JJ1D 4NYIR 2BVNA 4PX9A 3T1OA 2CHQA 2WKQA 3EX7C 4JLMA 3IGFA 5JCPA 4OHYA 1JAHA 4LUCA 2V1UA 1NF3A 1Z07A 2J46A 4TMKA 4AKEA 4W9MC 1KK3A 2ZSEA 4WVFA 4B74A 2NTYC 2ZU0C 3VHXA 1TQ2A 4B3FX 3THYB 3OIYA 4F4IA 4Q1EA 1CJVC 1PV4A 4R7ZA 4HAUA 2GRJA 1CR2A 5CM9C 4AC9A 1DAGA 1EX6A 5TXGA 3FB4A 1U98A 3VQTA 1NN0A 3WBKA 1OXTA 3GLFA 2XTNA 2DR3A 1YHNA 3AGQA 4RD1A 3QKRB 4QHYA 3KKMA 1XCMA 3EC1A 3TKLA 3O8CA 3O8BA 3X1XA 1S9DA 4KU4A 4IOJA 4P0TA 3AUXA 3RRYA 2Z4SA 5AJZA 5TARA 1L4YA 1OE0A 1Z0IA 2YWGA 2R6CA 1D9XA 4R98A 1RRGA 2KSQA 2BBOA 3TVDA 5DISB 4DLTA 4DXAA 1XBTA 5KDOA 1RRPA 3MMPA 4QBGB 4BLQA 2OHFA 1LF0A 2V7QD 3EWSA 4NYIQ 4U00A 4A2QA 3U6BA 3D7MA 2B21A 1P7CA 1T9HA 2QMUA 4IVQA 3LDAA 1JECA 1JALA 5GVRA 3T1TA 2PZFA 1AS2A 1XMVA 1KK1A 3DHWC 2VP0A 3LAWA 1NN3A 2IYQA 3GJ3A 1G7SA 1WF3A 4B3XA 4RSGA 4M4SA 4QRHA 5F98A 3AP1A 1IN5A 1DELA 3LA6A 3R9XA 4LC0A 3K0FB 1NN1A 3LD9A 2A5DA 1IN4A 2ZRLA 2F7SA 3GD7A 3QE0A 3GPLA 4OK6A 1KK0A 2R2AA 2GF0A 2WAYA 1IXZA 5BN3A 4DDTA 4LPKA 1ZNZA 2ZRAA 1R7RA 1ZCBA 4ESHA 4YONB 2WJIA 1DAFA 2BIFA 1GP2A 4B47A 4EQ6B 4FW9A 2GVZC 4W7SA 1E2QA 2QUZA 1YRAA 2GKSA 2EFCB 5FBQB 3Q5EA 3A37A 3CLVA 1UM8A 2R9VA 3KXKA 2DWOA 2NG1A 4HB4A 2F9MA 1BS1A 2H92A 4TWZA 1TEXA 2RGNA 2VQSA 4Y0VA 2OG2A 1EG7A 2HYIC 4DSUA 1WB9A 5J40A 1OFIA 2IUSA 2VSFA 3PEWA 5FI0B 1G5RA 3NHAA 3VTKA 2ZSDA 2QTVB 1LB1B 2BBWA 4CEHB 3N2EA 4NCIA 2GCOA 1GNRA 2QGNA 3ADDA 1G3IA 4U7DA 1VYUA 1AS3A 5EZ5A 3I4LA 5JS8A 3U5ZB 4CDGA 2W6JA 3I92A 1XXHA 2X8AA 4BASA 5EUMA 3BFKA 3EZ6A 4YXWD 5EQTA 1ZC3A 3EZ2A 3UPUA 4JL8A 4A0FA 3RS3A 1Z6YA 1KO4A 1XCGB 2JLUA 4G01B 1UDWA 2J0UA 4JBYA 1S1CA 5E7JA 1J7KA 1Y3AA 3EA0A 4XWOA 1P6XA 4JLDA 1N6RA 4OHXA 2BCJQ 4Q7JB 4FCTA 5JHGB 2CE2X 1U0HC 1G9XA 1SXJB 3AV0B 5FH9A 1FZQA 1DO2A 2WSSD 2VSOA 3FMFA 3OIUA 3A4LA 3U44A 3L43A 3BGWA 3WYFA 5JI2E 5J4KA 1OKKA 1VG8A 4HI0E 4IDQA 5GJVC 2P67A 3MFYA 4D26A 5AUQA 2P5SA 5TVKA 1RYHA 3RDPA 1XMIA 2G0TA 1DTSA 2O0JA 2VPPA 3H4MA 4WZAE 3KQHA 4W5HA 2QPOA 1BMFD 4AG5A 1ZMXA 2A3RA 2QY9A 1GRNA 2W6IA 3PIRA 4HAZA 4NCNA 1AN0A 5JMTA 4DDUA 3FE2A 3UWKA 4LHWA 3CF6R 4G5GA 5L3VA 3CPJB 2J7PA 2ANBA 1L2TA 3AF1A 3SQWA 5BYKA 5FBLB 2C77A 3E5HA 4XSHA 2GAAA 4KBGA 5J4VA 2VHTA 1Z0DA 1VYTA 2QE7A 4JLBA 4C0HA 2OAP1 2OBLA 1ESNA 2A78A 2D06A 1NG9A 1W4AA 4QGFA 3GP8A 2BKUA 1U81A 1Y63A 3TK1A 4TQUS 2QMEA 1YU9A 4RKFA 4PC3A 4WAUA 3VR2A 2F55A 1OSNA 4XJXA 3CNNA 4L15A 4B35A 2BWJA 3O8DA 2QTFA 3MLEA 4B6FA 2ZYVX 1IONA 3WYGA 5B2ZA 1W4CA 4S35A 4C3ZA 3LX5A 1COWD 2HDNB 2YINC 2XXAA 4BE7B 4M9ZA 4N3NA 1I4DD 4MDEA 4MRNA 2O8BB 1H8HA 2W0SA 1KI3A 2XJ4A 5KDDA 1N6IA 3A36A 1US8B 2ZR0A 1ZD9A 4PSAA 4R9UC 2XB2A 1KI6A 2RAPA 1XD9A 1RJ9B 1ELOA 3AP3A 2AR7A 1UEJA 4MGYR 3B78A 4A6PA 3BH0A 4HLCA 1Z0FA 1W46A 3ZIAA 1DAMA 2AKYA 4PPQA 4Q47A 3KQKA 5GJWC 4BLRA 3T34A 2R62A 1GKYA 4LBZA 4Q1BA 4D0LB 5F3WB 2CNWA 3LY5A 1G7RA 1IM2A 1WRBA 3HU2A 4D0GA 4UXHA 4LBWA 1RJ9A 3T35A 3PFIA 2NZJA 3B8HA 4OBEA 1XEWY 3TSOA 3B1YA 4US2R 3DKVA 2IYYA 1YZLA 3MD0A 3L2OB 4TQAA 5B64A 8OHMA 2ZJ2A 1ZUNB 3ZYCA 1E9EA 2EFGA 2FMXA 1JEEA 2VBCA 3SYKA 3Q8XB 2NO6A 1Z0KA 1J8MF 4Q21A 1VCMA 5EP2A 1R5NA 1G4UR 3NH6A 1GNQA 1PZNA 1G5TA 4MYCA 3BB3A 1DAEA 4Q7KA 1J2JA 1U0LA 2EYUA 2LKDA 2NO0A 1WMSA 2F3TA 5K8TA 2XZLA 4HUQA 2FN4A 1SVOA 1W49A 5L3RA 1W4BA 1WA5A 1E0JA 3U2QA 4JJKA 2Z0MA 1KY2A 3FGNA 2CK3A 5GJCA 4IFEA 1KIMA 1CBUA 1OIWA 2BEKA 2DFKB 2WMOB 3GMTA 1XTKA 1RRFA 2UZIR 2NIPA 1N25A 4YLGA 2AX4A 5K8LA 2VP5A 5KNBA 2AK2A 3RS4A 4BFXA 4Q9HA 1VG0B 3OIWA 2VA8A 2ECKA 4LZZA 4LGMA 2VF8A 5DI9A 2PMKA 3JZMA 5J4LA 3KTAA 4WXRA 3AF2A 5HTKA 5UKDA 1I2DA 3JZAA 3Q72A 3BS4A 2GXAA 1Q12A 2QM7A 3FHOA 3ZGXA 4BRUA 2IS4A 4TYQA 5IK2D 2IYRA 5FL3A 4LK2A 3J81k 3BB4A 1ZIOA 2GXQA 1U90A 1U9IA 1R0XA 1U0JA 1HA3A 1WBDA 2BOVA 4B2IA 3C16C 1I4TD 3AF3A 4L5BA 3GJ6A 4IRUB 4IHQA 2V6JA 1O87A 2Y8EA 5EE9A 1RRCA 3N2IA 1KK2A 4QGGA 4A36A 3AVWA 1E1RD 1W0JA 1IY1A 1MT0A 2MSCB 2WIBA 1P75A 4KFUA 2J5XA 2CLSA 2ZVPX 2XNDA 1XXHE 2ZI4A 3MWYW 4FMCB 1N2CE 3P4XA 1ZD8A 5H68A 4CEIA 2H1LA 3CRRA 4H1UA 4JLJA 4ZKEA 5KU1A 3L0OA 4V0KA 1SVMA 1UFQA 1XZQA 1YR9A 3OIVA 4I1VA 1OT3A 1EGAA 1WDTA 2FSHA 3Q3JB 3FOZA 4MKIA 2IXFA 2GJAA 5AR1A 1P9RA 2FFBA 2SHKA 3A1VA 4LYHA 3LO5A 4M21A 4MUBA 1XD8A 1XPRA 1OHHD 3I5XA 1IQPA 4IOLA 3HU1A 2OESA 3F5FA 3CRVA 1NL3A 1CRPA 1P73A 1EX7A 4LJ7A 3DEFA 1AQUA 2ODNA 3EIEA 4DDWA 2ATXA 1TEVA 2C04A 1WP9A 4Z51A 4DEXA 2QNRA 3S1AA 5FPTA 3BFXA 1PJRA 2J7PD 3KQNA 1MABB 2Q21A 621PA 1XPOA 2WWYA 2RGAA 1KJWA 4LV8B 3FFBA 4KJZA 4HDQB 