1LDMA

Refined crystal structure of dogfish m4 apo-lactate dehydrogenase
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
329
Chain Sequence
ATLKDKLIGHLATSQEPRSYNKITVVGVGAVGMACAISILMKDLADEVALVDVMEDKLKGEMMDLQHGSLFLHTAKIVSGKDYSVSAGSKLVVITAGARQQEGESRLNLVQRNVNIFKFIIPNIVKHSPDCIILVVSNPVDVLTYVAWKLSGLPMHRIIGSGCNLDSARFRYLMGERLGVHSCSCHGWVIGEHGDSVPSVWSGMNVASIKLHPLDGTNKDKQDWKKLHKDVVDSAYEVIKLKGYTSWAIGLSVADLAETIMKNLCRVHPVSTMVKDFYGIKDNVFLSLPCVLNDHGISNIVKMKLKPNEEQQLQKSATTLWDIQKDLKF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M4 LACTATE DEHYDROGENASE
publication title Refined crystal structure of dogfish M4 apo-lactate dehydrogenase.
pubmed doi rcsb
source organism Squalus acanthias
molecule tags Oxidoreductase
total genus 105
structure length 329
sequence length 329
ec nomenclature ec 1.1.1.27: L-lactate dehydrogenase.
pdb deposition date 1987-11-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00056 Ldh_1_N lactate/malate dehydrogenase, NAD binding domain
A PF02866 Ldh_1_C lactate/malate dehydrogenase, alpha/beta C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1ldmA01
3.90.110.10 Alpha Beta Alpha-Beta Complex L-2-Hydroxyisocaproate Dehydrogenase; Chain A, domain 2 Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal 1ldmA02
4W9NC 4QX6A 4BNXA 3GF4A 4RZHA 1K89A 1NAIA 2X86A 4RVGA 5BSGA 4LSMA 4BOYA 3D3WB 2B69A 4FC7A 5DP2A 3VOSA 5TX7A 3WNVA 5ITVA 3DOOA 1KEPA 2Y1EA 1IPFA 4HBGA 4XR9A 3RUFA 1KS9A 1Q1NA 1VKNA 2VRBA 1U8XX 2YQ4A 4E12A 3RU7A 3SJ7A 3N7UA 3LLSA 3WGTA 5BSFA 1NQAO 1W0CA 3PYLA 2V6FA 4TRNA 2XXBA 4PG4A 2QRJA 3D5TA 1SOWA 3CPSA 1CQJA 1PS0A 4B4WA 1XGKA 1ZH8A 4S3MA 3GNSA 4WCFC 2DPHA 1G0NA 2GN9A 3FNFA 3FCOA 5L95A 3DZJA 2FHSA 1GZ4A 3JQGB 2OMEA 4FPXA 3ULKA 4BL5A 4XRGA 5IJZA 4ALMA 3GQVA 4IJUA 3VZSA 1YJQA 1KETA 3O38A 3WJ7A 3WQSB 4W9NA 2Q1UA 2R00A 2X5KO 5A06A 1GCUA 4R3NA 2PV7A 3OF2A 4JJGA 5EMHA 2EERA 3OQ1A 1NR1A 4R4JA 4BO3A 1QYWA 1QORA 4L76A 4OQYA 5JW6A 1PZHA 2ZJ0A 4LMRA 2FPIA 2O3SA 4KMSA 1EK6A 4ZRNA 1H6BA 4O59O 3WR5A 1QLJA 2DKNA 3ZWAA 1DDOA 4FGWA 5ER9A 2O2SA 3H7AA 3GDOA 4YTEA 2X7HA 1Q7GA 2I9PA 4UREA 5EINA 5FF9A 4CM9D 2EGHA 1KC1A 1R4MA 1ARZA 1R4NB 3QWHA 3CE6A 2AEJA 4TMFA 1P77A 1C3VA 2HMTA 4AJHA 2Q50A 3I9OA 4GWKA 3GN2A 2D0IA 1WDKA 4Y6RA 4AJ4A 5KJEA 4DPLA 4RF3A 4ALJA 1WXDA 1ZNQO 3AU9A 2HQ1A 1Z7BA 4YAIA 3DZHA 1U8FO 2YUTA 4CPDA 3S2GA 1C0KA 3KRTA 5C37A 4BNZA 4J2HA 4IGFA 1H9BA 5F5NA 2W2LA 5JAIA 5EQFA 1YGYA 5DBIA 4YRDA 1XWFA 3EK2A 4WJZA 4YBZA 3L07A 4H15A 5BNFA 4CM6A 1H0KA 3WGGA 1ADGA 2PKQP 3AM3A 3E5RA 3GEMA 4D41A 5F3RA 2YDXA 2H9IA 3LF2A 1BRMA 1H2BA 4YT8A 1ZEJA 3WGIA 4ZGWA 1H6AA 2GPTA 1MX3A 2Q45A 2AEMA 1ZK1A 2QRKA 1AE1A 1CIVA 3FN4A 3VH3A 4BHTA 4CQLB 4OQZA 2EG9A 2Y1CA 4GSLA 2WDZA 1T2AA 5JMPA 3WWZA 4EGFA 1E6WA 1XSEA 4NU6A 4QO7A 1PJQA 4HWKA 5L4LA 2FWMX 3JQ9C 1ZSVA 1XU9A 1UDBA 1JW9B 4FQ8A 4IINA 3ZV6A 3U49A 3ASUA 1Z75A 4NBWA 3DBHB 1GYQA 4TZTA 3BMNB 5K6AC 2UYYA 1Y8RA 4OOEA 2VWHA 2D5CA 3B1FA 5H81A 5DF1A 2PY6A 4PZCA 3WGHA 3P7MA 2HCTA 2HRZA 4YT4A 3VTFA 3RROA 1XA0A 1H94A 3WGQA 3VVBA 3HADA 1RKXA 4F45A 3JYLA 3VDQA 3NUGA 3FHLA 1XQ1A 1ZW1A 4BV8A 3OM9A 1R0LA 3W1VA 4E5PA 4NMHA 4ITUA 4L0QA 3E48A 3OETA 5KVCA 4FSHA 3RU9A 1KVTA 3MOGA 3Q9NA 1T2DA 1ISFA 1V35A 2PLAA 2QW8A 2DBQA 5JAQA 2VYNA 2PD4A 3ZHZA 1NPYA 1X0VA 3PHGA 2CY0A 1LLUA 5DOZA 3VKVA 3O4RA 2AQ8A 3A14A 1HYHA 3EDMA 3DFUA 2I99A 3OJFA 4XRRA 2GYYA 1GV0A 3IAHA 2IEBA 3PDJA 1TLTA 4KQWA 1LDGA 2Z5LA 2EKPA 4MVJP 4C4OA 4CM8A 4Z6KA 2NVUA 2NNLD 2WJPA 4J9VA 2PZMA 1I2BA 2YV1A 5JCJA 2Y93A 3IP3A 4CMHA 3DAGA 2FP4A 3NTOA 4ND1A 1NFQA 3GZNA 3BTOA 3TOZA 3ORFA 3LT0A 2VOEA 2UDPA 3Q2KA 1SO8A 4YAKA 3I9JA 3ZNPA 5KNLA 2CVZA 2F00A 5AXAA 5ICSA 1ISJA 2H1SA 2TMDA 3GFBA 4ZD6A 1IHXA 1Y5RA 3QE3A 4GBJA 1JDJA 1QMGA 5I8ZA 3RC2A 1E7MA 1UAYA 3K73O 4U5QA 4XGKA 4CL8A 3MJCA 4I5DA 4BNUA 4RCVA 3F1LA 4OXYA 4ZQHA 2OXIA 1A72A 4RQUA 3QVSA 2J3KA 1GYRA 4MKZA 4E5MA 4LW8A 1PEDA 3C24A 1UZNA 3KETA 4E33A 2VYVA 4NFSA 3QVXA 3AFNA 4DPMA 3O8QB 1MUUA 4NU5A 1ZK2A 3IMFA 1J0XO 4XR4A 4EW6A 3ZV5A 3GT0A 1ZO8A 2HJRA 1SPXA 2X23A 2Q4EA 3MOIA 2HKIA 2W90A 1NPDA 2Y0DA 3MZ0A 2Q1TA 1N92A 3ZWOA 2D1YA 4BNMA 4ZJUA 1A4IA 3UXYA 3NJ4A 1PR3A 3GNTA 4YAJA 1WP4A 4CUKA 3GAZA 2OOSA 1NFFA 3WSVA 1IULA 3ANLA 1B8UA 5F1PA 1B16A 5TC4A 1T25A 3BHIA 3I23A 3LYLA 3PQDA 3ADPA 3KEOA 4W4TA 3L6OO 2I3GA 2WM3A 2HO5A 4Y6PA 3W8DA 1CJCA 4MIEA 4C7KA 5BSEA 2BGKA 1I2ZA 3JQEA 4W99A 4CMKA 4IMRA 2HAEA 3QV1A 4ZU3A 3P2OA 3DL2A 3R1IA 1GU7A 3T4XA 3IKVA 3FR7A 3W4IA 2J3JA 4CM8B 2B4QA 4ESOA 4HP8A 5JDIC 2YYYA 3PIIA 3VDRA 4B4OA 2BMAA 2WE7A 4FN4A 1MC5A 4YDRA 1EQ2A 1VC2A 1MXHA 2NLOA 3NRCA 5CFZA 3ONDA 2Q46A 1NX6A 3GVPA 3JQ8B 4J0FA 5BQFA 1K6JA 3IP1A 1IOLA 1DRUA 3G17A 3RBZA 4DVJA 4PG5A 4EITA 1Y8QB 2BF7A 4YT2A 5JBIA 3ZU2A 2IXAA 1ENZA 3RUAA 2D4AA 4IDGA 1M75A 4OO3A 3WQRA 5IDQA 2GLXA 3K6JA 3QW2A 1DIAA 4DBVO 3DBRA 3I6IA 4LRTB 3MTGA 1AHIA 3I3OA 4YT5A 3B70A 3VPXA 3HFSA 3FWNA 4ALLA 3NTRA 3I9NA 4DMMA 1TI7A 2OHXA 1NBOA 3AU8A 2WSBA 1XG5A 3S1LA 5JO0A 3FPCA 1XEAA 3EGOA 4R68A 3RVDA 3ZWCA 4KUGA 4WKGA 1XU7A 4YCAA 4L73A 1Z6ZA 1IE3A 3WGOA 3RFXA 3GEGA 4BNIA 3I83A 3TJRA 1JKJA 4HXYA 4OM8A 2X22A 4PFJA 5CDYA 4RPHA 2Q3EA 3IS3A 3UHAA 