1LF5A

Crystal structure of rasa59g in the gdp-bound form
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein P21/H-RAS-1
publication title The Structural Basis for the Transition from Ras-GTP to Ras-GDP
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 63
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2002-04-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1lf5A00
4JLVA 4NYJR 2JLZA 3EIEA 3FMPB 4CEJA 3AVVA 3Q3JB 3Q85A 1B23P 1HH4A 1TF2A 2V4ZA 3PEVA 4RD3A 4EFMA 1IJEA 5IRCD 4KXFB 1VKJA 3QIAA 5K8TA 4BLSA 4DUGA 1OKKD 4UNSA 3LA6A 2ZR0A 4PTLA 2GZDA 1H65A 2BV3A 2WWIA 4EPXA 4BPBA 3PVSA 4R71A 4FMCB 4O2LA 3BWDD 1NIJA 3I92A 4N3NA 2REXB 3CF2A 3KB2A 4EQ6A 5B30A 1DOAA 1KDPA 2ECKA 2OAP1 3QEJA 3KX2A 1ZCAA 2W6JD 1NG9A 1Q44A 4IEIA 4Z8XA 4QJ5A 2HV8A 1ZM3A 1Q21A 2A30A 4HB3A 2OV2A 1T3HA 1KHTA 3GEHA 2A78A 3PENA 3I1FA 5TVKA 1RZ3A 3B6EA 4M53A 3UG6A 3BB1A 3VU9B 3BAFA 1G16A 1SVMA 2ANBA 3L2OB 3NKVA 1T8TA 4GSYA 5EZ5A 3K0AA 4QFMA 4BFZA 1ZM7A 1M2OB 2PJRA 1VMAA 1NIPA 2C2HA 5G40A 3K53A 5AJZA 4LBZA 3O8CA 1Z83A 1E69A 4M1MA 2YOHA 2NPFA 3KJGA 1VYTA 4LHZA 1E2LA 1W1WA 1XJQA 2QMHA 3THYB 5DI3B 2ZANA 1L2TA 5FL3A 1FUUA 1ZIOA 4RZ2A 4DEXA 1ZNYA 4Q47A 4ACAA 4US2R 1DO2A 3PFIA 4MRSA 1AK2A 4C0QC 2WSSA 3GJXC 2DCUA 1P75A 4OKSA 2C78A 5EUMA 1YR7A 2OFXA 3OEHA 2ZROA 2ZSFA 4MITA 4PO1A 3BFKA 3RSLA 3KKPA 3IKJA 2ZJ5A 3EASA 1JEEA 2C04A 2ZI3A 5GJWC 4YMWA 2YVUA 2JLWA 2CCJA 5KNCA 3ZVMA 4W5HA 3U7HB 4UXHA 1RIFA 3C7KA 3ADBA 3FMIA 4E22A 4NYIQ 1KJWA 3M0EA 1Q0UA 4LHWA 2RGEA 1YR9A 5D3MA 4OK3A 4OHYA 3KKQA 1QDEA 4NMMA 3CUEF 4V0ME 4NHOA 2LKDA 3FKSD 1SULA 1COWA 4FINA 1JALA 4K8OA 2R6CA 2IXFA 2NPIA 1XMVA 4QBHA 1F3OA 2GCOB 5CK5A 1XEWX 3A36A 3K70B 3NH9A 3OIVA 2XNDA 3KKMA 3P4XA 4Y0VA 3QF4A 1ZNWA 4L9WA 3RYTC 4LC0A 3RS7A 3C8UA 3AF2A 5KOYA 3D7MA 4NBSA 3WP0A 1QHSA 2QSZA 3K70C 1CF4A 4LX0A 2XEXA 4ON9A 4X8MA 4IVPA 1LW7A 