2W83A 5KNDA 3TH5A 1KMHA 1WCV1 2PZEA 2PZGA 2OILA 1UEIA 5EXXA 4HLQB 5JS7A 3W9YA 1W2GA 2EW1A 2Q3MA 4IFBA 3ADCA 1ZC4A 1KMHB 2AN9A 4O2RA 4IDNA 4IEIA 5C4MA 3K0SA 3ZH9B 2DPXA 5CYOA 2DFTA 4C9BA 1OKKD 4JT4A 2CHGA 1QHNA 5B57C 2IYUA 1B0UA 5J4HA 1MABA 1E9AA 3ONWA 4GRAA 3IILA 3P32A 3QPVA 2BMEA 4MRPA 5JFGA 1IJEA 3HR8A 1D6JA 3JVUA 2GZDA 1F5NA 4DSOA 5KUTA 1AJEA 1HT2E 4URUR 1EFUA 2D74A 4M1YA 3LLUA 2PT5A 3QKRA 1AZTA 1FPMA 1UF9A 2F9LA 2VHUA 1M74A 2VP9A 2IS1A 1P3JA 2J45A 1FX0B 2AXPA 4DIEA 1E2KA 5SZKB 4PSVA 2OFOA 1GRQA 1TQ6A 4C0QC 1XCPA 2NO9A 2QQEA 3KXLA 5A0FA 4Q7LA 1FUKA 1G4AE 4TYPA 2O8EB 3G82C 4G5QA 2ZRCA 5IRCD 3GLIA 1QZXA 2C96A 4KFRA 4KI0A 4FWTA 2GF9A 5JJKA 2ZSFA 1QG4A 1ZIPA 1CULC 3EG5A 2QM8A 4URXR 1DVRA 3SC3A 1W5SA 4TLCA 2CVFA 2A5JA 2X1VA 4IEEA 4P32A 4CYMA 1NLZA 4JBWA 4FXPA 3GEEA 3ND9A 4HEJA 4TL6A 4O3MA 1JQLB 5BW8A 1ZJ6A 4CW7A 3VKWA 3KJGA 4CGZA 2CEAA 3IPYA 2WWGA 5HZHA 1MO5A 1ZCAA 2DFNA 2VYFA 4OJKA 4V0MA 5HKKD 3AM1A 1UPTA 2RHDA 5AJWA 5CLLA 3U3MA 3QEJA 1DG1G 1OV4A 2ZS9A 3TRFA 3S1AB 1SXJC 3K9NA 1YVDA 1XMSA 2N42A 3T5DA 1XEWX 4NTZA 2ZAOA 5EUQB 5FTKA 4QM6A 4PZYA 5L3SA 3BRWD 4ZDWA 2GEVA 3KTAB 2GDJA 2V4ZA 1SVIA 1NJGA 1R2QA 4D25A 2JASA 4V0NA 3DO6A 3RSOA 2FSFA 2RGEA 4FMDB 4DHEA 4LYJA 4G1UC 4A9AA 5BWMA 4TT3D 3WP0A 5C1BA 1RPZA 2QE7D 1ZM3A 2CVHA 2EFEB 3BC1A 4V0LA 5EXPA 2HCBA 3CO5A 3H86A 4NCHA 1E1QA 4NYMR 4A1FA 3PJRA 3DZDA 1LW7A 1F2TB 2WTUA 1Q1QA 1KO5A 1YZGA 1JJ7A 1GKUB 3LVQE 2KE5A 2NPIA 5TV2A 5B30A 1AQYA 1TAGA 4JLVA 2QP3A 3REGA 4FI3C 3ZD7A 4FCWA 2GXSA 2P0EA 3DKPA 3BB1A 5JHHB 3TBKA 4LCBA 4Q1CA 1CS4C 5SZHB 4DCSA 4HAXA 4WW0A 5DN6D 4PC7A 3RLFA 1A2BA 3CUEF 2WHXA 2WJHA 1SVSA 4JZKA 3LBNA 4TYYA 1SKYE 5EE3A 2VF7A 4KSCA 1E0AA 3RRNA 3E1SA 3NDPA 5BXQC 1ZAKA 2BJVA 2FV8A 2R8RA 3CRW1 1BYIA 4KHZA 3I72A 1BYUA 1G3MA 4M1OA 1M7HA 2PLRA 3TE6A 2WPDA 5B58C 1TTTA 1X8KA 1NBMA 1H8EA 4NHOA 1GDDA 2OT3B 1AS0A 1D8TA 1Z6AA 1AKYA 5DO9A 2HCJB 3NH9A 1YKSA 3TR5A 4EQ6A 2ZM5A 3PVSA 3EPHA 2HYDA 2GTPA 2BBTA 5HE9A 4RZ3A 3EWAA 1TNDA 4DT1A 2ORWA 3U7FB 1OIXA 1XB2A 1A82A 1ONBA 2O8DB 2QAGA 4AKHA 1G64A 2ZIAA 4LYAA 2GBLA 1Q44A 3AF4A 3RAPR 4XSGA 1EFRA 2IWHA 1Z08A 4Q9KA 3K0EA 2Q9AA 2H57A 1ANKA 4Q4LA 1B23P 2F1IA 1X8JA 1VECA 3QG1A 3QPWA 1CEEA 2FX3A 4B6EA 1W0KD 2J1LA 4Z8YA 5DIFA 3KX2A 3W8RA 4URVR 2HUPA 2B6HA 3AKDA 1KSHA 2GJSA 2IF0A 3SJAA 1BKDR 2B8TA 2CLDX 1UBGA 2XXAB 1F6BA 1P9WA 2XB4A 3I32A 2PCJA 2ZU6A 3KDSE 4IVPA 3A1TA 3OAAA 1EFHA 1VIAA 3EASA 3B5JA 3QKTA 2F6RA 2CMKA 5KYKA 4AD8A 4ZI2A 5CB8A 4DUGD 1KDRA 4RD0A 5HCNA 3EA5A 3WP1B 1XTRA 3MRSA 4Z1MD 3AUYA 1CKEA 2NMVA 3K0FA 4OYHA 2OBMA 1NVUQ 4D6PA 4Q9LA 3QEOA 5EE1A 2RGXA 2GESA 3QXCA 2IA5A 1II8A 1TF5A 1VDZA 2H16A 3QNUA 4L9WA 4C7OA 1RYFA 3KB1A 4QHSA 1L7VC 3HU3A 1VKJA 3K9LA 4QOSA 4YDHB 4A8JA 1A1VA 4BFYA 2YKGA 1FMJA 3PXGA 2V3CC 3OEEA 3B82A 4PC2A 4TSFD 2JEOA 5FI1B 4HZUA 4GP7A 5HZKA 3NWJA 3UANA 4JYBA 1IOZA 4MKFA 4HAYA 2YNMA 5KOYA 4BQSA 4MGIR 1KJZA 2FSGA 5AUPB 3QKUA 3NBZC 5HKKA 3DL0A 2WWIA 4TL7A 2FDCA 1E9BA 1NMYA 4L8GA 2KJQA 2D3WA 5TMPA 4W5JA 3BOSA 1TUEA 4US1R 2O5VA 4QG7A 4IJMA 3RC8A 1E4VA 1CIPA 4AYXA 2ZR9A 2GZAA 2R6DA 2XSZA 4KV9A 3I5YA 2QSZA 4JLAA 1SXJE 5FUVA 1L4UA 1Z0AA 3EXAA 1NNEA 1E79A 4B3CA 4IXMA 4B2LA 4BZQA 4RZ2A 5J4YA 5JEEA 5D3QA 2REOA 5LDDC 5DI3B 4NL4H 2FZLA 2I1QA 3SFVA 2V55B 1TQDA 2HJVA 2AFIE 3R7WB 3WNCA 5FOXA 1CF4A 4ACBA 3SHFA 3QF4B 3W34A 2IUUA 1CR1A 2WPDD 2ZYTX 3WY9A 2UKDA 4R2IA 3ZLJA 1W44A 4IDHA 2GHIA 3PV0A 3L82B 5D3MB 3V4FA 5HPYB 2Q9CA 4UKDA 3LVRE 4GT1A 1FMLA 3FTQA 4YQFA 1ZBDA 3QVVA 2DFLA 4UNNA 3IDQA 4OHWA 3W8NA 3E70C 3P1JA 3F8TA 4EPYA 4KSBA 3BE4A 4R71A 3KUCA 5DLQC 4MRVA 4FWIB 2N46A 3HWSA 4OQFA 1D5CA 4PHHA 4ZV4A 2C98A 3X1YA 3M1IA 3DOFA 2RH5A 5G3YA 4ERNA 2AWOA 3NC0C 2HF8A 1N6KA 2AHOA 1X6VA 1A5TA 5EP4A 2XNSA 2YOGA 4P4UA 3OAAD 3PEYA 1GL6A 4Q1DA 1A7JA 4Q4JB 521PA 5FPSA 2VHJA 2QPTA 4N0EA 4Q1FA 5GJBA 4UQOA 3AH8A 1NMZA 1GOTA 4G3XA 4NU0A 3TUIC 1W1WA 2DWPA 1D2NA 1Z28A 2CE7A 4JYCA 5JRJA 4DSTA 1W7AA 4JLNA 3TLXA 1HE8B 1VG9B 3X2SA 3FPAA 2PX3A 1OXUA 1BH2A 1LTQA 1Z6XA 1RIFA 2IT1A 2PMDA 4KAXA 4B43A 1EFRD 4LSGA 3RRMA 4RZUA 4TZ6A 1JBKA 1KAOA 1MOZA 3MGCA 1OJLA 3HP1A 5KDLA 2ZJYA 1Z3IX 2FU5C 1FX0A 3KJEA 3RSLA 5IF9A 2PJZA 1KO7A 1O3YA 2ZVQX 1E96A 2ERYA 3IEVA 1T3HA 2XTMA 2TMKA 2FWRA 3AVPA 2O52A 2FPKA 1N5KA 1FW6A 4QC2A 2ODBA 3BH6A 1N6PA 4A15A 3L0SA 4Q48A 1F60A 2FF7A 3X1DA 3W3ZB 2GJKA 2PEYA 5D3MA 3ADKA 4K81B 2XTZA 3C15C 1P61B 5G3ZA 3SYLA 3GFPA 4WZ6A 2C03A 3DOEA 