5KOIA 4XIJA 2CF6A 2QZZA 1UXIA 1GCOA 4DL9A 1PQWA 1TVEA 2WEKA 4B4UA 5IZCA 3ROMA 3H9QA 3S2EA 1VL0A 4OYRA 3V2UA 4XYGA 1DFHA 3Q9UA 2BFPA 5B1YA 2VQ3A 4WLNA 4XA8A 3AOEC 1NFRA 3DZKA 2C7GA 4XB2A 3ADOA 2E48A 3UW3A 1P1KA 2X0RA 1QYCA 2CFCA 1FXSA 3T7EA 3HE3A 3JQ6A 5F1KA 4OXNA 1OC2A 4F46A 1P3DA 4PVDA 1Y8QA 3JQ9A 3C7AA 1MP0A 2NUAA 2YFQA 1I01A 4EEXA 1MV8A 2ET6A 3QWBA 4HNHA 1FDTA 1O0SA 4XWYA 4FD3A 5AQ1A 3ZNOA 3LC2O 1BW9A 1LDEA 3QA9A 3V5NA 3ZNNA 1EFLA 4B8WA 4LCJA 1OZAA 3ETGA 3HB5X 5TJHA 4CUZA 3DAFA 2HSDA 1JWAB 2BD0A 1IB6A 3WLFA 1OAAA 1JAXA 1BXKA 4MVJG 3NT4A 1BVRA 2PGDA 5J23A 2FOIA 2YFHA 3T4EA 4IDCA 3DEYX 5B4TA 1IY8A 3STHA 4TRMA 1XYGA 4FFMA 1V0JA 1UXGA 3HUDA 4CQMA 3L77A 4Z3DA 2IYOA 1PGJA 3VHRA 3A28A 1OI7A 5G0SA 3NYWA 3ETDA 4CLOB 1PJTA 1PQPA 1M6WA 3C7CB 3TZ6A 1HF3A 4TRJA 1T1RA 2DTDA 4RLHA 3OH8A 5K0ZA 1HLPA 2JCXA 1DFIA 3JQ7A 4RV9A 4YPOA 4BNLA 4Q3EA 1TB4A 3FBTA 4IIUA 4WEQA 4UEOA 1CF2O 1A71A 1XDWA 4YA6A 3FNEA 3GVXA 2JD0A 5CDSA 4HFJA 1RWBA 3LQFA 2ZCUA 3RFTA 5B37A 5JYDA 4M54A 4CLRB 3HJAA 1KEWA 4RZIA 1XKQA 3ZHXA 2C7VA 5I7EA 4J91A 4E2ZA 2IYPA 2HRBA 1LTHR 2OO5A 4G2NA 2Y1DA 3LT2A 4J1TA 5LC1A 2AA3A 3TL3A 4J6FA 4RL6A 1LDYA 1TT5A 1UXJA 2PFGA 2JD2A 2JCYA 3A06A 1UZLA 2G17A 4DLBA 1LLCA 1LSJA 2BGLA 2J3IA 2LDBA 3G1UA 4N7RA 3RBXA 1BXGB 1EUDA 3BHJA 3JQBC 3AUAA 4DPKA 3HHPA 5TGDA 3I4CA 1I3LA 3ROQA 4CR7A 2X5OA 2UUPA 1G1AA 1Q0LA 2VHZA 4DYVA 5JO9A 1T4DA 1DRVA 1N7GA 3SJUA 3CKYA 3MWDB 4RDIA 1U9JA 4Z0PA 3A1NA 2AE2A 7MDHA 2AQIA 3WICA 4D44A 2EW8A 4PN3A 1C1XB 1GR0A 3GFGA 2CNBA 1K0UA 1L7DA 1X7DA 3WYEA 1PZGA 2GRAA 2O3RA 3K96A 2UVDA 2Q2WA 1P45A 1IHYA 1X14A 1X7GA 3ICCA 4N5NA 1Y8RB 2C29D 4AL4A 1CETA 1E3JA 1ZMTA 4CODB 1YDWA 2PK3A 2X4GA 1JKFA 4UVIA 4R54A 5JAZA 5BSHA 1Q0QA 3EZYA 4W7IA 3VPSA 3GVCA 1SEVA 2G5CA 3ZHYA 3VZQA 4BGVA 4N54A 2VRCA 3WQQA 4AJLA 1B8VA 1E1KA 1Z7EA 2NTNA 3PQFA 4BB5A 3ZWWA 4M87A 4XYLA 3PYMA 3GNQA 2GDZA 5B12A 4CV3A 3JQBA 3RUEA 4ZRMA 2CDCA 4RQTA 1J6UA 4GVXA 2RH4A 4DRYA 5L45A 2HMUA 3L4BC 1T24A 1I3NA 1U2GA 4OAQA 3OQBA 1NASA 4WEOA 4A73A 4FFOA 4ALNA 1XCBA 4PLVA 1LRLA 4IS3A 3INGA 5A3VA 3WIEA 1V3UA 1J5PA 1C1DA 1C0PA 1HYGA 4D42A 1R37A 2DUUA 4GPD1 3JD4A 4BNJA 2UUOA 4F6CA 5G0WA 1H2HA 4CR6A 3KYDA 4RGBA 3D7LA 2ZTMA 4NBTA 4U6QA 4HY3A 1EQUA 2AW5A 2TMGA 3UCEA 3OJLA 3JQDA 1F17A 4D45A 1N7HA 3ZWXA 4HX5A 1KY4A 1O95A 1ONOA 4DGSA 1VKOA 3ETEA 2P4HX 3WMWA 2EF1A 3A4VA 1LDMA 4TZKA 5I9MA 2BKAA 1NVGA 4R3WA 3SBOA 4FOSA 1PL6A 2J3HA 3B1JA 4LCEA 2DFDA 4PLHA 4QO8A 4YJHA 3S2FA 1R12A 4CMEC 2VTEA 1GQQA 4BO4A 2Y1FA 3LC7O 3E1KA 4J1SA 4YYZA 4IQ8A 3PJEA 2W8ZA 3IJPA 3QQPA 3ZCXA 4DQVA 2B5VA 2CD9A 4RF4A 2X58A 4BGUA 2NQ8A 3WFIA 3OJEA 4AJ2A 4J7CA 2I5PO 4YR9A 4TKLA 4A7PA 2Q2QA 4URFA 2NU7A 4KZPA 3OHSX 3DOJA 4E4YA 3RC7A 4RPGA 3QLJA 1E7QA 1HE5A 3RI3A 1N1EA 4QUKA 1I5RA 3ITKA 2E6UX 3PFWO 1BXGA 1WVGA 2NQTA 3LSYA 3N58A 4EI2A 2RH8A 4F3YA 4QXMA 4E30A 2E37A 1MGOA 1TT5B 2GN6A 4KDFA 4PG8A 1S7CA 4R41A 3QRWA 2UV8A 1P31A 2CDAA 3PJGA 1C0LA 2ZTLA 1LUAA 1HKUA 4CM4B 2AMFA 2PNFA 4YJDA 3LLVA 4XYEA 4NIMA 3W6UA 3DTYA 1GL3A 3PWSA 4EJMA 2VCYA 3GZ4A 4CMEA 5AOVA 1LQUA 1X0XA 1BGVA 1NTOA 4ZA2A 5T57A 5A5FA 1BXZA 3DC2A 2I3AA 4R1NA 3W8FA 3ZWPA 1DLIA 1EBUA 1U28A 4DQXA 2VHXA 1E3WA 4OH1A 1GADO 3ROPA 4IJKA 2BI8A 1ZSNA 2A35A 4IJVA 3VPGA 2G0TA 4Z3KA 1E3SA 3JQGA 4II3A 5KIAA 1ZUD1 2A4KA 3B1KA 3DHEA 5C3MA 4Q3NA 4Z0HO 4TWRA 1QYVA 1ISMA 4YJHB 5HM8A 3WYBA 4I9UA 1VL8A 5JPIA 4D43A 2O3JA 4Q39A 4RF5A 4AICA 1Q2XA 3TSCA 3D0OA 1EE2A 5CPFA 1XLTA 2J6IA 2GNAA 1D8AA 2PZLA 1MXFA 4HKTA 3ZV4A 4EBFA 2BFAA 1HL3A 2P5UA 3AM5A 2PGJA 3D4NA 4ALKA 1CDOA 2NADA 2Q4BA 1NQ5A 1AGNA 3TWOA 1XELA 4Z0TA 3BTSA 3H3JA 4QTZA 6LDHA 1S6YA 3PYXA 4IZIA 4DC0A 4EZBA 3F9IA 4AJIA 1U7HA 3PFFA 4J9UE 3LDHA 2HK7A 4RF2A 5A02A 3TZQA 1B2LA 1LA2A 1UP4A 5A4DA 5AYVA 5FWNA 1I0ZA 1EK5A 1ENYA 3SC4A 1YJ8A 4ZQBA 1NVTA 3H5RA 2OL4A 3FTPA 4RPKA 4DREA 2PA3A 1RYEA 3K2BA 3WBBA 1MB4A 2EJVA 1GYPA 2Q49A 3K31A 1LLDA 4NFHA 1BDBA 4PG7A 5A9SB 4PVCA 3ZH2A 4BMVA 2PGLA 1I2CA 4KUEA 1FDVA 4M49A 2P68A 1GUYA 3CTMA 4IIVA 4NK4A 3NX4A 4BGIA 3JYOA 3ST7A 2SCUA 4RPLA 5AVOA 4XDYA 4AVYA 3C1OA 1LDNA 1R6DA 3VH4A 2H5LA 3LF1A 1GFSA 2QYTA 3NGXA 4FW8A 3GK3A 4GQAA 4FFLA 3R3JA 1UP6A 2CZCA 3LU1A 8LDHA 1DBVO 5DN9A 1HE3A 1K2WA 3DMTA 3MCVA 5ICMA 2X0NA 2VZ8A 1DEHA 2EV9A 4DIOA 1LC0A 2IZ0A 1KVSA 3AI2A 4HFRA 5ENDA 2OP0A 5DCYA 3AFMA 3PPIA 1PJ2A 5JSFA 4GX5A 5CP8A 3SLGA 5IXSA 4CMJA 2O23A 2GZ2A 2VWQA 3R0IA 3F5QA 1U3UA 1VM6A 3JD1A 2JFGA 4GL4A 4RVUA 1PSDA 5ADHA 4E31A 4NHEA 2GN4A 3VTZA 2RCYA 3K5PA 2Y99A 3DTTA 2HU2A 3LT1A 4YXFA 2HUNA 4UUPA 3C85A 4MVJF 1PS9A 2QZ9A 4ONEA 1X13A 3B20A 5GZ1A 2W4QA 3PVZA 4UVHA 1NVMB 5CEJA 2EW2A 3U4CA 1DAOA 4E21A 5BNTA 1AXEA 3I4FA 4MVJE 4YJFB 1YBAA 4XYMA 4C7JA 2WD7B 3BA1A 2ZYDA 2Z95A 2AXQA 2PZJA 2Y0EA 5HA5A 3ZNQA 1W73A 3GOHA 4B3HA 4LRSB 4Z9XA 4OMUA 3HDQA 4BNHA 1U5AA 4ILKA 5B4UA 2QYSA 4CM1A 4CLOA 3JV7A 4NFYA 3QWFA 4R5HA 2Q2VA 3D64A 1ZBQA 3F1KA 4DIBA 4TROA 1DOHA 4CM3A 2W2LD 1IUKA 3G3EA 1NHWA 1ZVMA 4QECA 3BTUA 4KDEA 1LC3A 2DPGA 1NWCA 4WLVA 1LSUA 1RM0A 1EDZA 5TRTA 3WBFA 3GLQA 1F8GA 1UZMA 4PG6A 3WWYA 3OFSA 4CQMD 2GSDA 3TN7A 3KBOA 4NJOA 1U1IA 1F8FA 3V8BA 1DHTA 3DFZA 1YDEA 2HK8A 4JBIA 3HB4X 2BGMA 3PP8A 1UXKA 1GTMA 4K9DA 4JK3A 