2CMKA 1E4YA 2Q3MA 3PIRA 3DOFA 4CT4B 1VTKA 1G3RA 2PH1A 2ZU6A 1XX6A 2B7BA 3RSOA 2J1LA 3H0KA 1JI0A 3RC8A 2H92A 5SZKB 3AVPA 5L3QB 5CYOA 3R8FA 4PPQA 5BN5A 2WICA 5P21A 1Z0DA 2BEJA 5FR2A 4LYAA 2AKAB 2R9VA 4XJXA 3KQUA 4JT2A 2ZRAA 1YZQA 1XEXB 2VHTA 3E5HA 4L16A 1YZGA 2GETA 3VHXA 4JLMA 1L4UA 4HSEA 4RD2A 2VF8A 3GJ8A 3LFUA 4LJ8A 3U3MA 2F6RA 2QMUA 2G88A 1NJFA 3AUXA 4Q1DA 1W4AA 2R2AA 4Z8YA 3SC3A 5AUOB 4LV5B 5C4GB 1QRAA 5BW8A 2A3RA 4HLUC 4D0NA 4WAUA 3LLMA 2PX3A 3I62A 1HA3A 4JLDA 1BO6A 2UVQA 4AKHA 4GOJA 1BKDR 4TLCA 4M1OA 1N5IA 4B2LA 4M9XA 4NYIR 5L8VA 2IYUA 1XTKA 3SBDA 2XZPA 3W8RA 1W48A 4HATA 1GL9B 4TQAA 3QBVA 4RKFA 3ZQJA 4RY2A 5A5GA 2JGNA 2GF9A 3OIWA 1Z0FA 2O52A 3U3KA 4ABYA 2WVJA 2ANCA 5CIWA 4LPSA 4V0LA 4II7A 1VYVA 4AKEA 1OFHA 4P32A 3THYA 5D3MB 2H17A 1O3YA 2XZOA 3A37A 5EXXA 2J5XA 4KYUA 4PSVA 1BH2A 5JWRA 3CX8A 1TF7A 2VSFA 1HT2E 1CULC 2QL6A 1Y63A 4RCYA 1W5SA 1EFRA 1G5PA 1KI4A 4Z54A 4DDTA 3UWOA 4CEHA 5J4VA 1D9XA 5KO2A 2ATXA 2K5UA 4A15A 4JT4A 3RS2A 1NF3A 3QF7A 4OI2A 1T3SA 3DOEA 3TSOA 4TYNA 2PZGA 1MO5A 1SVKA 3A1WA 1XJCA 3L0SA 4HAXA 2QT0A 1E9DA 1QHNA 2OSBA 4Q5IA 4CT5A 3GLIE 621PA 4OYHA 2CHQA 1UPTA 4HZUB 2FPKA 4UXIA 5E7IA 3B5JA 1CIPA 1ZIPA 2IUSA 1OXTA 5AJWA 1A82A 1XD2B 4URVR 1YE8A 1T3LA 2FU5C 1HV8A 2FEOA 2WKPA 2D74A 3X1WA 4D26A 1ZU4A 2XB2A 1DELA 4D4JA 4Q1CA 3R20A 1UKVY 3GFPA 4B3BA 4LJ5A 4RD1A 2LCFA 3CB4A 2OG2A 1S1CA 4B3XA 4Q9JA 2PMDA 3TW8B 1J99A 1S3SA 1IJFA 3A58B 5EE5B 4N0DA 1R10A 1VCNA 1WMSA 1K5GA 4OK5A 1JNYA 2B7CA 3O8RA 3U6KA 4KHZA 3CR8A 1II9A 1I4TD 5KNBA 3DL0A 1GNRA 4L4UA 3AH8A 1MR3F 3NG1A 1OIVA 2OBLA 2YZ2A 5HTKA 1XDBA 4QG7A 2HUPA 2C77A 4ZCIA 1WB9A 4NL4H 4URUR 5JBQA 3WYFA 1KYIA 4KVGA 2P0EA 4DLWA 5FTKA 4H9GA 4A0HA 4OI0A 3ADDA 2ORIA 1QHIA 1Q3HA 3SJCA 2UZ3A 4H1VA 2QGZA 4LK2A 4PHHA 2IWRA 3VR4A 5L3SA 2QGNA 3GJ0A 4EJSB 4OQNA 2IF2A 1P9RA 2AXPA 4JLOA 4HDQB 2ZRHA 821PA 3REGA 4G0NA 4GDFA 2XJ9A 