3DVLA 1JJVA 1JR3A 1TX4B 3KJIA 3TAHA 1GNPA 1W5TA 2EFHB 3SOPA 3U3RA 4XTRA 5FBRB 2YOHA 1XEXA 5A5GA 1VHTA 2DHRA 4RD4A 1BO6A 4BLOA 1NI3A 3A1UA 4GP6A 2BJWA 1AKEA 2V9PA 4KO8A 4Z1MA 4TYNA 2JDIA 2L0XA 2C95A 3LRPA 3QJYA 1OYWA 1N0WA 2IL1A 4C4PA 2VRWA 4MKGA 3GLFE 4GNKA 2EWVA 1JXMA 4JS0A 4OI2A 2ZUCA 5EP1A 1UKEA 3RRZA 3PUVA 1GILA 1CU1A 2ZE6A 1QHHB 4JVLA 2GA8A 4LOAA 1SXJD 2Z5FA 3CRQA 3TAUA 3CBQA 1R0ZA 1US8A 5P21A 1KSJA 5FL7D 1VCNA 1ZRHA 5EE5B 5KTYA 1SGWA 1NVVR 1JR3D 4JVMA 4QJ5A 3K53A 4DZZA 4KBFA 2G6BA 2OXRA 1YZKA 1W0KA 3K9GA 4I1SA 4QXAA 2FJUA 1UKYA 2A5FA 2FG5A 1QHSA 2CL6X 2P65A 4BGDA 3A6PC 3P26A 4LJ9A 2IWRA 3GLGB 1FOEB 3B9PA 1Q3TA 4HAVA 4IW3B 4B3DA 1IY2A 3TSWA 3A8TA 1SHZA 1QVAA 3SJZA 5KSZA 3VR6A 2VHQA 1T6NA 1OW3B 2B7CA 5TB5A 1UADA 1LFDB 2PEZA 4LHVA 1VTKA 4QJ3A 1G7TA 1N0VC 1E79D 2QP9X 5ANRB 3T1QA 2FFHA 1LY1A 3X1ZA 4CT4B 1LS1A 1DARA 4QGAA 4ZIRA 3OFND 1Z22A 2ZR7A 3SJBA 2XSZD 3OE7D 2V1XA 4FIDA 1KNQA 2HJGA 4LJAA 1CR0A 4MA4A 1E2LA 1HEIA 4HZIA 4D80A 1XTIA 4KVAA 3NEJA 2JCSA 1GL9B 2FOLA 1NSFA 3AQ4A 4K46A 4V03A 5IT5A 1YZQA 3K09A 2GCPA 2A30A 3B2EA 2A7QA 3BJIC 4OK3A 2ANCA 4URYR 1Z8FA 3ZVLA 2AXNA 3VR5A 2IEYA 1UBEA 1GFIA 2LWIA 1OIVA 1Q57A 3IQXA 4TL8A 4D4LA 4E07A 3IHWA 4B34A 3U7EB 2DWQA 2IEZA 2IK8A 3P27A 3FYHA 3TR0A 4NZYA 4BFWA 2QORA 5KPDA 4DB2A 1CRQA 2IYZA 1UKVY 5AK0A 4MGKR 1OH6A 5EZ6B 1BIFA 1H8ED 3ZIAD 2YVUA 1KSGA 2YJTD 3IO3A 4OKSA 2R6AA 2IXEA 1SXJA 4RZXA 5LPNA 1JB1A 4DLUA 5C4GB 3TIFA 5IK2A 1GIAA 3M6AA 1GVNB 4EPTA 3C7KA 2WMNB 3G5UA 4LC1A 1IN8A 2D2EA 1F2UB 1KI2A 4D0NA 3CZPA 4Q4HB 3NBXX 2CDNA 3SJCA 2CLCX 3SEAA 3KKQA 2GILA 4PANA 4AYTA 1S0UA 1II0A 1TQ4A 1UKZA 1XX6A 2GK6A 2XZOA 1VHLA 4PC6A 2G77B 1ZYUA 2CHVA 4BFZA 1A4RA 1X1SA 1M7BA 5JWRA 2PX0A 1HYQA 4OI1A 1M34E 1SQ5A 4BEJA 2MMGA 4F4CA 3BXZA 1F2TA 3CIOA 1XXHB 2FEOA 1ZM9A 4EFNA 1J8YF 1L8QA 5IDVA 1P2UA 2ZS8A 1P5ZB 4LRWA 4QGHA 1E2PA 5CK5A 5EE0A 1W36D 4UXIA 4M1WA 4B32A 3ICQB 3LW8A 1G7CA 2WZQA 5FUWA 1E2JA 3R20A 2YC2C 3PCRB 4F4JA 2IX3A 3QPUA 4ZDJA 2JLZA 1PUJA 1G20E 2A9KA 3M4YA 3CR8A 1C1YA 1ODFA 4ASUA 4QBHA 4TZ0A 2RGGA 3C5HA 1GG2A 3TUZC 3KQLA 3LW7A 4KLNA 1R0WA 3UMRA 4F93B 1G41A 4NCKA 2ZI3A 4GSYA 4RFVA 3THXA 2ODWA 4C30A 2WJYA 1ZU5A 2ZTSA 1GAJA 4Q03A 4TTRA 3VHLB 3U4QA 4HLUA 4ZO4A 5HE8A 4BFSA 2ZI9A 2FEMA 3GLGE 3C14C 3A4NA 2UVQA 4A92A 2VP6A 2WSSA 4JSYA 1HV8A 2XX3A 2G1KA 1XTQA 4M9QA 1KI8A 1F3OA 2BDTA 1M1YE 4B73A 1HURA 3NEYA 5LB2A 4YDSA 1OFUX 2QRNA 3CB4A 5FOUA 1NP6A 2W2TA 2W2VA 1KY3A 2VP4A 4EJSC 4TL9A 3FMPB 3CKLA 3N5CA 3QBTA 2JGNA 5DNYB 3K70C 2WJGA 1HE1C 4WOPA 2J41A 2R6GA 3B9QA 1GKIA 4NKRA 1W47A 2NO7A 2WV9A 3FFAA 3Q5DA 4YMWA 5J5CA 1DAIA 3LQQA 1DEKA 4QFMA 2C99A 4HUTA 1S9HA 2AL7A 4AG6A 1EFTA 2ZEJA 1VCOA 2XJ9A 3QQ5A 821PA 2PL3A 4O0MA 5FPYA 3K70D 3V4RA 4NONA 2WICA 3GLGA 4Q9IA 2QMHA 2QT1A 5GVSA 5CITA 5K8UA 4RD3A 2VEDA 1G16A 3FHCB 2R44A 4DUGA 2AFHE 2ZUBA 3H1TA 2FH5B 1UDXA 2BMDA 4KYUA 4CEIB 1ZW6A 2GJ8A 1J90A 1MO6A 4XOIA 4B71A 2YC4C 3H0KA 4LHZA 4HB3A 1IHUA 1NMXA 1W48A 4TT3A 4NDZA 1G3QA 1G8FA 2Z83A 4Z54A 1RC8A 3SQXA 4IOMA 4BFUA 1N3BA 2GNOA 1G8YA 2HLDD 1N6HA 4JVNA 3TMKA 4ZKDA 5C18A 4BFVA 3I8SA 2Z43A 5F9HA 4QJ4A 5M04A 2O8DA 5FTMA 4I4LA 3W5IA 2WWXA 2Q3HA 3CNOA 4JKYA 3KKPA 1QDEA 4EPXA 3TQFA 1NY6A 1R5OA 5FPHA 5AJXA 3SZRA 1XJ0A 2QMOA 4P3YA 1FP7A 3UWOA 2Q6TA 2OLKA 2K5UA 3R8CA 2CXXA 5L3QA 3K70B 2QG6A 4C0AC 2ZITA 1QG2A 4WBSA 3AVVA 4Z8XA 4JMPA 1E2DA 2G1JA 4KITB 5JBQA 1KOFA 3VMFA 4UNQA 2FE4A 3P20A 2FNAA 3UXMA 1E3MA 2CBZA 3VR3A 2DB3A 1XRJA 5A4JA 3CX8A 3PUXA 3UATA 2H8KA 4DRZA 4TSFA 3U61B 3L0PA 3AVXA 2AD5A 2E9SA 1XD2B 2XNDD 1RFLA 1JPNA 4ACAA 1EWQA 4E09A 721PA 1E9RA 4HLUC 1MO4A 4NE2A 4PHTA 5FUYA 3LX8A 4TMWA 4Q19A 2P3SA 1R8QA 1RVDA 5DN6A 4MITA 2OBNA 5EP3A 2EWWA 4F38A 3A58B 3PEVA 2BMFA 4DT1B 2VTKA 4MKHA 2UZ3A 2WJVA 4RY2A 1KDPA 4A0HA 1UAAA 4V02A 2I3BA 2O8FB 1PLLA 4HDCA 5C46F 2FGJA 3QF4A 3OFNA 4DCUA 1E2NA 3R7WA 3I73A 1Z47A 5CJPA 3R9WA 2AD1A 5SZJA 3QKSB 1DO0A 4MGZR 2ZRBA 1NIJA 1E98A 3LFUA 1U99A 4PHGA 1ZM2A 1U9IC 3BORA 2YV5A 1P2SA 4G0NA 5JSZB 1T4GA 2NO1A 2A5GA 4JLKA 1NY5A 2YWFA 4GMXA 3TW4A 4LHXA 3V9PA 2YWHA 4TLEA 5TY0A 2D7CA 1OXSC 2IF2A 2YWEA 5G41A 4Q1AA 1GL7A 1FQJA 4Q4JA 1F2UA 1Q3HA 3IQWA 3B1VA 4WZBE 2WVJA 5FTNA 2ZSBA 3D3QA 1E2MA 1GSIA 1KZGB 2ZE5A 1KDOA 2QQ0A 3EZ9A 4TLAA 5C2JB 3VAAA 5LD2C 1GITA 4A6XA 3TNFA 2Z4RA 2IYLD 3CH4B 4QHTA 4D2IA 4NH0A 4I1OA 4JL5A 4URZR 1SHKA 1J70A 2X77A 4TYWA 5LBIA 2VSXA 4Q7MB 3V00A 1WXQA 3IIKA 4MRRA 4FINA 