3GC6A 3HZZA 3RUDA 1KERA 5G2OA 3WXBA 1Q7CA 2VHVA 4Z9FA 3JQAA 5AXCA 1YONA 4TSKA 3O8QA 4PLPA 3Q3CA 4R1UA 4JJIA 2O7QA 1YH3A 3JD3A 2B35A 4HADA 4NPCA 3WNQA 2Q99A 4UVEA 4PLWA 3RBVA 4ZICA 3EAGA 4Q9NA 3LT4A 1HZJA 1DFGA 4BQRA 2C82A 1GUZA 5K9ZA 5TIIA 3RIHA 1P74A 2DAPA 2G76A 3KV3O 4CMIB 2J5QA 3L4BA 1B3RA 3FTNA 1H6DA 1ISGA 1XR3A 4CV0A 2ZTVA 3NV9A 3WG9A 4YAGA 4II2A 1B8PA 2X5JO 3VZPA 4DMLA 3GHHA 4G65A 4DC1A 3OICA 4NJMA 5JLAA 4ND4A 3WSWA 4BVAA 1ZSYA 3ZWVA 4JIGA 4GSKA 3UCXA 2NVUB 1SEPA 1NQTA 1PJ4A 4AJPA 4D0SA 3I5MA 3OJ0A 4JX8A 2YDYA 2YW9A 2G1UA 2ZKLA 3PK0A 2XF8A 5L40A 2PD3A 4J7XA 4GX0A 3RKRA 4IPTA 3M2TA 1BDMA 1PR9A 1SOVA 4GKVA 1R15A 1V8BA 4IM7A 2BHLA 2XOXA 3ABIA 1E1MA 4Y9DA 3OIDA 2VT2A 2C20A 3QHAA 4AJNA 3ZZNA 3MJ4A 2AQKA 4RVDA 4I08A 5K6AA 1P9LA 3HN2A 3NKLA 3INTA 4R5MA 2C5EA 1PWZA 4JXKA 1PJCA 2FN7A 4XQ9A 1Y81A 2ILTA 3PGJA 2DBZA 3AUUA 4MVJH 1YL7A 3C7DB 4WNCA 3ZWMA 7ADHA 2FZEA 2VNSA 2V7PA 3WX0A 1DIGA 3KO8A 4FJ2A 3FR8A 1VPDA 3CXRA 1WZIA 3ZW8A 1HRDA 3E82A 4H3VA 1E3IA 3M2PA 1I33A 4LK3A 5T5QA 3UICA 4WOJA 2HDHA 1MFZA 3SC6A 3JQ8A 4XX0A 1O89A 4BKRA 3OA0A 2PR2A 4BS9A 1RM3A 5TT1A 1W6UA 4P4LA 1R0KA 3NAQA 3U4DA 2I65A 3KTDA 3V2HA 3WDSA 3SVTA 2XPCA 3FPLA 4U6SA 2IEDA 5EERA 1M67A 1ENPA 1CERA 4IMPA 1E5LA 5DDIP 3RASA 3FWZA 3H9EO 3I9LA 3BAZA 2JD1A 3VVCA 3D4OA 3FI9A 3JYPA 4YRBA 1ULSA 5ER6A 3F4BA 3JYQA 1NR7A 4BO9A 3VZRA 4BNFA 4DUPA 4G5HA 4U7WA 2PD6A 4KOAA 4Y98A 1ZEMA 3BMCA 1D1SA 5C7IO 5KJCA 4H7PA 1D1TA 5COAA 4E5NA 4GMFA 3AI3A 2DTXA 1GZ6A 5THKA 1DIHA 5C5IA 3GR6A 3WB9A 2ZJ1A 1ADFA 4K6FA 4BO7A 5IFLA 5TSDA 3R6DA 3FRJA 1EVZA 3KSZO 4BNWA 3U0BA 5F21A 3TOXA 1Y1PA 1LQTA 1NQOA 2XXJA 3BIOA 3G0OA 4MIYA 3ROKA 2QG4A 3IL2A 1YOVB 3C3XA 2YQ5A 5F5LA 4YQZA 2EIHA 4OJNA 1GZ3A 1ZZEA 1X1TA 3DHYA 1XHLA 2D8AA 4GVLA 2WMDA 1VJ0A 2UAGA 5DCUA 1N8KA 1V9LA 2EXXA 4L4XA 2IODA 2JHGA 3QVTA 2VTDA 1HEUA 3COSA 3IQDB 1QRRA 4P4GA 5CG2A 3P5SA 1SB9A 4N5LA 3HG7A 4IDAA 4MKRA 5KKAA 1ZMOA 3W4JA 4L4RA 4CMIA 3F3SA 4XYBA 1YOVA 4J0EA 1E5QA 4MJLA 1DC4A 5A03A 4NNJA 1DB3A 5KCZA 1HDRA 2FRDA 3PEFA 2EWMA 3WJAA 1CYDA 2OBYA 2WD7A 3GEDA 4P38A 1QLHA 1FDWA 4HUJA 1GDHA 4ND5A 1H9AA 3GH3A 5A9RA 4A10A 3VPHA 2P91A 4IBOA 4ND2A 4BO5A 5DNAA 5L3ZA 3GZNB 5JC8A 3BMCB 4MKXA 1PQUA 2ZCVA 3WGYA 5I7SA 4FIZA 3UCFA 3VAZA 4BO1A 4O63O 2VUSA 1OMOA 4TKMA 3AY7A 4L74A 2FMUA 4CL3A 1LBEA 1UDAA 5GY7A 2CDBA 4TQGA 4RVFA 3PZBA 4YJFA 4R1SA 4RPJA 5L7WA 1ENOA 1Y7TA 4MOWA 4INAA 4PZEA 2I67A 4NH4A 2DU8A 1V6AA 3I1JA 5T6BA 1EDOA 1ZFNA 3Q0EA 1F14A 4NDNE 3BHMA 4EJ6A 2JFHA 1PGOA 3NT2A 3OIGA 4WE3A 1QR6A 5DZSA 3RUHA 2JAPA 2DBRA 2VZ9A 2GGSA 3TNLA 3LK7A 2LDXA 4K26A 4UULA 3UFXA 5BR7A 2CVOA 1JLLA 2EGGA 2Z1NA 3IUSA 4CLDA 1HTBA 3ZGYA 1I32A 4GGPA 1NXQA 3VKUA 2VRCD 3OP4A 4JLWA 4FDAA 1B7GO 1FMCA 2GUGA 5T67A 2PH3A 1I24A 1BSVA 2GO1A 3ASVA 1KIFA 3GPDG 2FZWA 4OHUA 4CM9A 3DO5A 3KM0A 5T64A 1ID1A 2VUUA 1DPGA 5EESA 2ZYGA 1XIVA 3H65A 5TQVA 3W6ZA 3KLPX 3QVOA 2FSVA 1F0YA 4QEDA 4B7XA 3ZU4A 4NJMB 3GVHA 4Y6SA 3E6AA 1HDOA 5DBFA 8ADHA 3RD5A 3NJ8A 1B0AA 1Z45A 1LSSA 1KEUA 2C2YA 1KVQA 1M76A 2DUWA 2Y67A 4FFRA 1FJHA 5ITWA 1BMDA 2Z1MA 2YV2A 3FBGA 3EVNA 5ES3A 5MDHA 3GN1A 5JNLA 4O5OA 3WS7A 1M66A 3PZRA 5JC1A 4IXTA 3RQSA 4D7AA 1ONNA 3WTCA 4ZN6A 3KSDO 3H4VA 3NGLA 1HSZA 1N1GA 3KVOA 4U0JA 4RO0A 4WNIA 5CEEA 5EPOA 3AM4A 4RDHA 5U4QA 1UP7A 3CMMA 4CMBA 3E5MA 4A27A 4JNKA 4L8VA 3ZI0A 4ID9A 3F47A 3C1TA 3JSAA 1C14A 5A04A 4MINA 1NP3A 4I1IA 4EUEA 2NVBA 1P0CA 5JCJD 1IZ0A 1LJ8A 5CPBA 4I9NA 4IQ0A 1J4AA 5IXYA 4YEDA 3PWKA 3BMOA 1M6HA 4MO2A 1GV1A 3OJOA 4FCCA 3TL2A 2O3UA 3ZDFA 3QY9A 2PKQO 5I8WA 3DMYA 1VRWA 1YL6A 3BXXA 3F46A 3HDHA 1NNUA 2FSSA 4DLLA 1G0OA 1T2EA 5JE8A 5U9CA 3UGKA 2IZ1A 3SXPA 1LXCA 1BG6A 3PHHA 2JHFA 2V6BA 1P1IA 1P33A 5T8KC 1E3WB 3M1LA 5I7FA 2OGUA 4CV2A 1ISIA 1ZKMA 3PHIA 1EUCA 4WOKA 4WLUA 1UR5A 5IDWA 3PJFA 3QSGA 2CUKA 2RAFA 3AOGA 2JCVA 3ZV3A 4NG5A 3JQFA 1A5ZA 2W2KA 1E0DA 4E6PA 4BUCA 1A7KA 5I7VA 5A5EA 5IN4A 1U3TA 2NWQA 4N5MA 3OEYA 4R16A 1XQ6A 4EUFA 5L4SA 3AUSA 5EL0A 3UN1A 1AUPA 4UVDA 4WCFA 1ZXBA 4JBGA 4IQGA 3I6QA 3ZW9A 4BKUA 1R4MB 5IN5A 2RHRA 4O0LA 1DIBA 3E03A 1DRWA 1P1HA 1T26A 1ULUA 1JTVA 1ML3A 1P1JA 2BH9A 5HS4A 1E1NA 4JBHA 4E5KA 4ALIA 3HFGA 1YXMA 3ENNA 2QHXA 4XZ3A 1DC3A 4HV4A 1YB5A 4YAEA 4TVBA 3JD2A 4XQGA 3L9XA 3MWEB 1ADBA 2A94A 2HMVA 4D0RA 4E2WA 3DQPA 1YS4A 3GGOA 4W7HA 1O94A 5G4LA 2EJWA 4CM5A 4KWHA 1PS8A 3D1LA 1DXYA 3PIDA 1UH5A 2H6EA 5IZCC 4B7UA 4A26A 3ANNA 1K5HA 2DTEA 5L9AA 3DMTC 1E7SA 1HDGO 3ANMA 4B8ZA 3P2YA 4BKOA 4DYDA 4BQPA 1I3MA 1WWKA 1HDXA 3BZUA 3DZIA 3G49A 4OXKA 3GDFA 1KC3A 4LGVA 3TFQA 4FB5A 2C54A 3OSUA 2GCGA 3CUKA 3QWIA 4FGSA 4PZDA 3FD8A 4ZQEA 1YL5A 5I9LA 4S1VA 5C7OO 2JAHA 2WWRA 2WYWA 3F5SA 2IZZA 5DCWA 3GVIA 2GZ1A 4CLXA 2DVMA 2HMWA 3HSKA 3E9NA 2IXBA 3L9WA 1A7AA 3QIVA 2P5YA 5EQDA 1YWGO 1C1DB 4E5YA 3D3WA 4U8GA 5KWEA 1DO8A 4MVJI 1U4SA 1PL8A 4FR5A 3QWAA 4WCFB 4XQEA 2YHUA 1Z73A 1SCUA 3UOGA 1EVJA 1TEHA 2AHRA 4I5EA 5THQA 3TDKA 1N2SA 2RBEA 1WMAA 2ZTUA 4PRKA 1VJTA 3AUTA 3E9MA 1ZK4A 2YHIA 4L75A 4YRAA 1K6XA 4PLZA 3HNPA 4TRRA 3ZU3A 3RUCA 4BNYA 2CVQA 3E8XA 5JDCA 5HRUA 4IDEA 4LVUA 3OIFA 3EHEA 3GUYA 4TVOA 5TF4A 1O5IA 1ZK3A 4AFNA 1W8DA 2GF2A 3BTVA 1CWUA 1Y9AA 3WLEA 1MC4A 5GZ6A 3X2EA 1MFPA 1SC6A 4ROSA 