3C14C 4MRRA 1EX7A 2GNOA 3TQFA 3ZLJA 1EGAA 2XNSA 2EYUA 2QAGB 4L9SA 2RAPA 3AUYA 3ZJYA 2FGJA 4FN5A 3KFXA 3TW4A 3RDPA 1SKYB 1KZGB 1ZM9A 2ZYVX 2HJVA 2GTPA 2RKOA 4PPGA 3IEVA 5A0FA 2IEZA 4DDVA 3CPHA 4W5JA 1OXVA 1W49A 4JJZA 5HZHA 3THWA 1PLJA 1JR3D 2OCYC 2PCLA 1XTJA 4A8JC 2QBYB 1UBFA 1NMXA 5C1BA 2PZEA 3TAUA 1S9HA 2FA9A 3BFVA 1G7CA 5ELXA 2ZS7A 2X1VA 3NDPA 4DEYA 4TSFD 1ONBA 2ZVPX 1H8HA 2PEYA 3BIFA 2WPDA 5JI2E 1GRQA 3AKYA 3QPVA 1E79A 1RYHA 3AF1A 4NCHA 4UNQA 2BBWA 2XAUA 1A1VA 1KNQA 4Y0AA 4MKGA 1G7SA 2PT7A 2NTYC 4RFVA 2H5EA 3REFA 3MFYA 3TE6A 3LX8A 3LLUA 4KBGA 2IS1A 4DLZA 3CPEA 3KXKA 1LFDB 2J9RA 3TMKA 4I1SA 1RC8A 1Z6YA 1P9WA 2ZS8A 2F43B 5B58C 1SVIA 2A9KA 4LJ6A 4CF7A 1KMQA 5E7JA 2OCBA 3AVTA 2Q6TA 4PANA 1ZUHA 2AR7A 4HLCA 1Z0IA 4BFTA 4EPVA 1CP2A 4KAXA 1VYUA 3GEIA 1EFRD 2P6RA 3W3AA 4Q03A 2GRJA 1EFCA 4Q9HA 4KFTA 2ZXUA 1OKKA 5E4FA 3B9PA 4KV9A 5DYGA 1IXZA 3P4YA 3LRPA 2ZEJA 1WDTA 4QXAA 4Q1EA 4TLBA 4NCIA 1Q20A 4G01B 3EC1A 3MCAA 4HLUA 4C9BA 3H1TA 2DYKA 1R0XA 4I99A 5JJLA 2PZFA 2HT6A 4GMXA 4NCNA 4BLRA 1YVDA 3R7WB 2VP6A 3B78A 3LBHA 2AKYA 2WWYA 2ZQ5A 2WWFA 2RGAA 5G3YA 2G0NA 4D25A 3BH6A 5UKDA 1BMFA 3U44A 4AYWA 2CVFA 4KO8A 4PSAA 1K6MA 4TLAA 5FBWB 5HCIA 1ZD8A 1EX6A 2VYFA 3L0PA 3KUCA 4URZR 4ZO4A 2H18A 4P4SA 1QHHA 1E2QA 3DHWC 4IKEA 4Q01A 3SYNA 1XP8A 4PC3A 1R8QA 5JMTA 3KKNA 1GDDA 1JR3E 5KPJA 3ZYCA 1PUJA 3BFXA 1D2NA 1OPXA 2FSHA 2FZLA 1A2KC 1XEXA 1AQYA 1G3IA 2RB4A 3BB4A 3MMPA 4D80A 5LDDC 1KDTA 1YQTA 4C2UA 4A2WA 1KAGA 3WBJA 3RRMA 2RGCA 4IDQA 4GFDA 4OQLA 3SJAA 1TUEA 3FWYA 3CBQA 3VNVA 4KLZA 1E2IA 5EE1A 4E07A 2QPTA 2WJHA 4A82A 4YC7A 5E7MA 1TEXA 2DWQA 3FHCB 3LXRA 1W4RA 1OB2A 1J70A 4RSGA 1XPUA 4MRNA 1KK0A 4HI0E 3OIYA 2EFGA 1M6NA 1E9FA 2ZUBA 1G19A 4LHXA 1OH5A 1QG2A 2QI9C 4X8LA 2VHCA 4I81A 2V6IA 3TIFA 4DUGD 4AK9A 1EFTA 1N0WA 1PLKA 2VHQA 4NE2A 4RFSB 2WSSD 1OH6A 2QQ0A 4PQFA 1P2TA 2ZRFA 4M1KA 3SHFA 5KUTA 