3K0CA 5FTJA 3AEZA 3RS5A 3W5JA 3GLIB 1KSFX 3KJHA 3U3KA 1G17A 3QUSA 2DY1A 3FKQA 2CNWD 4MYTA 4XWKA 3PR1A 2JLWA 3MUFA 1D2EA 2W2XA 2D2FA 1V5WA 2C5LA 5L3SB 4KYIB 2IYTA 4PPFA 1YRBA 2EVWX 2DBYA 2GK7A 2IHYA 2IHBA 2QT0A 3UG7A 2PLFA 2QAGC 4GOJA 2PCLA 4ZIRB 4XVRA 2FPLA 5DYGA 3GCGA 4H1VA 4YMSA 6Q21A 3GQBA 4LX0A 2V7QA 3QY0A 3W6OA 1IN7A 4EJSA 2ZJBA 1X3SA 2IC5A 2XGJA 1LS6A 3BD9A 4YXWA 1YR6A 1VCIA 4TMZA 4C0KA 4PAQA 4DCTA 4OI4A 4DLYA 2D4HA 2H5EA 2ORIA 3T5GA 4MH0R 5JWOA 4M9SA 1PLKA 4LYFA 4P4TA 4NYJR 3E2IA 1KMQA 1LV7A 1W2HA 3KUDA 1MRSA 1DS6A 4Q02A 3K1JA 3FMIA 5J47A 1XNJA 5H1YA 1R5BA 3SFZA 2O8BA 2FA9A 2VHCA 4PFSA 3ZQ6A 2WKPA 4DLVA 1D9ZA 3IUYA 3K0AB 2GVDC 4P33A 1COWA 1OH8A 1XEFA 3Q7QA 2HEIA 2CJWA 2EU8A 4C0BA 3NBYC 1E9CA 4LY6A 2PJRA 3CPEA 2JA1A 4PAOA 4LBYA 1FFHA 5ELXA 4M1SA 1ZD1A 1KAGA 121PA 1SVKA 3VU9A 4GDFA 4X8MA 5EJEA 4OHZA 2DCUA 3RC3A 4HATA 4UXJA 4I81A 3GLHB 3K09C 1FP6A 3AKEA 4A8JC 1G6HA 4PC1A 1TADA 1XDBA 1OHHA 4EPWA 3LBHA 1XEXB 3T61A 1KYIA 1VIYA 3SN6A 2ERXA 2J3EA 2ZRFA 1M2OB 3GFTA 4EFMA 1XWIA 1U8ZA 2IYSA 3QENA 4E22A 4PZLA 1OB5A 2O8FA 1N6LA 5FBVB 4GZLA 4DBLC 1P4SA 3MCAA 3SE0A 1JAIA 1MKYA 1T5LA 3THXB 4ON9A 3ZDQA 4C0LA 1SULA 2G3YA 3SNHA 3NXSA 3OEHD 5FOTA 2XZPA 3VX3A 3HPQA 2IYVA 4OI0A 3CW2A 2G9NA 2P5TB 1E0KA 2XEXA 1VYVA 3U44B 1D2MA 2E87A 2JLQA 3MWJA 4ZPXA 1NJFA 3W6NA 3GJ0A 2P2LA 4RFSB 2WOJA 4PPNA 1X86B 1NKTA 2Q9BA 3FVQA 1P60A 1IAQA 1MR3F 3OEHA 2ZI6A 3SYNA 5E95A 3CR7A 3DDCA 1NVWQ 1M7GA 3UK6A 5AUNB 4F91B 2H7VA 2BC9A 1KI4A 4WXPA 4HYYA 4KFSA 5AJVB 2RGBA 3GJ7A 4I99A 5FBWB 5KPJA 1W36B 3CX6A 3M0EA 1E4YA 2V6IA 2QRZA 4J0QA 3AP2A 4PPGA 2IYXA 1H8HD 3KB2A 4N1AA 2OZEA 1FNNA 2ZE7A 3ICEA 2QBYB 2PBRA 3WMFA 1S3GA 2ZRHA 4W5WA 2GEDA 1G19A 3GLHE 1T5IA 4M1TA 1IBRA 1MH1A 2GXUA 4PQYA 1YZTA 1ZU4A 2H18A 1C9KA 1S2MA 2NOAA 2ZJOA 3BH7A 4FMBB 2CCJA 3X1WA 3AGPA 3CF0A 5KSPA 4ABYA 3C8UA 3SU8A 5CDFE 2J87A 3WHLA 2ZPTX 1ZNXA 5DE3A 4C0SA 3JVVA 1KGDA 1U8AA 2J0UB 3C41J 4JIMA 1M6NA 2P6UA 1ZNYA 4JSTA 2F43B 4WA7A 2RGNC 3O47A 1NKSA 4TLDA 1G5PA 1HQCA 4IKEA 4DLSA 2Q0HA 3ZZ0A 2WWHA 1EFCA 5F9FA 2MSEB 1AGPA 2G88A 4AURA 3C4JA 4TTPA 3MAAC 4Q9JA 3CZQA 5KSOA 1HH4A 1Q1BA 1TU3A 3NBFA 3OESA 3OZXA 4Q66C 2HT1A 4CVNA 4U5XA 2ZS7A 1J99A 2RB4A 5L3QB 1QVRA 1OYYA 2O0HA 5DI3A 4R2HA 4LI0A 4LV5B 1N5JA 4P4SB 3IKJA 1TMKA 3B1ZA 2B8WA 1DAKA 1NN5A 2ZXUA 2ZRIA 4BLTA 3T1VA 5E4FA 1Z63A 1Q1ZA 3REFA 1E1RA 2CJWB 5FFMA 1E9DA 5KSYA 4F92B 5FPKA 3UG6A 3B1WA 3RS7A 1DG3A 1E6CA 3VR4A 3D6TB 3CPHA 3CM0A 1DADA 2OFXA 1DPFA 2MSDB 3IHLA 1S96A 2C8VA 4C2UA 1G8HA 2ZRPA 1SVLA 3NC1C 3SI7A 5CIWA 3VNVA 4A82A 2IS2A 2C9YA 4LPSA 1AIPA 2QP4A 2ONJA 1CJMA 3F3YA 4X8LA 2F1HA 4PR0A 5JWHA 1LNZA 1NIPA 4IDPA 2OLJA 3IO5A 4K8OA 4B76A 1P2TA 1JR3E 2J0QA 2IXGA 3QXSA 2JLYA 4RCZA 2RHMA 2RGCA 3TJZA 1YE8A 2ZJAA 2EYQA 4XVQA 1R6BX 3CF2A 4HZUB 3ZJYA 4HAWA 1NVXQ 1G291 5SZIA 2W6JD 4A4DA 1QHHA 2FSIA 2ONKA 1IY0A 1YR7A 2D62A 4OJQA 4D82A 3LH5A 1E0SA 2ZE8A 4A8JB 3GFOA 4I1UA 2CK3D 4EFLA 2NGRA 2RMKA 5KNCA 4IDOA 4D4KA 4GZMA 1G6OA 1N6OA 4GBMA 4BFTA 1XP8A 2ZJ8A 3ADBA 1GTVA 2RCNA 3W3AA 4BZPA 4RVCA 4TN1A 3TQCA 4GOXA 4Q5IA 4CF7A 4FD2A 3AF0A 3GJXC 1G3UA 2OUKA 3C5CA 4G5SA 2YZ2A 1U2RA 2W6ID 4PQRA 4GOKA 4FN5A 4X8HA 5FOWA 3EARA 1BMFA 221PA 3RANA 1DOAA 3LNCA 1NLFA 3UKDA 2BM0A 3RABA 4EKDA 3PEUA 5JJIA 4LWZA 4M2LA 3NG1A 1Q20A 5CYPA 1IJFA 3AVQA 5HR5A 5FR2A 3U4QB 4QNMA 1DBSA 2ASEA 4UNPA 4DLZA 4DLWA 1HUQA 1OXVA 2WSMA 1ZM7A 2F1JA 3RS2A 1E2EA 5LD2B 1P9NA 5G40A 4DEYA 2ZRMA 3NHBA 3ZQJA 1EK0A 4BECA 3WHKA 3KKOA 3KXIA 1Q0UA 1KTVA 1XFAA 3THWA 1A2KC 3QXXA 3CNLA 3WYAA 2JLXA 4NYMQ 3R8FA 3WMEA 3L0IB 4IXNA 1WQ1R 3QXHA 5CIQA 2WOOA 1VG1A 2NPFA 1M8PA 1R10A 2QAGB 2B92A 3VR1A 1JI0A 1NG1A 4E03A 1SVWA 4POAA 4LJ5A 3PUYA 1FNMA 2EFDB 421PA 3SBDA 4TQ9A 2XITA 1QBKC 3Q85A 4JJZA 5DHFA 2ATVA 1SKYB 3NVAA 5HCIA 3AVTA 4KVGA 1E2IA 3WRYC 3FKSD 4AKIA 2YHSA 3WXMA 4G5OA 4ARZB 1SZPA 4CEJA 2ZRJA 2J9RA 4RFSA 2WBLC 2I1VB 3PITA 1KHTA 3EIQA 4UJ3A 3LWNA 2P6NA 3IIMA 4JT2A 4M9XA 5BYJA 1Z0JA 5BN4A 3QOFA 4HUQB 3PQCA 3T15A 4PO1A 4URWR 1AGRA 3GJ8A 3OF5A 4JBXA 2HLDA 2ZETA 1Q22A 2JAQA 3PENA 3UMFA 2A5YB 2WWFA 5TDHA 3WBJA 1NSTA 1CJKC 4M1MA 1G3RA 5DH9A 1AA9A 3QVUA 2PT7A 3AVYA 3H84A 4D81A 3D8BA 2IYWA 5AJYA 4A0GA 4JLPA 1CJTC 1G18A 1KKMA 2QZ4A 1N5IA 2QBYA 4PXAA 1X8LA
chains in the Genus database with same CATH superfamily