1PJ3A 5HWSA 1R0SA 2V65A 3MJTA 4CUJA 2AEFA 2Q1WA 4RVHA 1HXHA 4JGBA 4WGGA 1E7YA 1C1XA 5H82A 4OKIA 2NM0A 3GDGA 2FR8A 1P1RA 3ICPA 3JTMA 2VHYA 2Y05A 2Y1GA 3DHNA 2XAAA 3K2EA 1PGPA 1HWYA 1Q7BA 2AG5A 4A03A 1HDZA 2B36A 4FJ1A 3EMKA 4IXWA 1HZZA 3WTBA 2B37A 3L0DA 5L4NA 3INRA 3KXDA 2D5AA 4DTIA 1C0IA 2E49A 5FEUA 2PKRA 2EP7A 3TZCA 3CINA 3PDUA 4B79A 4QSMA 2ZQZA 1LNQA 4QQRA 3T7CA 4QFDA 3RFVA 4I5FA 3UF0A 4E2YA 3SEFA 4GX2A 4KP7A 3EY4A 1EFKA 2R00C 2X0JA 3RCBA 3TPCA 3RAJA 3AY6A 5T8KA 1YQXA 4PRLA 1KOLA 1WW8A 1YQDA 5U1PA 4Q3AA 1QSGA 2PZKA 3NDJA 3GGPA 3IKTA 2O50A 4AJEA 1ISHA 1KVRA 1BVUA 1PZFA 1IYZA 3IDSA 4GI2A 1FK8A 3ITDA 4GX1A 4RJTA 3AK4A 5LCXA 4ZQGA 5TLSA 4J43A 5H83A 4IDDA 1SB8A 3ZWBA 4EYEA 1Q0HA 3EYWA 4IUYA 1VE9A 3PHJA 3U4IA 3I52A 2C0CA 5TS3A 2HJSA 5JY1A 5JYEA 1WNTA 1QG6A 4JQCA 4DBZA 3B6ZA 4ZVVA 1LRKA 1GEGA 4XGNA 1GEEA 3I9KA 3QVWA 3PHLA 5CDUA 4HFNA 4UEKA 3PTZA 1N5DA 2QQ5A 1FDUA 4BV9A 3GMDA 3GHYA 2I76A 4K28A 3RWBA 3QP9A 1T1SA 1BTOA 1DSSG 1X7HA 3FNGA 3HDYA 2GASA 3L6EA 5ILOA 1AXGA 2W2KB 3G79A 4W82A 1SMKA 4FFPA 3PGXA 4WECA 4CLEA 5G0UA 5CDGA 2IE0A 1BW9B 1J49A 2B4TO 3BMOB 3ONFA 1VI2A 3V1TC 3RC1A 5DBGA 5JS6A 4GWGA 1HLDA 3FF4A 4CMGA 3NDRA 1GAEO 3IIEA 4P22A 3M6IA 3OBBA 3OEWA 1PTJA 1E7RA 1UAGA 2JKVA 4MDHA 4R9RA 4A2CA 1EZ4A 1P0FA 4I5GA 4MVJM 4N18A 1U5CA 3JQ7B 4EUHA 1HETA 2X1HA 4XJSA 3CZRA 1YO6A 3EW7A 2H63A 3ZWYA 4AJOA 1JU9A 5KJFA 5A3JA 3RKUA 3KYCA 4Y67A 1JVBA 1F12A 1JQBA 1CQIA 1DC6A 1ZJZA 4BMNA 1E6EA 1V3TA 1DIRA 5AXDA 4GMGA 4PLCA 3DBVO 5JY6A 2P9GA 4GGOA 4CQMB 2BFMA 3RC9A 1I36A 1MG0A 1YKFA 1E3LA 5IF3A 1SNYA 2GN8A 4D3FA 2NACA 2AQHA 1PX0A 2BLLA 3BYZA 3KB6A 1U7TA 1VJ1A 2VYVD 1VLLA 3U3XA 5JCXA 1A4UA 4R1TA 4A0SA 4FFNA 2DC1A 2OZPA 4W6ZA 4OL9A 3RSHA 4L4SA 5KVVA 2YJZA 1N9GB 3D3EA 1NHGA 2VN8A 2O3QA 2ZB7A 1JAYA 4XB1A 1U2DA 1HE2A 1E7WA 1SAYA 1YBMA 4D3SA 2X9NA 3NEPX 4DWVA 1TXGA 4EDFA 2Y1OA 2OBNA 4J90A 3V1UA 4BKQA 2R6JA 2DQ4A 2WYUA 3H8VA 4P8RA 3DBLB 4B3JA 1KY5A 1WDMA 5HBRA 4KWIA 1HDYA 1YBVA 1IL0A 1ZJYA 4QT0A 3HDJA 4GKBA 1WZEA 4KUHA 4MIOA 3CIFA 4R9SA 4X54A 4Z9YA 5GZ3A 1SBYA 4B7CA 1YQGA 1VSVA 3TZHA 3H9UA 2ZIZA 4NQZA 4J4HA 4MVJD 4XCVA 5JDCC 1EMDA 4PLGA 3VH2A 1PIWA 1QXSA 3PLRA 3GY0A 1P1FA 1X15A 2JJYA 2P9CA 1E6UA 3AWDA 2CMDA 4DLAA 3PRJA 1EVIA 3HQ4O 3PLNA 4WPGA 1ZK0A 3V2GA 4BGEA 3LVFO 3S55A 2X6TA 2NVWA 3KZVA 1DJNA 3LZ6A 4R01A 3H9GA 4U0KA 5CG1A 5JAMA 4OIMA 2X0IA 4JP3A 3AW9A 3H2ZA 1CRWG 2EKQA 3ENKA 3K92A 1EEHA 1LLQA 2O4UX 3DBRB 1O6ZA 1ORRA 5BNIA 3KOUA 4XGIA 4FBGA 4PCVA 4CLRA 1LX6A 1ZIDA 1H5QA 4CJXA 5FFFA 4FC6A 1JA9A 1B3BA 2HK9A 4YJGA 4WLFA 3X2FA 5CEFA 3CZMA 9LDTA 3MTJA 4B4VA 2C2XA 1U4OA 3LC1O 2E4AA 1NWHA 4JROA 2QRLA 1I3KA 3GG2A 3K30A 1K3TA 4MVJA 4F6LA 2R2GA 5COBA 3WGZA 4BMSA 3GG9A 3S8MA 2ZK7A 1GPJA 2Y66A 4JN6B 3NDIA 3UH1A 4Y8VA 1B26A 1E1LA 3EVTA 3F4LA 5KVQA 3H6KA 3RJ9A 3KLMX 4WLEA 4XDZA 5G4KA 4D79A 2Q1SA 5TJ9A 1PJSA 2ZB3A 1EVYA 5C7LO 4PLTA 4WK6A 4AG3A 3W8EA 5L7YA 1DAPA 5A1TA 1A9ZA 3WFJA 1R16A 5G4KB 1B15A 4BKPA 2FR0A 3UUWA 3KYBA 2Y68A 2A92A 3GRKA 3HWRA 1A27A 1BHSA 1D3AA 1KVUA 1NM5A 3K9QO 3FNHA 3OQ6A 3Q6IA 2NV6A 2PWZA 4E13A 1UUFA 3Q2IA 4NK5A 2J5KA 1WDLA 3WIDA 3U9LA 4FJ0A 1WAMA 2VUTA 3ZU5A 2WYVA 4KQXA 2EHDA 3CH6A 2G82A 2AG8A 4JJFA 1OC4A 1L7EA 3UKOA 3DB2A 1E92A 3PJDA 3PXXA 2ZQYA 4AJJA 4HFMA 1GQ2A 3S2IA 4YJGB 3PI7A 1AN9A 1PGQA 4MP8A 2YV3A 1K6IA 5LDHA 1T2FA 3NTQA 3ZHBA 1GUFA 2VYND 1OBFO 4NR0A 3L4SO 3NT5A 4M1QA 3U4HA 3VPFA 3UAGA 4GLLA 1LSOA 1RJWA 4O1MA 2DBVO 3DZFA 3O03A 4Q3CA 3WOHA 4DXHA 3SX2A 3E9QA 2D59A 4XKJA 4J3FA 1NAHA 2DT5A 4YQYA 4YB8A 2FR1A 2YZ7A 5LDGA 3WYCA 5KJ1A 4CM7A 3V1YA 4LN1A 1UXHA 2AE1A 3H9JA 1MG5A 3OECA 4OKNA 2RIRA 3P19A 4A5OA 3HN7A 2YY7A 3GRPA 1PU2A 1LU9A 1LDBA 5MGBA 2ZYAA 3MJSA 3Q11A 4XIYA 2F1KA 1CEQA 5B4VA 1TT7A 3N74A 2B83A 1T2CA 4J2OA 4OGWA 5KVSA 1P44A 3DONA 3IC5A 1GQYA 2O4CA 3CMCO 2GD1O 5CAEA 1GD1O 2V6GA 3AOEA 3JQFC 4J7UA 5CHEA 3L6DA 3OMLA 1QV6A 2HLPA 1RPNA 1PL7A 1WPQA 2PH5A 5HS6A 5BT9A 4DA9A 3MJVA 2NTVA 1HSOA 5F1OA 3QJ5A 1YB4A 1LEHA 3C1AA 3DOCA 4PGFA 1W4ZA 1G6KA 2QX7A 3IOYA 3JQAD 2VT3A 3AI1A 2E82A 3DBLA 2WE8A 3PQEA 4NBVA 4BO8A 4L9RA 5JMWA 4J4BA 1I8TA 1YVEI 4RORA 3UVEA 4IS2A 4BNNA 4UVGA 2Y0CA 5L7TA 3Q1LA 4J1QA 4LSWA 4AJ1A 5DP1A 4M89A 4EJ0A 2FY8A 4GH5A 1N9GA 1KEVA 3GA0A 5TNXA 3ON5A 4IGEA 3CSDA 1HYEA 3A9WA 3O9ZA 1EUZA 1IPEA 4JP2A 5DOVA 4UUOA 3EUWA 4PIVA 4ZHSA 2EEZA 2CF5A 2GR9A 2NTJA 3BMNA 2B4RO 5TT0A 1YB1A 1LRJA 1DC5A 5KTKA 4XQCA 1KBZA 4Q3BA 1TA4A 3TF5A 4AJKA 4EEZA 2GZ3A 2IDZA 5I9NA 3C8MA 1D4FA 2POQX 4B3IA 2D2IA 1H93A 1OOEA 4R69A 5IDYA 3O26A 1DLJA 3F6YA 4LISA 2I6TA 1JWBB 4NBUA 1QV7A 2BELA 4H16A 1RM5A 3ZWNA 1T4BA 2X9GA 3K8ZA 4DQUA 3DAPA 4CQLA 5ENVA 1U3WA 2YHIB 2ZB8A 3DXFA 3H3FA 2VWGA 4M8SA 1BWSA 2C07A 2X8LA 4UAGA 4LVCA 2FPPA 2NU9A 4OSOA 1IZ9A 4XD2A 4BNVA 4M86A 6ADHA 5JXWA 1DHRA 5ILGA 5KKCA 2VZ0A 3KEQA 3JQAB 4PLFA 3IUPA 4YACA 1X1EA 4PLYA 3JYNA 1R4NA 1EBFA 3KHUA 5G0TA 5EJ2A 2DLDA 2WTBA 1Y9EA 1JVSA 2C5AA 3DZBA 4Q3DA 5HTOA 2C59A 4CV1A 5EIOA 2O3TA 3D4PA 3KUXA 3DWFA 2NU8A 2PTGA 5L51A 5IDXA 1AHHA 4NBRA 1LI4A 3GPIA 4WCDA 4UEJA 1RM4A 2ZB4A 4IY1A 1EE9A 2BI7A 2I66A 2J8ZA 4J16A 2DFVA 3U62A 4E0BA 4KTTE 2O7SA 1NYTA 2W98A 4K1LA 3W4KA 1QP8A 4BNTA 1NPTO 3CEAA 3TQHA 2EKLA 