4HB4A 4V0NA 3TSZA 1ZW6A 5J4HA 3A1UA 2QTHA 1W5TA 1J8YF 2KSQA 3DMNA 5GVSA 3G5UA 3IHWA 121PA 2FG5A 3V4RA 1N6KA 4IVRA 3ZZTA 3VX4A 4QGGA 2REBA 4H1UA 1KI3A 4ZI2A 2PT5A 2XSZA 3SEAA 5DNYB 2BM1A 3PUVA 2WKRA 2BC9A 4A36A 1IQPA 1TL7C 3NC1C 5EP4A 2IYZA 3RS0A 2ZRGA 4JVMA 1AS0A 1T9HA 1A4RA 1G8PA 3B1YA 3W90A 1N6RA 5HCNA 3HR8A 5FTMA 4EQ6B 1KK2A 2ZI6A 2ZRLA 2O8EA 4YMSA 1JBKA 4JLNA 4PC6A 4LJYA 1ANKA 4P4TA 4DIDA 1U8ZA 2GBLC 4F4JA 4NYMR 1DEKA 2VP5A 4D0GA 5FBVB 1US8B 2ZPTX 2J59A 1UDXA 2O8DA 2J0VA 2GZAA 2A5YB 2V1XA 4ARZA 2CE7A 3QJYA 3UXMA 2P65A 1NBMD 2ZJAA 3AGPA 4DCNA 2QP3A 3T12A 221PA 1RPZA 5JHGB 5J4KA 1CJUC 1AZTA 1I4DD 3HJNA 4CYMA 4G5GA 1ESNA 2ZJBA 3C4JA 2QA5A 5K8UA 3CR7A 2Z4RA 3B9QA 4G5RA 1N6OA 1KAOA 1S3GA 1U98A 1U9IC 3PR1A 4F4CA 3U3JA 1P61B 1KMHA 5LPNA 5LD2B 4BFXA 2VHUA 3NBYC 5JEEA 1LNZA 3LD9A 2O5VA 3PCRB 1M7BA 3RNLA 1YU9A 3EXAA 4C30A 1GL6A 2ZSAA 4PQRA 5H1YA 4JL5A 4KODA 3TAHA 3V00A 2B21A 1XPOA 1DAKA 1NVVQ 2J0QA 3CWQA 1P73A 4M9SA 4I1OA 3HU2A 4NP6A 1DO0A 2CL7X 2ONJA 1RE0A 2ZIAA 1NVVR 1KTVA 1T5IA 2YWEA 1XEWY 2BBOA 4LUCA 2ZJYA 5AJXA 1FFHA 3SNHA 5H70A 2AX4A 3W34A 5FTJA 5EQTA 4ZIRB 1X8JA 4B76A 3DM5A 4Q7LA 5AUNB 2VRWA 3UG7A 2H16A 2IYTA 1E3MA 1E2KA 4S2EA 1XCMA 4HUTA 4NCJA 1SHKA 2ZSDA 3GJ5A 4PR0A 3NBXX 4BLOA 1HYQA 2E87A 5CLLA 1CRQA 3GLFE 1RKBA 4ARZB 4PSKA 3EA5A 4WBSA 3AB3A 2QAGC 1MV5A 3U4QB 1TQ6A 3EC2A 1YHNA 4DBLC 5FBRB 3RWMB 2WSMA 5FI0B 5JI3E 2OLJA 4FXPA 1W4BA 1EWQA 4AI6A 1MABB 3I32A 1U0JA 4YMUA 2GCNA 4WIAA 5JWHA 2XNDD 4EJSA 5L3QA 3D8BA 3CRRA 1CBUA 4YMTA 5FUXA 3FMFA 1CS4C 1MO3A 4Q18A 3VKGA 5H68A 1L7VC 2Q9BA 2WJJA 3BBPA 1II0A 4Q1AA 5JRJA 4JVSB 1YKSA 2CK3A 4MRPA 5FBQB 2B92A 2DBYA 1FX0A 1Z0JA 5KU1A 1Z63A 3RHFA 1V43A 4ZDJA 4M9QA 1G6OA 2AWOA 2F43A 3PUWA 5LBIA 4P4UA 1E9EA 2BMDA 5CK4A 4DT1A 3M6AA 3V9PA 3CRQA 1SKYE 2FFBA 1TX4B 4B35A 2ODNA 4ITRC 4RZUA 5FI1B 2EU8A 3L0OA 2MMGA 4IOJA 1JAHA 4JLBA 