2OZKA 5IAAA 2RIPA 3C5WP 2PKQP 1LF5A 1K7CA 2PZAA 2Y68A 3ASVA 4IDEA 4WLEA 4AJ2A 3EAQA 1W8IA 4PG5A 2GTHA 2V54A 4C1BA 3H2ZA 2X6QA 4ARAA 1H5NA 4WIAA 3QNWA 1G1MA 3ZWXA 1W36C 1NTOA 3QGMA 4K9QA 3D6VA 5LQSA 4GUAA 2GWHA 3CWQA 1Y82A 1F0NA 3CX7A 1GGNA 3HR7A 4X63A 5JCOA 1UWLA 3UA4A 2IS6A 1E1CA 4BX3A 1T9GR 4TXJA 4BO9A 4BV9A 1X1AA 1D6SA 4LXGA 4UM5A 1CD5A 3BDIA 4BUZA 2QRMA 3OURA 3JALB 4KWIA 4MUMA 3AT1A 1P1IA 3HM2A 2ZSAA 4G0YA 4II2A 4MWTA 3GJSA 4XD7D 3T1YB 3MLAA 4GPAA 2OP0A 4E94A 1DXOA 1C8VB 2K2QB 2R66A 3PIDA 2XQVA 2BH2A 4TKVB 4QIHA 5K3SA 2VLIA 4G4IA 3PLAE 4XWAA 5CMLA 3UJHA 4ZTUB 4J0GA 4TMVA 1BXRA 3QF7A 5I4KA 1EAYA 2JIZA 2F1RA 3KKNA 2W98A 3DBLB 1ZN9A 1E63A 1NM5A 2BR3A 3ZGVA 3FBWA 3NB0A 3SR0A 2J7KA 4B3SB 4KXFB 2COUA 4US0R 2H7XA 3CGGA 5ALFA 4YI3A 5E38A 5JG7A 4AROA 3UMSA 3CLUC 1Q50A 4EY7A 4C4SA 2NUBA 3ZCQA 1MQ9A 2J6HA 3HBFA 4HDRB 4V2IA 1T4BA 4KWCA 1N34B 4YP9A 1EZ1A 3A3OA 3GQVA 3Q7SA 2VDKB 5AFSA 1OXMA 4FDMA 3ZQ4A 3ICPA 4NBRA 2OFWA 1CP3A 1A5SB 1O7JA 3DMNA 2ZIZA 4ZCQA 5CG1A 3IPRA 5JDIA 3HHPA 1I2MA 5KYTA 4JR1A 2JK1A 5HQ3B 2A58A 4UDNA 2FFQA 3ABSB 1O9GA 3LCVB 3BFVA 2J0QA 1KOJA 3K0CC 5KCZA 2BEJA 2QI9C 3D31A 4KB5A 4UBJA 1TECE 4G1CA 3UMMA 3RYHA 1NBMD 3GA0A 4MUHA 5CVJA 2CVQA 4N8SA 4GMDA 1JV2B 2W00A 1JIJA 4EI9A 5JASA 3DWEX 3KTOA 5CDYA 5B2EA 1GPUA 4AMBA 3G2JA 3H2YA 4YRAA 1JQKA 1L5WA 1W93A 2AI3A 5JW6A 1TL7C 1JIUA 4D8UA 3OT1B 4NBSA 4DBVO 2JGMA 1L7OA 4LBVA 4UM7A 4BUCA 3LK7A 1V6AA 1QFJA 2B34A 2E48A 4AWBA 1FFDA 1WLSA 1P5RA 3F90A 4LDJA 1YZUA 3ITKA 4LDRA 2KBEA 2X8JA 5CFRA 5KJ1A 1NASA 1IOVA 1L4LA 3LHDA 4ZV9A 2OYCA 5HM6A 2G04A 3I42A 1A5AB 2HFKA 5FL7A 5HUHA 2P7IA 4D02A 2REBA 4QZVA 1XLTA 2AWNA 2JATA 4G25A 5AO9A 2JJ8A 5JDCC 2PKWA 1Z4NA 1GZVA 1AO3A 5FDFA 3PC3A 3I9JA 2VL7A 3MWEB 4IO1A 2Y1WA 1N8KA 2R4UA 3D6NB 2VXCA 3NIBA 3WB1A 3DZ8A 3E53A 1QIGA 1RP7A 3HFJA 4BNDA 3OE4A 4X45A 2I7XA 3N58A 3OC6A 1VZ3A 1XDSA 3CYFA 3ZV7A 1PZGA 4W82A 3FTPA 3L8GA 1B4DA 4TS4A 3UY4A 3WFJA 4RMHA 4V0ME 5FOSA 3HO1A 3PC2A 1E9FA 3DF7A 5GZ6A 1FFWA 1Q0QA 2IOYA 4MIOA 1MJGM 4HDSB 3UAGA 3G17A 4PTZA 4X0EA 3EZFA 3JQGA 3PA8A 3QFTA 2ZIXB 4P3NA 1BDMA 3FDZB 3I9LA 3ER6A 4AKSA 4FSDA 3O90A 4X7MA 4W5RA 2HPHA 1SKQA 1JFRA 2H65A 3ADOA 3EZ7A 2ZFUA 3OLWA 2GPYA 2VCYA 3VBEA 1N5RA 1WUIS 3CVUA 3LQFA 5KHAA 1E2FA 1Q7TA 3W3AD 3VJLA 3VKHA 3DL2A 1JAZA 1GM5A 2MINB 3EIOA 1CJUC 1SBTA 3DBOB 3O73A 1T6XA 1ISJA 1BTOA 1KQFA 1JQJC 2J5BA 4PGFA 4S2EA 1KMMA 2FW7A 1VPTA 3K2QA 3KZ1E 4NNJA 4KBYA 2HY7A 1JG7A 2OGZA 2Q2QA 2QXYA 4HPWA 4QBFA 3OA2A 2QTRA 2IVFA 1H05A 3PGA1 1JU9A 1PLJA 4RD2A 2FGKA 2IRWA 3A7EA 3I8XA 1A8SA 1F5SA 1U2DA 3PXDA 4RCVA 1BD4A 4OQLA 4RTPA 2PUGA 1R5JA 1LDNA 1XTJA 2ORVA 3LQYA 4L4SA 1XRMA 3JASA 1KETA 1A1SA 1GQ2A 1M8GA 1MJ5A 1QH9A 2ZJ3A 5LSAA 3ZKAA 5HM8A 2P8JA 5CCXA 4ILKA 4CIYA 2C3MA 2HHLA 3JVEA 3E5RA 2BHRA 4RHCA 4OMUA 3F0TA 4A5OA 1RZ3A 2D1YA 4OB8A 4ILEA 5LWHA 4MI1A 5IKPA 4ZYLA 5JNRA 3L8YA 2QRVA 3SHVA 5LNK1 3AU9A 5KTNA 1UFRA 1CY6A 4TTQA 1H0HA 1Z5OA 2J9YB 2X6TA 4UARA 2Z2IA 2WKRA 3DZFA 2EX4A 3F6PA 3GDOA 3TLYA 1XRPA 3IDFA 2IVZA 4ZJYA 3SOZA 1HNZB 5JJCA 3ZHSA 1DE0A 2AF3C 1QFXA 4BO8A 5AK4A 4GI3A 4TTSA 1U7TA 3F6CA 3GJTA 3UIEA 4UUMA 4DDVA 3OOSA 1P33A 2E4XA 2PGLA 2O8EA 2JJ1A 4HXYA 3CE9A 2HT6A 4L16A 4CQMA 2HX1A 1C41A 4XAQA 5AIBA 3PDIB 4LXUA 1SQSA 1V9LA 2JI6A 4KNWA 4BVLA 4DJTA 4POOA 3VVBA 2WP8J 4MV1A 1E99A 4OMCA 3ROZA 2V03A 1JIKA 2VPWA 3EW9A 3H3JA 4GD3Q 4HRVA 4MPDA 1SD1A 1RZUA 4G2NA 4UCWA 5H8WA 4I8XA 2IU3A 4PTYA 1FB5A 3I53A 3F6RA 1I9GA 1ZGGA 1DUIA 3UYKA 4AG3A 4FJ0A 2GCNA 3RNLA 1MX9A 3RREA 1YB2A 3NVDA 4C4RA 2VF4X 4EA9A 1BS9A 3U3ZA 4M1KA 4FB5A 2WEKA 2RI0A 2ZYUX 5DOVA 2V8BA 1ZBQA 1BEUB 3KE9A 4LTNA 2PO7A 2MTBA 2CYBA 4D43A 1WETA 2CCKA 2CL0X 3LXRA 3VKFA 1KYWA 1BW9B 1ORIA 3B13B 5AM4A 5BMVA 4C3OB 2GLXA 2F3PA 3P97A 5CJ2A 1NDHA 2XXJA 2WJJA 1ABEA 4L8VA 3HO6A 5EEGA 1RLTA 3CZ9A 1QRAA 3KWMA 4PNZA 3U4CA 2QN6A 2C9MA 4X00A 4JNKA 1O2DA 1ZS9A 2GMWA 3QFCA 3RROA 4M0KA 1UPXA 2N0SA 2OE2A 3ORRA 5E8RA 2WE7A 3OU2A 4IVNA 1X9GA 2AOVA 2E4WA 3R7AA 3RHFA 3A0UA 1NZJA 4HDMB 3ITNA 2A9QA 3JD3A 4P53A 3LXXA 1H2EA 3TCXB 2JLSA 1T0HB 3HYTA 1EP2B 1QF9A 3E22A 1SB8A 2WWWA 5L6LB 3ONVA 1ULZA 5I9LA 2JZNA 5A9SB 9LDBA 1H65A 1RKXA 2DPYA 2I3GA 3DPUA 1IG0A 1II8B 5BVHA 5BWCA 5IG2A 1W0JD 2Q5EA 1OLUB 4XDGA 2JAOA 5HDBB 3KEFA 2C9CA 3TTWA 1DEHA 2O8CB 2C5AA 3AVOA 1Y81A 2O20A 3T54A 3LVBA 3ZD6A 3CQ9A 3A6EA 4GHWA 4D4MA 2PLWA 1SHTX 3DAGA 4MA0A 4XGIA 4CIVA 3SS8A 4O2BF 1KRXA 1KJ9A 5C8VA 3VR4D 1PKXA 1I4WA 1A76A 1OFHA 1QKIA 2Y1EA 1QHYA 3HR4A 3OPVA 5JSFA 3H9CA 4MEBA 3MSXA 3KZNA 5JH7F 4I36A 1HZJA 