2ZATA 1U3VA 4G81A 3E18A 4BO0A 5JFOA 3DR3A 2CSUA 1GY8A 4UUMA 2O48X 3TZKA 4BIIA 2DM6A 4M55A 4RVSA 9LDBA 1YRLA 2X9VA 1Y5MA 3GGGA 5IZ4A 3VH1A 5DT9A 1QYXA 1KYQA 4MPDA 4I9HA 5COQA 3GAFA 4WUVA 4JCOA 3EZLA 4DIFA 3TFOA 1V3VA 4O6VA 1JKIA 4XJTA 3VC7A 5DULA 5AXBA 4J1NA 4I8XA 4WLOA 2HMSA 4NI5A 1HT0A 3TRIA 1ZCJA 5KJ6A 3U5TA 2D3TA 3R3SA 4XEHA 2VNAA 3ONEA 3D5QA 2GERA 1M2WA 4J4TA 4CM4A 4CLHA 3RUIA 2P2SA 1JN0A 1E3EA 3GMSA 3M1AA 2B5WA 3H5NA 4QFCA 5GMOA 3MEQA 2NU6A 4J49A 1A9YA 4BNGA 5EN4A 3H2SA 1RYDA 1PZEA 1VL6A 1YE3A 1Z82A 3GUCA 1O9BA 1PWXA 1PJBA 1HDCA 4E32A 4ND3A 1ONPA 2OFPA 1QYDA 2A9FA 4KTVE 1DJQA 1PGNA 2JL1A 3DBHA 5CDTA 1WMBA 1UDCA 4IDBA 4YWJA 5IAAA 4FS3A 1E77A 3I9MA 3DZGA 3OA2A 4P4NA 1Z74A 1MLDA 2VOJA 3DDNA 4MP3A 2VHWA 1MA0A 1O8CA 1ADCA 3AY3A 3H5AA 1H6CA 4LMPA 1GPDG 4E3ZA 4YVFA 1SZJG 2P4QA 4NZ9A 2O2YA 3SLKA 1PJLA 3BMQA 3EC7A 4K6CA 3IJRA 4GAEA 5A05A 2BFOA 2QIOA 3KYDB 3G1TA 1FF9A 3JCZA 1L1FA 2NSDA 1I30A 4IZHA 1B14A 2OUIA 5FI3A 3JD0A 4ZQFA 5A9SA 1FDSA 2VWPA 5FYDA 4D46A 1D7OA 4BO6A 4IJWA 5G0VA 4FOOA 5A9TA 2JFFA 4E2XA 2IRWA 2V6MA 1WLYA 3KSUA 4BB6A 4R51A 2B0JA 1OFGA 3MJEA 3AJRA 4HNGA 4CMAA 2J5RA 1Y6JA 2WD8A 4MP6A 4OOFA 3U09A 3JQCA 3KYCB 4CMCA 1F06A 2OORA 1R66A 3BMQB 5L53A 1HE4A 2EP5A 4RLSA 4BO2A 3WMXA 3FSRA 5FI5A 4CR8A 2OP1A 3ZN2A 2FPGA 4IDFA 5IG2A 5JDIA 4WASA 1ZXLA 4GLOA 1VSUA 4BNKA 2BRUA 3RJ5A 1QKIA 2P9EA 3PWZA 4D3DA 2RHCA 1UJMA 4OSPA 4UUNA 1I10A
chains in the Genus database with same CATH superfamily
3L8HA 3H42B 3UQZA 4QX6A 3KJZA 3GF4A 4RZHA 3TTSA 4B8YA 5KC8A 3ENQA 4F3RA 4PHHA 1Q57A 3FDZA 1KFEB 2E5LB 3F3MA 1UMBB 1J06A 1H66A 1WKBA 2D06A 2QXTA 3H99A 2L19A 4X20B 2YWGA 5DP2A 4N5IX 4RXMA 1Y9ZA 5TX7A 1GKIA 4J03A 4P82A 1KFCB 1RJGA 5A71A 5I3ZA 2JJ2A 1RHQA 2CDNA 4HBGA 1KS9A 1LPMA 4XARA 3OFKA 3T0IA 3SJ7A 5DK4A 3N7UA 1JYSA 5BSFA 1SCUB 4DIMA 4P7GA 1H2ZA 4MUEA 3BBPA 4IR7A 2PQ2A 4EFKA 3PT5A 4PG4A 2C3YA 4YMTA 1XZCA 2GN1A 4MSUA 1J8DA 2V5UA 4TLLB 1MJGM 1NQVA 4Y1RA 3WLIA 1R5NA 2JGDB 1XGKA 3V34A 2V1XA 3I0ZA 4KX5A 2ZT7A 4WCFC 1RHUA 1Z4QA 1N5KA 2DPHA 4GMXA 4RK1A 3SNKA 2M6SA 2PL3A 4HRYA 5LP6A 2ZJ7A 3AXSA 4DF3A 3DZJA 3JQGB 2JAOA 2OMEA 3ID6C 4R3UC 1YJCA 3AERA 3AR7A 2P6UA 2WWHA 3GQVA 4FUTA 4PCAA 3A04A 4QUDA 4HJRA 4H1HA 4RIIA 1YJQA 3RJZA 3WJ7A 1X19A 4EVIA 5A5GA 5B1HA 1V1JA 1WDWB 2DUJA 6Q21A 2EJBA 4HF7A 2R00A 5JJ5A 1H1LB 1U2GC 2QEQA 1FW6A 1IXYA 3MUEA 1E4EA 1IY2A 4JI3B 4Z53A 1X7XB 4W63A 4Q1BA 5LN1A 1CS0B 2XV1A 2FSIA 1JLRA 2JAXA 3AJ9A 3AEKA 2XMQA 2NXEA 3AY0A 3CB2A 3CGWA 3LNCA 2EERA 4I81A 3MB8A 3A4MA 3IKMB 1F4LA 4R4JA 3UXMA 1QORA 3KE8A 4D26A 4ON9A 4O4LA 5JW6A 1FQOA 2O3SA 1SXJA 4FYXA 2YR0A 2EFYA 4ZC1A 2OFXA 2AX4A 1QIDA 3AVTA 4A1OA 4L8FA 1S3GA 4REQB 4ZRNA 3KQNA 3QU9A 2C9ZA 4JS0A 1E1CB 4Q4AB 1Z2EA 1YZUA 4MXDA 2REOA 4KPUB 1FQJA 1QIEA 3DDHA 3AV0B 4YTEA 3R7LA 2X7HA 2CJFA 4BFCA 4CM9D 3DXXA 1AX9A 2HA4A 1YIDA 1NG1A 3R0JA 4M1MA 1R4MA 1RPJA 3DCNA 2HCJB 1PZMA 2OWDA 4YJKA 1B6TA 2VT6A 5KX5A 4ER7A 1C3VA 1MNAA 3IP6A 3Q7QA 4FZRA 5D51S 5EJFA 2C98A 3SR3A 4CQJA 5BYKA 2H1LA 1CY7A 4RZXA 5DWQA 1IIBA 1L7VC 3O21A 4IOJA 2D5LA 4R2WA 1Z25A 2QN3A 3G2MA 5KJEA 4DMGA 1YNSA 4ZODA 3AVUA 5L3SA 3S8EA 4YAIA 3K09C 1ECPA 5CDHA 3O8RA 1I4WA 1U8FO 1CE8A 4BVLA 2YUTA 2J30A 3DE0X 3LW7A 3S2GA 4BAUA 1X80A 1Q20A 4HLNA 2VLBA 3E7XA 5C37A 5CDFE 2W42A 4IGFA 2CJWA 5F5NA 4C3VA 1VJCA 3NHZA 2C84A 2C2OA 3J80A 1YGYA 2CKMA 1P6QA 4JBNA 5LP1A 3GUHA 4WN9B 4E07A 5BRAA 2GAOA 3OEHD 4TUYF 4YBZA 3ZTTA 5BNFA 2OAP1 1H0KA 2XTJA 3R20A 3AM3A 2RJOA 2O0HA 1RACA 3GEMA 2EGUA 2VHEA 4GOJA 4JENA 3TQIA 3CF2A 5G41A 5C5EA 5F3RA 3PI6A 3CRVA 5AW2A 2H9IA 3VZBA 4UMDA 1ZEJA 1AHPA 1H6AA 3WGUA 5AVWA 4CF7A 3N8HA 3KUKA 1OZFA 3JVVA 1MW9X 1NZDA 1TCUA 1R5JA 2FUCA 2QRKA 4FNGA 5ALIA 2F3QA 1AE1A 3FN4A 1TTQB 4FXOA 3WO0A 1C4XA 4BHTA 4ZV4A 2BL4A 3L8EA 1D0SA 1DTWA 1Q91A 4PGAA 2ZXFA 5FULA 4GSLA 3IQFA 1T2AA 3LM8A 1E1RD 3KSRA 4I66A 1E6WA 5JJIA 3EZXA 1PJQA 2VHJA 3AF1A 4HWKA 4IJ6A 4PY2A 4EZEA 1KMHA 3HM9A 5E3IA 1V48A 2WQ6A 2WAYA 1XU9A 2ZSFA 2SKDA 2QN2A 1JW9B 5E6RA 4C7OA 1K8YB 1GSAA 1JQEA 2E21A 4JB2A 4JOCA 2XNJA 5D6OA 4OJKA 1O4VA 2QVGA 2WZQA 3BMNB 4JYBA 4YECA 2CCKA 3T41A 1PNRA 1XCMA 4HZUB 1BHJA 1UK7A 4HDKA 1LQ2A 1EP2B 1QE5A 2QL5A 2Z8YA 4HPXB 4IV0A 3QKSB 3VHXB 4D4IA 1VHQA 1WVMA 4ZGGA 2VSFA 2CC2A 1HQDA 3E9RA 5C35A 3ORYA 3RROA 3DLCA 3K0BA 3WGQA 1VG1A 1I94B 4KVAA 4IIYA 2NO0A 3U44A 1R6TA 5FOSA 1AOXA 4NOLA 5KS2A 1ZW1A 4EA9A 2ZXEA 3FPHA 3OM9A 4M76B 4QDTA 4AY2A 4E5PA 1CC1S 1W7AA 1TQ4A 1QHYA 3IEMA 1MEEA 3KT8A 3N8NA 1V7ZA 2QLBA 2X19A 4PBTA 5LQAA 2PLAA 3ZDZB 4JR2A 2VYQA 5JAQA 2PSEA 1IXKA 1ZH0A 4Q3KA 3OY7A 1X0VA 3PHGA 2CY0A 1H05A 2AF4C 1XO1A 5KYYA 5TV2A 4TTQA 4D0LB 2CCJA 5DOZA 1BOFA 2FX3A 1R0WA 2FN3A 3KBBA 3CCFA 1GNLA 2B34A 2W6ID 4V2UA 2G28A 4CGZA 2J33A 4XRRA 3GCWA 1ZD3A 3HCAA 1M0WA 1SRRA 1OKKA 3IR6A 4PYLA 5AVYA 2Z5LA 2EKPA 4C4OA 2NVUA 3WMRA 4W8GA 5ALSA 2NNLD 4WMLA 2AR7A 2WFMA 3F9RA 3V4RA 1I2BA 3PTLA 5JCJA 2MMCA 2WIDA 5KTSA 4D0GA 3X2SA 1BA3A 2OE2A 3DO8A 3URMA 1Z2PX 3I2HA 5I4CA 1ILEA 2FFAA 2AI2A 3GZNA 4M9XA 4MLDA 4NKRA 4O4JA 4QNMA 3VI3B 3ZXYA 1ORIA 2NYAA 2YWBA 1PBNA 3LT0A 1BFDA 1WV0A 4HGRA 3Q2KA 2QGFA 4B6GA 4YAKA 3U56A 4N48A 2BGJA 3EWNA 2CVZA 2JFQA 1ABEA 2UXDB 3BEOA 2JFPA 2AN1A 