4JSYA 1E9SA 3R9IA 5M04A 5EXPA 4DRZA 5HKKA 1IY0A 5G3ZA 2X77A 1R0YA 4HLDA 1HTWA 1UM8A 1B0UA 2CNWA 2FX3A 3EIHA 4MGKR 1Z0AA 4OI1A 3CNNA 3WYAA 1KGDA 1Q1BA 2NO1A 4M4SA 5CJ2A 1ZUIA 2IYRA 3OAAA 4AYXA 4XOIA 3FOZA 5FR1A 4CIDA 1X8KA 4V0OA 1E2NA 1R8SA 2W00A 4FWTA 1Z28A 4WZ6A 2HF8A 2FGKA 3QXXA 5CM8B 1G4AE 2GAAA 3UMSA 2BIFA 5FOTA 4TZ6A 1JPNA 1Z6GA 4Z1MD 1W4CA 4P0TA 2HYDA 1IHUA 1UBCA 1L4YA 1LS6A 3DVLA 4M1SA 1G18A 5IT5A 1QF9A 1XTSA 4QBFA 4FMBB 3CNLA 1OFIA 4DDWA 1U9IA 3U7FB 5DSZA 3THOA 1GRRA 1R0WA 2XTZA 3T1OA 1GAJA 3QUSA 3VHLB 4A6XA 1MRNA 1Z0KA 1R7RA 2QQEA 2BCJQ 1F6BA 1II8B 3E2IA 3NBZC 3TUIC 1R0ZA 2VHJA 1NN1A 3S1AB 1E9RA 2JDIA 1UBGA 2VP4A 3GFTA 2ZITA 1E94E 1N6LA 1HE1C 2W0MA 3FFBA 4IVQA 3RANA 1FZQA 4PPFA 2N42A 2ZR9A 3HWSA 1XD8A 3HP1A 4HB2A 2RGXA 2GCPA 3IPYA 2P2LA 2IS6A 2MMCA 2ZRBA 3GMTA 1BMFD 2FF7A 2O8CA 4O25A 3AVYA 1UFQA 1ZRHA 3K9HA 3THWB 3QXCA 1HT1E 1H8ED 1FTNA 4ZKDA 3IGFA 2JJ2A 1OB5A 5K8IA 4DC9A 4E03A 2IYQA 3GLHA 3K9LA 2OCAA 3LAWA 3GQBA 4R98A 2QN6A 4B47A 1XWIA 2GJ9A 1TMKA 4LJAA 4PO8A 1NMZA 4EKDA 1NL3A 1M1YE 3D3QA 2DWOA 1RJ9B 1ZC4A 1BOFA 1N3BA 4D81A 4KJZA 1G1MA 1XFAA 1G64A 4CRWB 4ZDKA 3AVQA 3UPUA 4TYYA 3F5FA 2CVHA 3TBKA 3L0IB 5JSZB 5FUVA 4EFLA 2RH5A 4M8NE 3ZS9A 3AF4A 1NNEA 3K0FA 3SN6A 4ASUA 2JLQA 4QJ3A 4LYJA 4NCKA 3I72A 5HE9A 4CDGA 3FHTA 5KDDA 4LYHA 4YXWD 3GJ7A 2JJ8A 4GNKA 3TK1A 4AURA 5KSOA 1PJRA 4C4PA 5FTLA 2GEUA 1KK1A 1R6BX 2QM8A 3RS4A 3A1SA 4Q4AA 2Z6VA 4NONA 3BORA 1GM5A 4Q48A 4M2LA 4WXPA 3PUXA 5GJCA 1E0KA 4PC7A 2X19A 1G8FA 1I4LD 3IDQA 2ZE6A 3ND8A 2HT1A 2CK3D 2BVNA 1G291 4US0R 3WHLA 1PZNA 3EWAA 3H2YA 3I8SA 1G6HA 4Q4HB 2XITA 1GP2A 4MYTA 4BZXA 2CL6X 2VH5R 4C7OA 4ZDIA 3PITA 1HQCA 2WMNB 3GP8A 3ZH9B 4IDOA 2D06A 1EK0A 3THXB 4W5WA 4B3GA 4B33A 3P1JA 2WZQA 2CJWB 1UEIA 3CKLA 3TNFA 3I4LA 2IYSA 3BK7A 2BEKA 3S1AA 2RHMA 2GJSA 2IL1A 421PA 3A4MA 5FBLB 1HUQA 4Q00A 4QM6A 4Q7JB 5G41A 4BASA 