5DZSA 1A9OA 3PPVA 3TCKA 2DTXA 2ZJZA 3E82A 4EL0A 5IZCC 1E58A 2BGNA 2J31A 2O2HA 3V8MA 1QRRA 3A3PA 1ZWKA 3CRMA 2R4QA 3KUUA 2XDQA 1UMDA 3ND8A 4HDMA 4ITRC 3ZCRA 4L4UA 1AK2A 4GP9A 1GRRA 3DT9A 4O8ZA 4UVDA 4WKNA 1DBRA 2W93A 2ZIFA 4ENSA 1VLQA 3BMNA 4A8PA 4Y9RA 2OAQ1 4N6NA 3DB1A 1DDOA 3I1FA 1NW7A 4KKVA 1R9NA 5E7IA 2PWPA 3JTMA 2HO4A 4LJ6A 1NURA 3WZ2A 4YMHA 2BSQA 5A4KA 4BLSA 4WCFB 5T4HA 4I50B 5ICMA 2J0SA 1CUAA 4AXBA 3HJTA 4H18A 4QO7A 1PUIA 3OX2A 2CF6A 1TPZA 3V8RA 5PGMA 5BURA 3ELUA 3WS7A 4NAHA 1S1MA 4KR6A 2XMSA 1TM7E 1DIOB 2CMHA 2PX8A 3CLRC 4O33A 3ZVNA 2YOFA 5T3YA 1SJ9A 4PX2A 1F48A 2EC5A 2QGFA 4L73A 3UT5B 1KH3A 1J21A 4ZVNA 4A3SA 4MB6A 2XQFA 3A26A 5ICFA 4OQXA 3O2NA 5LQNA 3P52A 4ARVA 2QT9A 2FFAA 3V46A 3ICCA 1BWQA 1R9GA 4FSHA 1NRJB 4HDAA 3S99A 3DEJA 1F2DA 3HYCA 1Y98A 2WU1A 5BQ5A 1Y6RA 4MO9A 5G4LA 4L9SA 4FYWA 4Y0AA 1N5OX 3JQRA 3RE1A 5KHLB 3K9FC 1JIXA 5KOHB 3A1SA 2QENA 3BX1A 3IEUA 1U5CA 1QK3A 1RAIA 3SDZA 5IKEA 3E7PA 1ODSA 2GD2A 2BELA 3KWLA 3WLQA 1XV5A 3BBPA 2WJ3A 4JC0A 4HPXB 1CK4A 1L6IA 1FVHA 2FMFA 2JFYA 1KZ7B 3C74A 3M5CA 3RVKA 4EUHA 4OLBA 1XAHA 4FZ5A 1FUYB 1CJSA 5THKA 3VZRA 4Z2AA 3IJPA 4EHFA 3BIFA 1RWMA 5K0LA 3MA0A 2YWCA 3ZS9A 4XGQA 2CUTA 2Q4EA 1C50A 3U0VA 2GO7A 1YJ5A 5GADl 5J5VA 4EY3A 4RF5A 3X3HA 2AE1A 1KZ1A 3FPLA 1WBBA 2HXSA 1WE2A 2C94A 1P7ZA 2OK8A 3WAGA 2O3JA 2OGTA 5I8WA 2ZUDA 4C07A 1U02A 1XPJA 3L8ZA 3LLMA 1RWBA 3L07A 3LWBA 4GPTA 2V97A 1YOBA 4NEGA 1Z82A 2DWCA 4CT0A 1OLOA 3K8YA 2ZRNA 4J03A 1QTRA 3EEIA 3OP1A 2O5EA 2G25A 3WRXA 1FNCA 5CDGA 1KNXA 4MR9B 3S70A 4GQBA 4Z53A 3PSAA 1E2BA 2ZYRA 1NF8A 4A2WA 2V0GA 1TAUA 5KWEA 4L6IA 1XD2A 3O3OB 4X61A 4CU2A 1YJBA 1XVTA 5LLSA 4R2LA 4F0JA 3FETA 5CX1A 1ULSA 4YUAA 4ICIA 3ENNA 4TOIA 1TFRA 1N2SA 2R6ZA 1K5DA 2EZ9A 3M4NA 3GGOA 4D9IA 5DSZA 1RHMA 3VC7A 2FKNA 1E6MA 2Z5GA 2W2OA 3WSTA 4JOQA 3LBIA 4IIBA 2AK3A 1UANA 3UT5A 1Z7WA 1W29A 2WKQA 2CLKB 4KPGA 5JCPA 5KX5B 1G6KA 2W2NA 4E4RA 2IIQA 3FJ1A 4YJGB 3URKA 4LUCA 3T3DA 2AG0A 4JASB 5I5EA 2FW1A 2J46A 2V1UA 3TR6A 2NZWA 4W9MC 3JQ7B 1KK3A 4D3ZA 1TQ2A 3DEIA 1PD1A 4MHSA 2X2OA 4NQRA 4YRZA 3UBMA 2VDWB 3UHPA 3A1CA 1F14A 3A9VA 3OT5A 3QLUC 4P8RA 4R7ZA 2OR3A 1DT3A 3A1FA 1G6Q1 1SUSA 2E4VA 2NTVA 3H5WA 4XLLA 1QGZA 2YN0A 3G2HA 3OSUA 1DAGA 1V35A 4J1TC 2DOKA 2ZDQA 1AQ6A 1M0WA 1ZESA 2A14A 1U98A 1L5NA 2BFWA 4P93A 1ID8A 3NP9A 3CCCA 3GLFA 3G2LA 2XTNA 4ZU1X 4BL5A 1B43A 1TJ5A 3AGQA 4GMFA 4RD1A 2YFYA 3BMCB 3M82A 4L28A 4QHYA 2HK7A 3HBMA 2H0QA 2E4ZA 2I22A 4MVXA 1K8YB 1W76A 3I2JA 2FY8A 3TKLA 3X1XA 1S9DA 4KU4A 4CL8A 5ADUS 3AUXA 3RRYA 3R7FA 1H3FA 1I9CA 3EXFA 1L4YA 2JGLA 2RKBA 3D6AA 4WINA 5AH0A 4FGWA 5DLYA 4DA7A 1PS8A 1ZW1A 4YO8A 4QJIA 3QBDA 4IUBS 4LGYA 4B5KA 2H8GA 1LBQA 3H05A 1UJCA 3LHIA 4FGUA 5A5FA 3E3NA 2OHFA 1RM0A 1ZIDA 2FR8A 1KJNA 1M73E 2V7QD 2YXLA 4NYIQ 3RAJA 1L7XA 1X70A 5ALEA 1T9HA 3AHJA 4PZCA 5HOEA 3DLHA 2GN8A 4KIFA 1Z2NX 4WN9B 4EG5A 4DA4A 1JBEA 1ZLXA 2V7VA 5ENVA 1LFAA 4MJ7A 5K0EA 1J2RA 1XMVA 2JL1A 5I9BA 4WLFA 2ZBDA 2B4TO 1C7JA 2VHXA 4P3XA 1U1FA 1NN3A 3LVFO 3V3TA 3ZWPA 2XOEA 4ZEVA 1G7SA 1GDHA 1WF3A 2BL4A 2QUIA 2R00A 4ZU3A 2PBFA 3A32A 4QRHA 3SLRA 2AX3A 4AX8A 4C87A 1IN5A 3LA6A 5F98A 2QTLA 3R9XA 3EAFA 4DLNA 1B16A 1BDJA 3K0FB 3EVTA 3LD9A 2PZLA 3EIUA 3LE8A 4RC9A 4U7WA 5G4KA 4BP8A 2I2AA 4KR2A 1XZLA 4BO6A 5T3UA 1KJQA 1I2BA 3QE0A 3PC8C 4H7KA 1LDEA 3QXGA 4GS5A 3BCSA 2D54A 1KK0A 3QE9Y 1GUZA 1X1DA 2WAYA 1BWPA 1NRWA 3HLYA 1BA3A 4LDNA 1U9ZA 1Q0SA 3CT6A 4O63O 2YYYA 3TLMA 2BJHA 3HMQA 3EF1A 4KO4S 4FBLA 4L0CA 2ZRAA 1R7RA 3EXG1 1QNFA 3BK2A 3QITA 3R3XA 5AW5A 4ESHA 4B47A 4L7QA 4OJTA 5DIZA 4OHMA 1SCJA 4X65B 3RUPA 2GVZC 1P1JA 1PT9A 1I7DA 1YRAA 2GKSA 2EFCB 2YY5A 4AZVA 3A37A 5JBNA 4TUYF 5KTPA 3UMGA 1D2RA 1MMFB 2HH9A 4ROTA 4P22A 1D4AA 2DWOA 3JATB 5FBHA 1TIPA 5KTTA 1AV7A 1Y9EA 1C8BA 3FI0A 2SICE 4YJDA 2HRBA 3MW8A 1Y8QA 3WGGA 2CYAA 3AU8A 4QUHA 3RUHA 1B6GA 4XXHA 4FLEA 3ZY2A 1YQUA 2XQGA 2OG2A 3ESCA 5H4HA 1WB9A 1DXYA 3E15A 4MCJA 4DY4A 4PGGA 5IJAA 4L5JA 4WBNA 1CEQA 2BBWA 4CEHB 2A0UA 4BMOB 3D81A 3GZNB 4GF5A 4BCBA 1BMTA 3PDIA 4C4OA 2QGNA 4BDSA 4FFLA 2VUUA 1IZYA 1QK5A 1BN6A 4CDGA 2W6JA 4RJTA 2VN8A 2YMLA 1GSOA 3M2PA 5EJAA 1ZZGA 3CWCA 3UK1A 1P8AA 5ABPA 2YHAA 3IOBA 4BVAA 3UJDA 2N9UA 1AVTA 3FDZA 3UPUA 3G7NA 1N9GB 4EI7A 4H4DA 1M3SA 4NZPA 1PR5A 5CCDA 1PI3A 2IZ0A 4UPVA 1Z6YA 3DMTC 3KVVA 1GTL1 4PZDA 3RHTA 4BJ5A 3CZAA 1ISFA 2HPAA 4M1EA 3SYRA 2XDQB 4G01B 5BW4A 3W5DA 1PL7A 2A9JA 3QLVA 1OOEA 4JBYA 4JWTA 1S1CA 3KNZA 3W05A 