4HRAA 1IHXA 2HZBA 5I8ZA 1JDJA 2G8LA 2IHJA 4CL8A 5CFMA 4XGKA 5BOVA 5KTTA 1I51A 4I5DA 4BNUA 5A4JA 2K5UA 4OXYA 2PPLA 3QXJA 2WTXA 5EMMA 4RQUA 2OXIA 3W78A 1SULA 2J3KA 1W49A 4HDNB 3SR4A 1YJAA 3F90A 1VMDA 2AN4A 3E9CA 3M6AA 3GJ8A 1L5WA 3HBNA 4IH9A 3RH0A 2P3LA 3ASZA 3EVFA 1ZK2A 2O2DA 1J0XO 3IMFA 1ZGJA 3KQOA 1FW8A 3GT0A 2X40A 3LFUA 5E3JA 1ZPDA 2W90A 1XFDA 4JNCA 1NUSA 4GPAA 3UFBA 5C1IA 4QULA 5F3DA 3T3MB 1CUWA 3TLGA 1KP3A 2JGKA 4YMHA 1CUFA 1A8SA 3SEQA 3O8BA 2P90A 3DYVA 3GNTA 4IAOA 1E2BA 5BN4A 2RGYA 1KDZA 4MB2A 3GAZA 1VXOA 3QFTA 1DNPA 2AGVA 2G4CA 1NFFA 2XMZA 2ZPAA 3RSOA 4DW8A 1PV4A 2G67A 4K6MA 2RHGB 3H1FA 2R8BA 1XLVA 3TLXA 1TJYA 4C43A 3KFLA 3BHIA 2D8MA 2I6SA 3QVGB 2Q2OA 2C4TA 1P7PA 3EGDA 4ZK6A 4R7ZA 3LBIA 4Y6PA 1XNGA 2IEGA 2M9MA 4C7KA 2SECE 1W29A 1XD2B 4QWMA 1I2ZA 3JQEA 4W99A 3T4PA 1EWVA 3QV1A 4KU4A 4ZU3A 5K51A 3R1IA 1V39A 3CVOA 1GU7A 4HX9A 5ALEA 3ZLVA 4YX9A 2HNKA 1BH2A 2WVGA 4F86A 3MTAA 5AKKA 4I4NA 1T4GA 3AJ8A 3VR5H 4CIAA 4RJ2A 4KDRA 1CZUA 5JDIC 2YYYA 1SPBS 3VDRA 4KO4S 4NBKA 3C6XA 5KTRA 4OJMX 3BA6A 3OZEA 4ZC8A 4J3JA 4YDRA 3EGXA 3ZGOA 2P3SA 3ZJYA 1MXHA 1N3YA 4DG5A 5CFZA 2CNLA 4MWBA 5KPDA 1C7JA 5LVAA 3RTCA 3GVPA 3JQ8B 4QXPA 4G97A 2W93A 3TMYA 4DVJA 1NQWA 2W6NA 3HP7A 4HRXA 1WUIS 2BF7A 2F9MA 4IKOA 4PG5A 4ZCIA 4ZJPA 1LBQA 1OWPA 5JBIA 1R3DA 1JDBC 3GD5A 5K3FB 5JVDA 4B3TB 2ODPA 2HRQA 3CG0A 1ENZA 1HFWA 3D9QX 2OBBA 3GA7A 4K1XA 1QRDA 4IDGA 4OO3A 3G5UA 3OD1A 5TQ2A 2J0EA 3WQRA 3OCWA 4JKIA 3BE4A 1CNMA 5IDQA 1T91A 5KNCD 3QW2A 1DIAA 4DBVO 4B87A 2HHLA 2E0IA 3ILYA 1SC1A 4ZV9A 3Q7EA 4ZZ1A 2WSSD 3VNAA 3VPXA 3BQNB 4R2HA 4V0KA 3ZVKA 5IHPA 1LPBB 5LOVB 1NBOA 4LZJA 1JYEA 5JO0A 1KS2A 1ETHA 1FUKA 3FPCA 1RMQA 5K0LA 5EHXA 4WKGA 1ZUHA 4XJVA 2B1RA 3EGXB 2WF9A 3D6HA 4IQ4A 1SFRA 1ZIPA 3NM6B 4WA8A 4BNIA 1OREA 4L6AA 4KV9A 3TJRA 1JKJA 1V8PA 5CD1A 1K6MA 3EIXA 3O2QB 3NH9A 4HXYA 4YGYA 3C4VA 4OM8A 3PUYA 4MVXA 4BTLA 1G8PA 4KR6A 1PR5A 4RQBA 2QX9A 1OV6A 4MRSA 1KEZA 3LIIA 4OA8A 1I0IA 3INYA 4LYEA 3EIWA 3HCCA 3V4LA 1JJBA 1NLMA 3H9QA 3S2EA 4JSYA 1CNEA 4INOA 4TV9F 1GKKA 1WF6A 3Q9UA 1O96A 1W30A 4XA8A 3R76A 3QUQA 1KJ8A 1NFRA 1MAUA 2O07A 3QTTA 2WR8A 3LZCA 4D56A 5HHTA 5I7UA 4JC0A 1Q3KA 1EFHA 2LTAA 2WOJA 4XB6B 2VAMA 4KN5A 3T7EA 2J3EA 3WGMA 2NO6A 5YASA 5IXJA 3O7WA 4OLBA 3EA0A 2QBYA 3JZMA 4HOYA 1U7OA 3BWDD 3FFTA 2F48A 4DJFC 2O57A 1N0UA 4WX2B 1U90A 4PVDA 3HVRA 4PE5B 1R9MA 2YFQA 4MO9A 3QKRB 1C29B 1CQIB 4UU0A 2Y9PB 1QP4A 1E9CA 5E4FA 1MV8A 4BN4A 5CVJA 1FNDA 1H2RS 5KWVA 4P32A 3GLGB 2Q8PA 3HABA 4EGCB 4C5BA 4G2TA 3LC2O 1BW9A 3UIEA 4BFYA 3O84A 4QUHA 5DTRA 4X7PA 4NE2A 3SNHA 3KR0A 4LCJA 1OZAA 4EK9A 2NO4A 3HB5X 4RY9A 5LUBA 4XLLA 1OROA 4YYEA 3DAFA 4G0ZA 1JWAB 1JAXA 1ZOIA 1BXKA 1AF4A 2J5BA 3DFMA 4MVJG 5TVGA 5BN4B 2HH9A 3RRMA 3T1QA 3WRYA 1CPYA 1WG8A 3JVUA 5REQB 4RHEA 4TRMA 3ZVNA 3O95A 3DCYA 1WMFA 3HUDA 1JA1A 2QAGC 3OKPA 5EYPB 4E03A 1EJ2A 1RWPA 1T0HB 2ZE8A 4NCHA 3MK31 3DL0A 1C1YA 4RJIA 5CK5A 1BZYA 1PO7A 2WA2A 2ZTHA 4Z0NA 1ZGHA 2BTQA 1X7ZB 4OHZA 2EP8A 2VNKA 5G0SA 3VOBA 4QELA 3SF0A 1XWIA 1RVV1 4JODA 1V1RA 3IQHX 2Y6UA 5IDVA 1XNQB 1RLIA 4Y1FA 1FVHA 3EAQA 4CLOB 1E3QA 3TL6A 4LF6B 4CKBB 4ZGBA 3WGJA 3MGCA 3NAGA 1SU7A 4K9KA 2WWGA 4B1FA 3ZDDA 3OH8A 4HH4A 5K0ZA 2VJMB 3FYTA 4GKJB 1DFIA 2OXTA 1X80B 2FLKA 4RV9A 4CKWB 1EIZA 1XUOA 4LC9A 4JXJA 4KXWA 4BNLA 1TB4A 1E2HA 1S01A 1VYUA 2QLNA 3H1PA 3EXEA 4LZLA 4IIUA 4WEQA 5A0FA 3S5JA 1DRJA 3NBKA 5A4MS 3L7NA 1RBQA 3ACBA 4TV8F 1CF2O 4QICA 2E5FA 4TT3D 5CDSA 2OXCA 4RIFA 2ZCUA 5FWYB 2O8EA 3P4XA 3MSXA 4GXTA 5B37A 3K0CC 2BM9A 3HJAA 2FOLA 4MWGA 4RKYA 2XI4A 2E4YA 3PX7A 4HGPA 5IVKA 3OIYA 3VISA 3LO5A 5I7EA 2EX1A 5GIOE 1N9KA 4J91A 4G0WA 2IYPA 1Q7EA 3FZGA 4QYIA 3U44B 5B3JA 1JG3A 3R23A 1I7PA 2AA3A 3WLNA 1P2TA 1EI9A 2B8NA 2JGLA 2MSLA 2W6QA 4J6FA 3TL3A 3VA7A 1TX4B 3EYAA 4RL6A 2W2VA 1UXJA 1F3LA 1FLAA 2G17A 2G6TA 2QM7A 3ESDA 3NOOA 3EMDA 4QJIA 2PL5A 5LP6B 3ICOA 4QUJA 4HNQA 10MHA 3WYEA 4DPKA 1EUDA 1MO4A 2VIIA 1Y7IA 4W5WA 4ZVPA 5TGDA 5TPWA 1WTCA 1TL7C 1XZNA 2FWIA 2QTBA 3P2JA 2W83A 1RZ3A 4N3AA 3ROQA 4JB0A 3SICE 5HR5A 3BH7A 4RKFA 5F2OA 4INZA 2X5OA 2AZXA 1VHWA 1ECBA 1J23A 1G1AA 1Q0LA 2VHZA 4YFVA 3BK7A 5HCNA 1DRVA 4N39A 1N7GA 3SJUA 2IHYA 1XL0A 2HSJA 2REQA 1G4HA 2W8BB 3MWDB 4UCWA 4V1CI 2RGBA 1NMYA 2AE2A 5KEIA 2ZAOA 3NBFA 4XPIB 4D44A 2EW8A 1Z7GA 1M2FA 4RZUA 1S2LA 2Q4TA 4G67A 1L7DA 3DE4X 1D09A 3E3LA 1RYMA 2Z8ZA 5FJJA 5I7HA 2QTLA 2QD1A 1MVOA 1PX2A 1IHYA 3BQ9A 1ZNXA 1X14A 1X7GA 3MGGA 4YXWD 2TS1A 4N5NA 3OMWA 2I71A 4CKXA 5BV7A 4G1VA 7REQB 4D99A 1E3JA 1E9VA 4MQLA 3NFRA 5EZSA 4D8VA 2BN4A 3ICWA 3VOTA 5KINB 1LGYA 4R9VA 4B6PA 1BJRE 1JV2B 1JKFA 1RKVA 4HAOA 1FTYA 1NRJB 2ERXA 2WJ6A 3GIDA 4K88A 2HPAA 4R54A 4AK9A 1MBZA 2X8AA 4JH0A 1WCWA 4Y0VA 4FU0A 2BFBB 4W7IA 5FL7D 9ABPA 3COYA 4DJEC 4JMLA 3F67A 4UUAA 4UMVA 1XJWA 4FEGA 1XMVA 3O92A 2NTNA 1ZN7A 3PQFA 4BB5A 1FMFA 4JUDX 2HU5A 1JFFB 4XVCA 3QEAZ 5IYZF 3GNQA 3ZDXB 2GDZA 4DXAA 3HXQA 4N40A 4LE1A 3R8XA 1QGAA 3I05A 1M2NA 3V9PA 1J6UA 1IWBB 1JNXX 2JEZA 2QRNA 3LY8A 4FZ3A 3T3IA 4N41A 5KZMB 4CT4B 2NZ8A 3WLMA 1D2GA 2DWPA 4A73A 1RWMA 3QOFA 3HKDA 4UDXX 1LPOA 2G9NA 1TM2A 2JH9A 1WUKS 4QQFA 1I7QB 2ANCA 5FO0A 1C1DA 1X9HA 2QYHA 4ITVA 1MDFA 4PNPA 2HQRA 4EMSA 4V1CA 3OCUA 2I2CA 1CZLA 