3QKUA 1MO4A 4HYYA 4Q4JB 4RKEA 2C9OA 1P72A 2D2FA 2JASA 5TXGA 1QVRA 2P5TB 4X8OA 4AWXA 4BWYA 3NDBB 2Q3FA 4GZMA 4TMWA 2X2FA 1E6CA 4F7WA 4TL9A 1T6NA 4JJKA 5DYIA 2QRZA 4TTQA 3OE7A 1IN5A 3MWJA 3QG1A 4G5QA 4D4LA 3CH5A 4B3CA 2GILA 2D3WA 2GXQA 2HJGA 3AGQA 3THXA 3SFVA 3OIUA 3SDZA 1T0HB 2W83A 2BJWA 4MQBA 1SVSA 5F9HA 2OO7A 4WXRA 4MGIR 3IIJA 3OEED 4XD7A 3K0CC 4HUQA 4MGZR 3O8DA 3QKTA 2GEVA 2ZUCA 2DWPA 3EZ6A 4Q02A 4F93B 4AG5A 1R5NA 4M0LA 4DSNA 4PPNA 1QZXA 3H84A 4UJ5A 1T5LA 3FPAA 1UF9A 3IIKA 1C9KA 4A0RA 2GJAA 2WWXA 2YKGA 3LBNA 1G5TA 3LH5A 5TB5A 1UEJA 2R6FA 1CKEA 2KI5A 4TYQA 1SVWA 3E70C 3CPJB 3LX5A 1G17A 4URXR 2V8OA 1N5LA 3FKQA 3PEUA 3UANA 1V5WA 2QG6A 3IQWA 5H8WA 2NQ2C 1NVWQ 2R8RA 2C96A 3QE0A 5EE0A 3W6PA 3A1VA 4C3ZA 3D6TB 3QEOA 3B85A 1OV4A 4QGHA 1ZM2A 4Z51A 2YINC 3LNCA 4J0QA 4QRHA 4LZZA 3T06B 4URYR 4UKDA 2J0UA 2TMKA 2ZJOA 2Z83A 4LWZA 1NLZA 1LVGA 1ODFA 3QNUA 4AKGA 1LV7A 1CLUA 1IY2A 1FQJA 4DLTA 2A5JA 1ZVQA 4Q9LA 3A4NA 5KPDA 5DI9A 4HZUA 1XRJA 3L8ZA 2ONKA 2WBLC 3AVOA 2Z0MA 2A5DA 3ZVNA 1ZUNB 3W6OA 5JSZA 1XEFA 4LCBA 2VEDA 3BERA 4TLDA 1OYWA 4GPTA 2L0XA 3OF5A 4B48A 4LGMA 1E0SA 2VSXA 3AP1A 3QKRA 4AKIA 4NYMQ 1RW4A 3SI7A 5SZJA 4JMPA 4LHVA 2KB0A 2ZRMA 4WW0A 5AWFC 4HB0A 4EPTA 1E1QD 3C5CA 4PC2A 3TUZC 4C0KA 4TT3D 1SQ5A 2FN4A 2P6NA 2V7QD 3H86A 4LY6A 4BFYA 2I3BA 4IW3B 1F2UB 1HQYE 2ERXA 4Q19A 4C0AC 1OXXK 3BB3A 4EPYA 4DXAA 3T1QA 5JLJA 1C1YA 2Z43A 3GPLA 4A2QA 3DKVA 1TEVA 3DDCA 4GP7A 1A5TA 2V7QA 3U7GA 2ZRJA 1GILA 3AM1A 3VMFA 1WP9A 3GD7A 1AKYA 1JR6A 4BZPA 4POAA 4V03A 1E98A 4D4KA 5BN3A 2NMVA 2GCOA 4IHQA 4ERNA 3T34A 1W46A 4XD7D 2ZRKA 4JL6A 1Q1QA 2RGNC 2YHSA 3LW7A 1NMYA 4BRWA 4EPWA 2XOKD 3W5JA 2HYIC 3K1JA 4CEIA 3MAAC 2W6ID 3DZDA 2ORVA 4WA7A 3P32A 3GLGB 5A4JA 3K0AB 2AXNA 1J7KA 1OSNA 2EFCB 3MWLA 2ZETA 4PFSA 5L3VA 3FB4A 4US1R 3SJBA 3QBTA 1KY3A 1MABA 3R9WA 4X8HA 2KE5A 3U7EB 3O47A 2QMOA 1VG9B 3I73A 1N2CE 