4E2YA 3MD9A 4WV3A 4XWOA 1JLMA 4OHXA 3ZWDA 2HZ7A 2BCJQ 3L04A 4Q7JB 1KYYA 1JIQA 2PA0A 4L3VA 3TIGA 4C7JA 3JASB 3GEDA 1NP7A 1QP8A 1ZUWA 3DHYA 1O97D 3O8QA 5KI6A 1UP6A 3AV0B 5L53A 1ZI9A 1EHCA 5LOVB 1DO2A 2VSOA 3OLCX 1TVMA 4HH0A 2WJ6A 3IQEA 1OLXB 3A4LA 2V6BA 3FFWA 3L43A 4WKOA 1I7QB 1M6WA 2FW8A 3RTAA 1LH0A 1C7RA 3A6GA 4QPJC 5J4KA 5JI2E 1YZYA 1GGEA 4L51A 4P5PA 1PX0A 3FPFA 5CP8A 2M98A 1XMIA 3IQIX 4PZ9A 3EUEA 3V8QA 4BNUA 1Z5GA 3QPBA 1JKFA 5ITZB 5GPBA 1IHPA 1V5FA 3ESAA 1T2AA 4JUAA 1P31A 2A3RA 1AUQA 2QY9A 5EQJB 1GTG1 5DNAA 5FYDA 3UWKA 4DDUA 3CEMA 4RPKA 2AYZA 4LF5B 1YF3A 2GR9A 4JUFA 1GZDA 1L2TA 3K5IA 4LWQA 4K9RA 1PFGA 1EGMB 4IMJB 5CHEA 4UBOA 3SQWA 3OE5A 3OZAA 3KQVA 4I3HA 2C77A 3GAFA 4XSHA 1LJUA 2GBFA 3G02A 4C0HA 2O2DA 2OAP1 3KPJA 6ADHA 4JQSA 4EB8A 2RD2A 1R18A 3ZUGA 5GP1A 4QGFA 2YCBA 5D01A 2JPDA 1EYZA 1Y63A 4EX7A 1YU9A 3DFFA 4PC3A 4RKFA 3GLUA 4WAUA 4YAEA 1V8ZA 2F55A 1I0LA 1JQBA 2JIRA 2OZVA 4NVRA 4XJXA 3TKAA 3CNNA 4MMXB 3GRFA 2BWJA 4BMDA 4D74A 1B7GO 5FA8A 1DGQA 1KHHA 2HL6A 2RBEA 4R1NA 3WYGA 3EH2A 4C5BA 2O2IA 3VZCA 1I2CA 3FDJA 3KP1A 3NJRA 4C3ZA 4QLOA 1E9VA 2XDYA 4JU8A 2XXAA 2QJWA 1FYXA 5KX5F 2Z30A 4OYLA 1AHHA 1P1KA 2QIPA 1CWUA 4MDEA 3RUCA 4K0KB 2D5LA 1H8HA 2W0SA 3TLGA 1FDWA 3U9TA 4JNCA 4AMZA 4C05A 3UJ7A 3FPSA 1KYTA 5HDQA 2J32A 4INAA 2XB2A 1KI6A 1NJSA 1ELOA 3OPYA 3WKDA 1JT9A 1TLTA 2E3JA 2FQ1A 2O7NA 3B78A 3K7EA 1AUXA 1IE3A 1W46A 3C7AA 3QELA 1Q0LA 2EP5A 2NWQA 3UC5A 4FGSA 4BLRA 3T34A 2NSYA 5K8JB 3DWFA 1TMOA 4TTJA 1GKYA 1WY5A 2BGMA 3AG6A 4Q1BA 4XFKA 4G9BA 1N0IA 3MIIA 3LY5A 5D51S 1RXIA 5FO0A 1XXLA 4YRMA 4NCAA 1N57A 1HI9A 3BSWA 2B69A 2PPLA 1RJ9A 2C29D 2VTDA 3B8HA 4HNHA 1AY0A 1KBQA 1XEWY 1NQVA 1M34B 2VDMB 4W9RA 3RKSA 2TRSB 4LF6B 3FOWA 1KBZA 1VGRA 4ALIA 2EERA 2ENUA 2OC9A 4M7PA 2IDMA 1O8CA 2ARKA 1B8NA 1B93A 3QVLA 2P68A 2YJGA 1JEEA 3VPXA 4IDAA 2QUJA 2ODAA 1Z0KA 2X2PA 1AKQA 2GYWA 3FSEA 3QV1A 4FGZA 5J1TB 1F3LA 5DCWA 5TMDA 3UK7A 2EX0A 3GK3A 3V6LA 1JQ3A 4JJ6A 5I6DA 1TA4A 2XYQA 1TMYA 3DOOA 1PZNA 2NVUB 2YMQA 3U3XA 1YD7A 4MVJG 3SZUA 3VPAA 1WMSA 3AM5A 3M89A 1RCTE 5K8TA 2XZLA 4HX9A 4MVJA 2VK2A 1QM5A 4NDAA 1SVOA 3P9KA 3ZWCA 5MGNA 1W49A 1I14A 4F97A 4H77A 4EF4A 4JJKA 1V8DA 1KY2A 2Z0MA 4V3CA 5JAHA 4JENA 2A6PA 2A0YA 1OIWA 2DFKB 2P91A 3WJ2A 1MB2A 2YVQA 4UDYX 1N25A 3AF5A 4RIIA 5K8LA 2FEXA 2VP5A 2AK2A 6CHYA 4K6CA 4LE2A 4BFXA 4Q9HA 2VSYA 4RVFA 2AUTA 5SYMA 2Y66A 2VA8A 4LGMA 5DI9A 1IJKA 2H7CA 3B2QA 4KNYA 4XB2A 4LZJA 3QEMA 4RHTA 4KRYA 1GR0A 1UPFA 5IJXA 1HYHA 4Z0TA 2UUBB 5KQSA 3ZZ1A 4OMDA 2WIDA 1S2LA 2AQIA 3OF3A 4FYHA 4KQGA 3TN7A 4BRUA 4LN1A 5KYUB 4FSXA 2MOKA 4I6JA 3V97A 3GP3A 5LOVA 1DEOA 2IYRA 3TD9A 3BB4A 3GZJA 3ADPA 1R0XA 5GWXA 3DCIA 1PGNA 2BOVA 4B2IA 3AF3A 1V5EA 2XD4A 4IRUB 1UZNA 4LKRA 3T5MA 2IE8A 1MJFA 1W581 1LBEA 3AVWA 2UVPB 1W0JA 3R5XA 1MT0A 3JWEA 4Y2JA 3TOSA 3GIDA 3G2OA 2ZVPX 2XNDA 2OHXA 1DC6A 1ITZA 1JE0A 1KZ4A 4DG9A 1ILEA 1ZD8A 1YH3A 4CEIA 2H1LA 2X0IA 3JXEA 4JLJA 4ZKEA 1N9GA 2R4TA 3M70A 3Q40A 2BGUA 1OX5A 4O4IB 1PEAA 2XOXA 4I1VA 3OIVA 3UQZA 1FUEA 1Q11A 1SCDA 1WDTA 2HSWA 1F8GA 2P7HA 3EEYA 3Q3JB 4WLOA 1H2FA 2FF5A 2LE0A 3OT1A 3OETA 4YBZA 1CJCA 2IXFA 2IXAA 1KH2A 1W87A 5EFOA 5AVSA 2WF9A 1I3CA 3ZE9A 1QGAA 1M1YA 3A1VA 2SHKA 1S8OA 4BB6A 1UKAA 4DR1B 5HMMA 3EEOA 4PBSA 3P2MA 1NJ5A 4C20A 1IPEA 5FCDA 1TCVA 1IQPA 4RD6A 2CFIA 4X1OA 5LFAA 3G2NA 1UAYA 3B5EA 1E6LA 1DRVA 1BE1A 4AL4A 1PZEA 1TEVA 1KFKB 3B1FA 5EIBC 1AB5A 1WP9A 1YAHA 2AC7A 3EQZA 3L4JA 2QNRA 3S1AA 1S5PA 1D1TA 1PJRA 4PXYA 3TPCA 5CDSA 5I9NA 2A1TS 1FXWF 1CUXA 3COVA 2CFCA 1P2GA 2O2CA 2CXTA 3GIWA 2RGAA 1OA1A 2X8WA 4IO0A 2XA9A 3FFBA 5DT2A 3V2IA 4HDQB 1PJBA 4NZNA 5F51A 1YXMA 3SQLA 5KNDA 3FVWA 1XVIA 3M8KA 1PIWA 3CLKA 2PZGA 2Q2OA 4GH5A 4PLHA 4LXQA 2M6LA 3DG9A 1N7IA 1ZOSA 3W9YA 4BMVA 2P41A 5ICSA 1FMTA 2EL7A 4CV0A 3ADCA 3K0SA 3FBGA 1KFBB 4IDNA 5DP1A 3H0EA 2C9BA 5CYOA 5HJEA 3GNSA 4WKCA 1YZ3A 2COKA 2HU7A 4BU1A 3KOWA 5B57C 1B0UA 1EUDA 2ZJ1A 4ZOLF 4U4AA 5KYWA 2ZPUA 1K88A 2J6BA 3IFSA 3IILA 4ABTA 1NAHA 4MRPA 1H0KA 2SKCA 5K0CA 3O31A 2E1PA 2P2NA 4AIRA 3UKJA 3A6JA 4OGWA 1F5NA 3K6SA 1G42A 5LM3A 3UGQA 2PTHA 2WYOA 2HHCA 2R00C 4URUR 3VKVA 2ETVA 1RJGA 1QS0B 2Q9UA 1AZTA 3LQ4A 2F9LA 3V6MA 1M74A 1J42A 1EZZA 2EV9A 1NQOA 1UQRA 4BATA 1PSWA 1N7GA 4P3KA 1ZVMA 4DIEA 4DLBA 1FIUA 4CUJA 3ICOA 1O89A 1XCPA 1TUBA 3QYPA 1U9YA 1WHTB 5A0FA 3TTTA 2FP3A 4Q7LA 2XYVA 1EM8A 1D09A 1FUKA 2WA1A 3BIJA 3G82C 1BDBA 3L77A 3GLIA 1PKEA 2C96A 1NVAA 5TSDA 3H5OA 