1WMEA 3A6EA 4NXNB 2G88A 2RI6A 4CR6A 2PFSA 3O9VA 4NBTA 3WAGA 1DG3A 2WMNB 4EGSA 5BR8B 3KQHA 1PNVA 1JAIA 3CLSD 3UCEA 1N1MA 3WLPA 2FDCA 1UJNA 4B40A 2CUNA 4HX5A 2WKSA 2XLCA 3A36A 1NNI1 4H7JA 4OI4A 3TFWA 2V98A 2P65A 2W4MA 2ZKIA 1KK1A 2V58A 2D5IA 1LDMA 4NYJR 1YRYE 3CNLA 4NU0A 4TZKA 4LOKA 4OG2A 2BKAA 4R1OA 1NVGA 1QX3A 3K1YA 4KQ1A 5J2TF 2C2MA 3LL7A 3VGPA 4FOSA 4YP9A 1PL6A 4NV3A 4CNBA 2W6JD 3B1JA 2B1IA 3COVA 5E9QA 5FBKA 3NYRA 4QO8A 4YJHA 2BFEB 1FTGA 3S2FA 4CMEC 3R7FA 3LC7O 3O74A 3FHOA 3R9XB 4J1SA 2P2GA 4YYZA 3KLNA 5ELXA 3IAUA 3QXXA 3WMFA 2WT4A 3SYRA 4U4AA 3QQPA 3ZCXA 3ZPXA 4IMIB 2VSOA 1VJRA 4BGUA 4AJ2A 3CVUA 1KIAA 1RQGA 2I5PO 4LC0A 4N01A 4US1R 1IONA 1T34A 1E98A 1Z39A 1ZUIA 1A76A 4LYGA 4BVFA 1Z56C 2B99A 4OMCA 1F2VA 4X85A 1L5NA 5KOJA 4FOLA 5FB3A 1P5RA 1UC4B 3UHPA 1TA9A 2R4TA 2Q3CA 3M89A 4P3OA 3RI3A 2J0QA 2BDTA 3HEMA 2HRCA 1PQYA 2ANBA 1GKUB 2XUPA 3RLFA 2E6UX 3PFWO 4EI9A 1EUDB 2CMKA 1OI3A 4AUNA 4A3SA 1WZNA 1FZTA 5DGCA 3OFNA 3PU6A 2QOEA 3C39A 3OE7D 4U1RA 5TDHA 2E37A 2WIJA 5LMCA 4MV8A 3RIXA 3RSGA 1S7CA 1TD9A 1J9EA 1YC2A 3AYXB 2H65A 1C0LA 2XUHA 1KZ9A 4JGGA 1YS6A 1BQ4A 2ZTLA 5EE1A 1LUAA 4B2PA 4ZYZA 2QMHA 4EF6A 3WB2A 3W6UA 1ZHHA 3QBDA 3DT9A 5FT9A 2YXNA 2Y8EA 5ADVA 3RS0A 3HO1A 2JDIA 2GOYA 5BRNA 3VYWA 4BQOA 1B1CA 2JB9A 4Z9BA 2A9JA 2B5OA 3U9SA 1X0XA 1NTOA 1TKRA 4QYSA 3VDMA 1XMOB 5A5FA 1Z83A 1BXZA 2PG3A 3AUKA 5AJWA 2I3AA 3UHJA 3PLAE 4L72A 2HBQA 4TXMA 3BOSA 3R0XA 1DLIA 1QAOA 1P6UA 1U28A 2EJTA 3THYB 4OH1A 2XUOA 1QTQA 4EO7A 3ASYA 1P7CA 1UFVA 1KYIA 1ZSNA 4IJVA 1T9GR 2C4KA 1SHZA 2KB0A 3L7LA 3T3EA 1BCSA 3C14C 3ITNA 4YPFA 4PSVA 4Z3KA 4LF7B 1OLSA 2FPGB 5KIAA 2XRZA 4AI6A 1DO0A 2A4KA 4D97A 3PC4A 4ZZ2A 3K35A 2C8VA 3VPCA 3CZAA 3WA7A 1ISMA 4X8MA 1J1UA 4HQOA 5HM8A 4L5BA 5IPFA 4I9UA 2NOAA 3TGWA 5JPIA 4KPFC 2FTKE 2DBYA 2GJ4A 2VJDA 2NZYA 2OCBA 3QXGA 4L4ZA 3TTXA 1H8ED 4AZSA 2NZUG 4D43A 2Q4RA 1X8KA 4AICA 3TSCA 1UBNA 2AWOA 2WFAA 3D0OA 1EE2A 3ROEA 1MHPA 3KAJA 2GXUA 4MRMA 5CPFA 1OILA 5EYPA 3ZV4A 3K5IA 1X7YA 1G21E 1JR4A 2W22A 4RD1A 4UU1A 5DI3B 4ALKA 1CDOA 2V9PA 4EY6A 1PT6A 5ES4B 3IH5A 3TWOA 3RRZA 3E9EA 3B6MA 1AS2A 1W88A 3L6RA 1SVUA 3H3JA 5BUQA 2FI1A 1JFFA 5FBZA 5FOVA 3IQXA 2WMOB 1OHHD 5HKLA 2IV7A 3W8RA 4QDKA 3PYXA 4IZIA 5B6JA 3F9IA 1U7HA 3O9MA 1NLFA 4RF2A 4RSGA 4PSCA 4YDHB 5AK6A 1B2LA 4C88A 2JJ8A 3KQTA 1S8AA 4AAYA 1N6NA 4XIIA 4DREA 3L7KA 4E14A 3WLSA 4EG8A 4HUQB 3K2BA 1UMCB 3GCGA 3A9UA 1GTRA 3EZ9A 3D6JA 2EJVA 4K6OA 2F67A 1W2WB 4ES6A 3T5AA 4NFHA 4AMUA 4B85A 3LWBA 4PG7A 7MHTA 3S40A 2PGLA 4KUEA 4XVUA 2H92A 3TW6A 2H2GA 1GUYA 2FV8A 1G1MA 4P7JA 3P32A 2ZI7A 3WRYC 2P0YA 1KRHA 4V02A 5AVOA 3O4VA 3TZLA 2OYRA 1HNWB 2H5LA 3AFIA 3LF1A 3K16A 2QYTA 3BIFA 3L1UA 3W77A 4GQAA 1AKYA 4HAUA 5C8VA 1OF1A 2D1RA 3A25A 3GMIA 2CZCA 4FNOA 3N7AA 1DBVO 2YNMD 1HE3A 1K2WA 3DMTA 1B43A 1SCQA 1KHTA 1L7RA 5CVCA 3IIJA 2VZ8A 3WQHA 1UMDA 5EIWA 2Q9BA 4H08A 2JZCA 4DIOA 4YRSA 2O1SA 2AMLA 2BH2A 1CUXA 2A6PA 4X41A 3T9CA 2NO1A 3QZUA 3TBKA 1LH0A 3EUEA 2IS2A 3LH5A 4X1KB 3PPIA 4H6VA 4LXTA 3N3AC 3QX8A 2REQB 1AGXA 1CP3A 3OTIA 2NU6B 3GLFB 1YGPA 3R24A 4UFPA 1NSFA 3PFCA 3DXZA 2GZ2A 1RQPA 3QEMB 2VWQA 3R0IA 1JIVA 3PKIA 1GSOA 4EGAA 5LNK1 1VZ3A 2JFGA 1CUZA 1A7JA 4Q9LA 1JG4A 1RYBA 2FZKA 2YRWA 2Z30A 1NI4B 2GN4A 4GQIA 4LE2A 4N9WA 3G8CA 3S29A 1UBUS 1XAGA 1Z7WA 5ALLA 3TQQA 5IKXA 4EY4A 2OENG 4TZ6A 2FQXA 1QM5A 2DR0A 2V5VA 4PZ9A 1OTYA 3NHKA 4UUPA 1ABBA 1X42A 2YOFA 3C85A 5SY6A 1M6VB 4CN8A 2CXPA 1A9OA 2OXFA 3T7DA 3B20A 4PQGA 4HGNA 4DR6B 1H0RA 3TXYA 1E9BA 3T94A 3U4CA 4E21A 1QK5A 1FFAA 4NH0A 1P9WA 4MVJE 1KEEB 3MWEA 4XYMA 2C8KA 3PPYA 4IO1A 4MV0A 4JOBA 1T2NA 3TLYA 2Z95A 1NF2A 3C16C 1K1EA 1L3CA 3M6XA 4Y2XA 3SQWA 2XZOA 2C4MA 3GOHA 3RWOA 2BW0A 5JVDF 1JJIA 1J2RA 1IPHA 1M1ZA 1XRSB 3IHLA 4BNHA 4XW2A 3X1KA 4KGXA 2DCMA 4JC4A 3T7JA 3VFDA 3F7MA 2CFSA 3CLVA 3JV7A 4NFYA 1PEKE 2ZRDA 2IYEA 1HX7A 5JD4A 1GKYA 4PAWA 4R5HA 2G8NA 2ZWIA 2Q2VA 3FFXA 4WJLA 3F1KA 3OZRA 4BLOA 3S1AB 1KORA 3NW9A 4TROA 3AL0C 3F2VA 4DLUA 2YV5A 4GZMA 4R84A 4LZZA 1ZBDA 3BTUA 4KDEA 1EGMB 4D9EA 4NOMA 1O2DA 3WISA 4F4IA 2HWWA 2PXCA 4X91A 5TRTA 1XTQA 1RM0A 4MI6A 4EG7A 3QVGA 1UZMA 5HZHA 2I8AA 2PBZA 4G5OA 4MKFA 1K8RA 4PG6A 4CQMD 1RAIA 2GSDA 4N8SA 3FKSD 1U04A 621PA 2O6HA 4WW0A 5HX7A 1TU3A 3LPNA 2GVDC 3K3PA 3QUCA 1SUFA 4NJOA 3L8DA 4M38A 4OXXA 1U1IA 2ADMA 1F8FA 1FUUA 2X6QA 3M1IA 5JSUA 4RLFA 1YDEA 5LQCA 4JBIA 4MW6A 5BURA 5ALOA 3WK9A 4WBSA 1XCGB 1GTMA 2V3WA 5ANRB 1IN1A 4TYQA 1KYZA 1JX6A 2ZE6A 3WXBA 1Q7CA 2QL6A 2Q5LA 1EP1B 1YONA 4Y9SA 4KEAA 3ZX4A 3N2EA 3O8QA 3Q3CA 1T3ZA 5AHKA 2WSYB 1TFUA 1V4BA 1YH3A 2GFQA 2LKDA 3JD3A 2CLOB 4JJIA 2Q1YA 4NPCA 1P7ZA 5DHUA 1JZQA 2GPYA 3IUQA 3ZY5A 4Q9NA 3LT4A 1DBSA 4TLMB 2I8LA 4WXHA 4BQRA 3KP1A 2C82A 1GUZA 5K9ZA 1U5BA 3BF8A 1E96A 1P74A 4IRUB 4CMIB 2CUZA 1CULC 2J5QA 5CFRA 2HWXA 1UKYA 2BTQB 4JT4A 4BMPB 1J07A 1L1RA 4XOIA 4DEXA 1YCDA 5CX1A 3TD6A 3ZU6A 4ZI7B 3N8IA 4CV0A 1Y8AA 4HPJB 1J20A 3ETJA 4KQMA 1XZFA 4DR5B 4GOXA 4L6IA 4II2A 3ET5A 4Y0AA 5AUPB 3ZCVA 4DMLA 3Q0IA 4G65A 4QBGB 4BXOB 3CCBA 3TAHA 2BC9A 3M4NA 1X70A 1ZSYA 3TUJC 4A0HA 1L0BA 4DR2B 3MYYA 3UCXA 3C1UA 2NVUB 4HAZA 4D0SA 1S0UA 3SZOA 1YB7A 1I7NA 1P81A 4X97A 5AUOB 4CF5A 1CUYA 2OO3A 2YDYA 4UTOA 4QFBA 3KUUA 2FXIA 4FXPA 4YMSA 3ZX5A 2ZKLA 3PNLA 4QOFA 3KR2A 4OQEA 2VF8A 4NBLA 4HVLA 3OAAD 3HPQA 4J7XA 4Q4DA 3NZEA 2QMUA 1T5TA 4TX1A 4UHBA 4NNOA 3BXGA 1C4KA 5LXTF 3RKRA 2QW1A 3CUTA 3GO4A 4F91B 1XMQB 2EIXA 4GYKA 2PU5A 1R15A 1UOPA 5G02A 4RPIA 1IY0A 4XUGB 1QVAA 4P2BA 4Y9DA 2VT2A 3RVKA 1KA9H 1Q6YA 3V8PA 5CG1A 1N36B 3HACA 3L0OA 4OLAA 5BUZA 4JIMA 5JPDA 4ZOAA 3GRVA 1CIJA 1QHSA 1MRSA 2DUNA 2AUTA 3GYGA 1JP7A 1FYXA 2KMLA 3D6VA 1W76A 3KU4A 3LQQA 4I08A 3VSCA 4AMZA 1K86A 4KWTA 2C5EA 4S12A 1AB5A 3BXZA 3PFBA 2FN7A 4XAQA 2ILTA 1DEAA 2PO7A 2G0AA 2VK1A 2NTEA 2YN2A 3C7DB 2YICA 4LHVA 4WNCA 3G5AA 2XMSA 3DEZA 2WIAA 2O7RA 4RKQA 3EDCA 5T4EA 3PGLA 2XUKA 3CZCA 3CZ4A 3M6UA 1JWLA 2K4MA 3FR8A 3FZQA 3GQBA 3O0DA 4LRQA 1G63A 2ZJ2A 1ESNA 3A1DA 3CXRA 1WZIA 3B3GA 3FIUA 3PENA 1NJ2A 4H3VA 1I33A 4LK3A 1MDBA 5J47A 3G8DA 4GI5A 3Q9LA 5JV5A 3R0ZA 1Y1QA 4ARZB 2FSGA 3DF9A 3JQ8A 1TMOA 4Q1FA 4QYMA 3TNYA 4DUGD 2MT9A 3OA0A 3QVMA 3UT5A 3C3PA 4P4LA 3SVTA 1QZ3A 4F46A 3G7UA 3D4LA 3KTDA 2DQYA 1YI8A 1R6BX 3B13B 3G02A 3L06A 5EERA 2ERYA 1IN6A 1RCUA 4MUFA 3NPMA 3K70C 3SKXA 1E5LA 5DDIP 4F12A 3H9EO 1X3LA 3G59A 3BAZA 5DGXA 4H7HA 2APJA 1JLSA 3O4HA 4M37A 3FI9A 3JYPA 2I3ZA 3WLKX 3JYQA 4BO9A 2J0UA 2PVPA 4PYIA 2ODQA 2IBMA 4G5HA 1VL2A 4G26A 4KVFA 4PICA 3VXKA 5KJCA 5M04A 4GE0A 2WF6A 1OWMA 3OLVA 4H7IA 3SM9A 3AI3A 3VGJA 1GPWB 5C5IA 3LHSA 1TIKA 3M4YA 2TMYA 1NXWA 5JZVA 4H1WA 4BO7A 3NG1A 2YMQA 2E4ZA 3OKAA 4CIBA 2PWBA 5IFLA 1QQAA 1WR8A 3R6DA 4GYWA 3SJAA 2JLAA 5IVDA 4MARA 5DWDA 2H4WA 4TTIA 4QUAA 4IFBA 4JDUA 1VRCA 2XXJA 2BKVA 2FPXA 1XZIA 1ZVJA 2VP5A 5H4HA 1T6YA 1YOVB 2H31A 4LUCA 4MQEB 5H7XA 2QX8A 2CB9A 3D0RA 2Z6QA 1ZZEA 3UMCA 3I8SA 1XHLA 2D8AA 5EP1A 1VJ0A 2UAGA 3AKYA 3W5DA 1QP0A 1N8KA 1R9GA 2EXXA 4TMXA 1PL0A 2V3VA 1HEUA 2ZWMA 3PEUA 4MW1A 4O1HA 1QRRA 4P4GA 4BP9A 4RENA 3CR3C 3P5SA 4TL9A 2FCAA 4IDAA 4Q9AA 4B3XA 3BM5A 2GJ9A 2ZGVA 2CYAA 2EDAA 2FGKA 4KODA 3W2HA 1LF5A 3W4JA 4DQKA 3GJ7A 2PUFA 3ZE0B 4BB9A 4CDMA 1V6SA 3CU5A 5F77A 1MO5A 4FYKA 3FUTA 3OOWA 5DNYB 4CTMA 2CLFB 4OIFA 4ZHQA 2C1XA 5CM9C 1E5QA 3T5GA 1EVQA 2EBWA 3B82A 3LGSA 1JMKC 3UB2A 4AULA 4YMGA 2H1FA 4NNJA 4UNQA 4KXQA 3BJRA 1DB3A 1E1CA 2OFWA 3EGWA 2YJ3A 1PFWA 3NHLA 1YE8A 3KD3A 3PEFA 2EWMA 4COKA 4D6XA 4DXDA 2OBYA 4DNQA 1KSHA 2R62A 2WD7A 3IPLA 4PHFA 1GXSA 2YIMA 1QVRA 1ND6A 4DAEA 1U11A 1BKDR 3DQZA 3KJIA 1GT6A 1DMRA 3CX3A 4MQ5A 3DZDA 3L79A 1KR2A 4DDUA 2XDQA 4A10A 3UPTA 2A0WA 4IBOA 4ND2A 3PUXA 5DNAA 1CEEA 2OYSA 5IRCD 1SHKA 2XNSA 4OHWA 3BL6A 2WT9A 3EVZA 1J7JA 1PQUA 2ZCVA 4OUKX 1L7QA 2QM8A 3HXMA 4JAVC 1D6SA 3VAZA 2AMYA 4O63O 1O95D 3UV6A 3MTBA 4BO1A 1K0FA 3DMPA 3RTEA 1PT9A 2KWIA 3PXDA 3PD7A 4CL3A 3O93A 4YJ3B 3UV7A 1UDAA 5JASA 3VKWA 2ORWA 2G5PA 1XDDA 4RVFA 4YJFA 2VLIA 3CR8A 3HV0A 3IA7A 4GIBA 1NN5A 2WIGA 3H5WA 1YR8A 2PBLA 1HLGA 3LGAA 3C5EA 3GPLA 3ZLTA 3OX2A 3B6KA 1RXWA 2DU8A 1V6AA 2E9SA 1EDOA 4MUHA 3PUZA 1J5EB 4MVYA 1F9AA 2N47A 1F14A 1XQXA 3KJNA 2XE8A 1JEDA 4NCJA 4RK7A 1ZCZA 3BHMA 3ROZA 4EJ6A 6CHYA 5EXPA 1QR6A 2AOTA 1OSNA 5C1DA 1YS7A 3SQLA 1NBMA 2DBRA 1YCFA 3TNLA 1P75A 3TQOA 3RC8A 3C4QA 2LDXA 4K26A 4UULA 1CHDA 3IQGX 4M36A 5BR7A 3DE5X 2AKAB 1UZAA 1DX4A 1MCZA 3LHIA 5FNVF 4AKEA 1HTBA 2PT5A 4MQFA 2AK2A 1E4OA 3THXB 4NULA 4F5EA 2QTHA 2IHUA 2HQBA 2PH3A 5CDFA 4GM0A 1JL3A 2GO1A 1CXZA 1KIFA 2F1OA 3GPDG 1DEOA 3KM0A 3M9XA 3DEIA 3DKKA 4Z4CA 1NMXA 4LZAA 1Y82A 4KQ9A 3GVHA 1X87A 3ROTA 1ZUWA 3RD5A 1RJFA 1Z45A 4RWZA 3JWHA 2C2YA 4YAWA 1E4VA 1ONBA 3B1XA 1HYQA 1KSFX 3MBKA 5LIRA 4BVGA 4CKEB 2YV2A 2VSYA 3FBGA 3WZMA 3RYCA 5IAJA 1FMJA 1R7RA 4OEHA 3ZXXA 2BM0A 4AFNA 3WRWA 3RQSA 1GU1A 1ONNA 3QXCA 1E32A 3ZZMA 2OWEA 4B9EA 4CIVA 3HR4A 2PRZA 3D4IA 4YCBA 5BW4A 2XZLA 2PT7A 2R8EA 3TQRA 3E58A 5JZSA 3HKBA 1X94A 2XB4A 1Q0TA 1Z68A 3WHKA 4CMBA 5EZQA 2V7WA 1RRMA 1T4CA 2RAUA 2YJGA 2H4JA 5DBHX 3DVQX 1JPJA 1SHTX 4YHHB 4A23A 1Y98A 3F47A 3C1TA 3NUQA 2RE8A 3CV3A 2ZUWA 4MINA 2DZDA 3PR3A 4MMYB 5JCJD 1UPUA 5CPBA 2XMPA 4LDZA 4LKOA 4Z4FA 1CCWA 1J4AA 4JI5B 1GRVA 2HLDD 4M9CA 4P7KA 1QHHA 2R9VA 2YS7A 3PWKA 5IXYA 3S81A 3JAMA 1GV1A 3OJOA 4FCCA 1BN6A 1M6NA 1J5XA 3Q10A 1JHRA 3QY9A 5DT2A 2PQ0A 3SPXA 4LF9B 1KK2A 3ZDBA 3CZPA 2GZAA 3DMYA 1YL6A 3F46A 4IICA 1NNUA 3S8YA 2FSSA 3ELBA 3HMQA 4KPUA 4F8JA 1NC3A 1C7QA 2A9OA 3K4PA 4RPCA 5I45A 2KW5A 2HA5A 2FDRA 1R1DA 1RRFA 4HEA1 3NHPA 1LXCA 3SXPA 3TE6A 1CFJA 2ZRKA 4H6PA 1H0SA 2X2PA 3N87A 1QCYA 5T8KC 2Q5FA 5FH9A 2PSSA 3M1LA 2OGUA 1HT3A 3QY0A 4CV2A 1CUIA 1ISIA 2FHPA 2WJVA 1XZAA 3IDZA 1JSZA 3CN9A 4P6VF 2WSSA 1T15A 1TKBA 5DJ5A 4OYHA 2BSXA 4CKCA 4WLUA 1UR5A 5IDWA 2CUKA 2RAFA 2CXTA 2FFHA 1U3FA 1ZMRA 4K2AA 3C3EA 4W5RA 3OT1A 2Q9CA 2XGMA 1E0DA 1ZH6A 1UPAA 3EIHA 5IN4A 2NWQA 2A0UA 2FUG1 3K1AA 3KSMA 5L4SA 5DTQA 1P0IA 2ICAA 4QUBA 1EJ6A 5IJ0A 5BR4A 1YBHA 1X1AA 2A84A 2VJYA 5AI6A 1E3MA 2FMTA 2NG1A 2HXSA 1SU4A 4TN5A 4NLLA 4AZTA 1P5JA 3TLKA 5IX8A 4YP6A 1AUPA 2R6R1 1EJBA 4UVDA 3KEMA 4YAFA 4L08A 3PCRB 1OYWA 1T9AA 2ZU0C 2IU4A 3ZW9A 4BJHB 4GI7A 2JGDA 4NENB 4FHDA 3KELA 2FWRA 1WB4A 1S8NA 1Q0UA 1DRWA 2E4UA 1T26A 1A95A 3KEFA 1P1JA 2ZRCA 3TSYA 2BH9A 4BMOB 4RAQA 1JT9A 1F2TB 2JJ1D 2R8OA 1XXLA 4CTNA 1AG9A 2GTIA 4XZ3A 1CZRA 4ABYA 4UCFA 4Z8YA 4HDOB 3E22B 2IH5A 4YAEA 3I61A 4JJ8A 1JS1X 2W7TA 2A94A 2A1IA 2QQ0A 3PCXA 4LBWA