3OZEA 3RYFA 2RHWA 2ZYDA 3NDIA 5H9VA 1ADFA 1PJQA 3LF1A 3QJ5A 1VKOA 1Z4KA 4JK3A 2Q7OE 1JU4A 1NV9A 1V4NA 3USES 4URXR 4ND7A 4ZYYA 1W5SA 1Y3IA 4P6VF 3P9XA 4BC0A 4UOZA 4IEEA 2FR8C 4P32A 4DC1A 5CT9A 5FJJA 4JBWA 3TDKA 3I1YA 1O94D 1UKCA 2WG0A 5IM4F 5BSHA 2X4IA 4P1ZA 2ICAA 3VKWA 4ZICA 3LLCA 5KTSA 1RHRA 2WFLA 2OGSA 1MO5A 1QO9A 2A4MA 2DFNA 3IAHA 4MUNA 4UEKA 5FAKA 4EMBA 2RHDA 3F4BA 1FFXB 1V6SA 4RF2A 4KRFA 3QEJA 1DG1G 2OSVA 1NRIA 4ZQEA 1WSAA 3QTBA 1SXJC 2BTEA 1YVDA 1T1SA 4XYGA 3P0HA 2R8EA 1XEWX 2PZ8A 1DIAA 2I8AA 3HA7A 2V7GA 4GECA 5K8VA 1NPTO 5CCBA 1FRQA 5EUQB 4KREA 2MSLA 3MQFA 5DBEX 3O95A 4PZYA 3BRWD 4G56A 2ZR8A 3KTAB 4I9HA 2DQSA 2V4ZA 1PVVA 4MK4A 1SVIA 5LQCA 4X62B 1CNFA 5H3LA 1SA0B 4DA0A 4UHKA 4R16A 4E5NA 4CKEA 2FSFA 2RGEA 3DZHA 4FMDB 5B7PA 4DHEA 4A9AA 4G1UC 5JYDA 4LZWA 3L6EA 2QE7D 3UF0A 2CVHA 5EXPA 3BC1A 4V0LA 3H4VA 4RE5A 4CMEA 2ISCA 1XMOB 5AT1A 3CO5A 3H86A 4NCHA 2A1UB 4NYMR 5CB4F 1F2TB 3A6LA 2ZXEA 4C5AA 3RUEA 5MN6A 1Q1QA 1QR6A 3INTA 3LVQE 3QUQA 3FZYA 2NPIA 2IYFA 5B30A 1QQTA 1DT5A 4HH3C 3M5PA 3I34X 4JLVA 3QX3A 4RF4A 3RVDA 4FI3C 4K26A 4FCWA 1C7ZA 1PT5A 2GXSA 1BZYA 2WFLB 5THXA 4N49A 4DBZA 2JAUA 1Y8QB 3S29A 1DQRA 3C8MA 5SZHB 3BWYA 4O2AB 3TBKA 4DCSA 3NTXA 2G76A 3D4NA 4IIXA 4JZKA 5T8KC 4TYYA 2GM9A 2KYRA 4D41A 1SKYE 2C61A 1I80A 3I9KA 1JX6A 2NU8A 3ESXA 1F7VA 3DKKA 5BXQC 1GG5A 2R8RA 1K0FA 2BT4A 3DBVO 1BYIA 3PKZA 4KHZA 1UXJA 4ZVPA 4Y6OA 1QYXA 1SUAA 1X38A 1BYUA 1T43A 2Z2JA 3H16A 1M7HA 4WCDA 1BKSB 2WPDA 4V24A 3WIDA 5FWXB 1X8KA 1NBMA 1QB7A 1X13A 2IJGX 1IIBA 5LA6A 2Q3LA 3H2HA 2VRCD 5ULLA 1LC3A 4F5WA 1GDDA 2OT3B 5I7SA 4JI6B 1JHYA 3V1LA 3FOEC 1J1IA 5M34A 2HCJB 3NH9A 1YKSA 1TIBA 3H5NA 4G24A 4QUAA 3PVSA 1TW3A 4TKMA 3WIVA 5C31A 2GTPA 2BBTA 3KBBA 2FPRA 3LUDA 3VNBA 4DCCA 5JCJD 1HX7A 2X0RA 3LDHA 4WXMA 1NUPA 1ONBA 4EF6A 5DMXA 1IY8A 4XQ9A 3DDNA 4TV9F 1RAEA 4LYAA 3GELA 5JCOC 4NARA 4RGBA 2WVAA 2CXPA 4GX1A 1O6ZA 3AF4A 4UEOA 1UAGA 2ZXUA 1EFRA 3PNPA 5LZ5A 1UT6A 1Z08A 2Q9AA 2H57A 1ANKA 2OCIA 3OBIA 2AHRA 4OFZA 1DX6A 1FDTA 3CUUA 2X0EA 5KNBD 3T0GA 1E5TA 3OX3A 3D02A 3QG1A 3DE7X 1WBJB 3OZRA 1CEEA 2QXUA 3Q9NA 3TVYA 1MV8A 4CM9A 1EX9A 4QAQA 1Q14A 1V3QE 1ZD3A 4RESA 2TSYB 2OCXA 1SR8A 1XL0A 4HC4A 4JBNA 3SKXA 4E14A 4HGNA 4D0SA 1B0AA 1P9WA 2AOUA 1DBVO 1GADO 4IP0A 5AI9A 1V9SA 2EJTA 3I32A 2VQEB 2PCJA 2ZU6A 3OM0A 2VK1A 5AK6A 2JGAA 1NXQA 3VZSA 1T8RA 2H00A 4TV9B 2NYVA 1WZUA 3DVQX 1U2TA 3ZCTA 1VIAA 3QKTA 4KEAA 3V4ZA 1SG9A 2F6RA 4M9CA 5EI5A 4JITA 3WGLA 1G0OA 3BFJA 4JXKA 4C4XA 4CMCA 4NJMA 5CB8A 4DUGD 3IDZA 3EA5A 4NK4A 3WP1B 1XTRA 3MRSA 3NRJA 4F8YA 3P2YA 2AC4A 2NMVA 1CKEA 4BAUA 3PJFA 1GLNA 4RK1A 2JFUA 1NVUQ 2FTKE 5G1PA 3PYLA 4KR7A 1EM8B 3L4BC 3VVMA 5EE1A 3OWXA 3KXDA 3PNYA 3HKEB 3N2GA 3WADA 2BGLA 4EMSA 2I6TA 3LYLA 1II8A 1U8TA 2R1TB 1TF5A 2H16A 3D1JA 3QNUA 4WJKB 5T6MA 3VNAA 4X6XA 1JF8A 1Z56C 2HB6A 3BREA 4KQIA 4QHSA 1DEAA 3EOZA 4QG3A 2ZCVA 4JYMA 2O1XA 3AEKB 3ITEA 5CW2A 1VKJA 3D3KA 2G80A 1HWYA 4K5QA 4YDHB 3R6GA 1GAEO 2BSXA 5T4BA 4D45A 3SPXA 5JY6A 4BFYA 1EVJA 3IJEB 3GH1A 1NR1A 1XTBA 2N3ZA 5CLJA 4UQPA 1N36B 1JDVA 4FQ8A 1WW8A 2GLUA 2IZ1A 1XG5A 3ZD8A 5JROA 3N2KB 3I5MA 2PSEA 5F35A 2XWPA 5BQ3A 4O1HA 1Z4JA 4GP7A 4BMXA 3LG2A 3W79A 5HZKA 4OGLA 4U63A 3MQ2A 3W5HA 1UUFA 2X3YA 3WJ1A 2RBGA 4IKOA 1UJ6A 4IFTA 4TM7A 4YV7A 4EEZA 4Z7JA 5LYJB 4BQOA 5C32A 1RWNA 1B3BA 1ZA2A 5CFLA 5A62A 3AOEA 3T5AA 4H7IA 2KS6A 1G38A 4BQSA 2UU9B 2FMKA 3JARA 2E85A 1KJZA 3BWBA 4HMQA 4EYGA 3ZWYA 3DDZX 3V1KA 4EW6A 3WIUA 2XUHA 2JGKA 1FVFA 2WWIA 1CQPA 4TL7A 1U28A 2O8NA 3CW9A 3DTYA 2D3WA 3NONA 3ZIDA 3BOSA 1X7YB 2H1RA 1X1EA 3UV6A 3FRHA 3WLMA 4HBGA 5C8DA 2ZBUA 1ISHA 4JLAA 3WKBA 3R0QA 3OCZA 3PD7A 2O2ZA 1XVUA 4HJRA 4TV8A 4UU7A 4RTLA 5JEEA 4RZ2A 1YNOA 3RRJA 2JRCA 4NL4H 4MV9A 2YY6A 3WRYA 1CSEE 3MJVA 3SFVA 4TS3A 5HOQA 2ZWIA 1OC4A 4HQRA 1WDKA 5ECDA 5H9WA 1U7UA 4ACBA 3SHFA 3W34A 2PUEA 3DT8A 2F17A 1CR1A 2H2WA 2WPDD 3PUHA 1W73A 4FFPA 4RENA 4URFA 4BGUA 1JW9B 3BWMA 5I47A 4W1RA 4RVUA 4QU5A 4QOJA 5HRAA 4JI4B 1YV9A 4IDHA 2G0AA 5JAUA 2Q9CA 4BN5A 4UKDA 5K6TA 4OU4A 1YFKA 4UNNA 4FE7A 2DFLA 3KJNA 1NNSA 1QE0A 2QX4A 3E70C 3I8OA 3H83A 4BB0A 4IM7A 2YN2A 4R1UA 4F9FA 5JATA 1HORA 2CLEB 2XUZA 4NBWA 2NYRA 3BE4A 4KSBA 4EPYA 5LJIA 1ECLA 4MRVA 4FWIB 2N46A 3HWSA 1EEHA 5FIUA 2HOQA 3MJ4A 4ZV4A 4XIIA 1NQWA 4CCYB 5ERYA 1GQFA 1FVOA 3G6KA 3GBPA 4HEQA 3DOFA 4W8HA 4GLFA 3O1JC 4GXNA 2HF8A 4YI5A 3QP9A 3JRWA 4AAYA 1VPWA 4OHFA 1A5TA 2YOGA 1CZNA 2CYCA 2NU6A 4MICA