4HDCA 4KVAA 4KSBA 4DCSA 1P4SA 4NU0A 3NC0C 4RFSA 2NGRA 4C0SA 3HR7A 1HE8B 1AM4D 2GWHA 2WTUA 4QBGB 2DFNA 3K8YA 3WMGA 1UKYA 3B82A 3E1SA 1YR8A 4UNNA 1P2UA 1XMJA 2OEPA 2WM9B 3LWNA 5SZIA 2WJYA 1VIAA 4IDNA 3EIQA 1I2DA 1JJ7A 2QP4A 4Q7KA 4XWOA 3MLEA 1OF1A 5G53C 1DAHA 4A92A 2BKEA 1D8TA 2QY9A 3MUFA 5JS8A 1JAIA 1OJLA 2BBTA 1EFHA 1ZD9A 1DPFA 1U8YA 4URWR 3WNCA 4TWZA 5JFGA 2EFDB 1OHHA 3F8TA 5IDVA 3U3OA 4G5OA 4QJ4A 3ZD7A 3HYRA 4TQ9A 1BIFA 1W0JD 2HF9A 1ZINA 3HPRA 3SHWA 3LVQE 3U60B 1P2SA 1D2EA 2IF0A 4XH9B 4IOLA 2QAJA 1J2JA 2QEQA 3EA0A 4MGYR 2XGJA 2IYWA 2Q9AA 2AFHE 4B6EA 4DLYA 5GJVC 3X1ZA 4YDSA 3FDIA 2CBZA 3QPWA 1U0LA 1P9NA 2A5GA 2DY1A 1OLOA 1NI3A 4Q4HA 3L43A 2GZHA 1P60A 2OE2A 2YOGA 3N2EA 2A5FA 2YWHA 2ZYUX 1KO4A 4DJTA 1GL7A 3NHBA 4QGFA 1UAAA 3NH6A 4GP6A 1Z6TA 2YC2C 3IUYA 3DM9B 1E2EA 4MKFA 4U7DA 1XZPA 1RRGA 1DVRA 1XTQA 4N0EA 4O3MA 5KDLA 4Q1FA 2G3YA 1HURA 2JIZA 4M1TA 3WHKA 1FNMA 2OHFA 1IM2A 2R65A 2XXAA 4GI7A 4JLKA 4B3DA 1QBKC 4TMKA 1NBME 3WNDA 4D6PA 1NVUQ 4DSUA 3D31A 2IUUA 1CJTC 1MO6A 2AN9A 1NLFA 1W36D 1QHXA 4JL8A 5JECA 1N6NA 2Q0HA 3U2QA 1T8UA 2FV8A 2PX0A 4MYUA 1DS6A 3DZ8A 2QNRA 4EFNA 2WJGA 4CZ2A 1YZTA 4KFRA 4XSGA 3VR6A 5KNDA 3C16C 2IK8A 4QHSA 2ZSBA 1CJMA 1T0JB 4E09A 5AUPB 4R7ZA 1ZYUA 4BLTA 4FIDA 1XNJA 4DCVA 2W6IA 5FUWA 3ZVLA 1O87A 3GLHB 5E3HA 3CWZA 2ZRIA 2GJ8A 2OUKA 3R9XA 4M9ZA 3X1XA 1EFUA 2WJIA 3B7GA 4G3XA 3EW9A 4NYJQ 3CF0A 3ZIAD 1QHHB 1SXJD 2XJ4A 3K09C 4HAZA 4BLQA 5KSYA 4QL3A 3GCGA 4PO9A 3GFOA 3P27A 3LV8A 2I1VB 1Q22A 2OCPA 2ZREA 2ODWA 2J45A 5F2EA 3CLVA 5FL7A 2JLUA 2FDCA 4HUQB 2IS2A 2QP9X 1JEDA 2JLSA 4GMDA 3KUDA 5F3WB 3TH5A 1CXZA 2GHIA 1GWNA 2G6BA 4R9UC 2ZM5A 1E2GA 4GRAA 5IK2D 2HDNB 3AP3A 3IIMA 2C9YA 2YJTD 1S96A 3KZ1E 5B2ZA 4B74A 1NSFA 4LJ4A 2D7DA 1S8FA 1TQDA 2C5LA 3WRYC 3PUYA 3Q7PA 2Q21A 5AR1A 3I8XA 3K0SA 1P5ZB 4Q4LA 1SZPA 1OHHD 2FFHA 3M4YA 4FMDF 3VR2A 2WKQA 3VQTA 1RRCA 2OXCA 5HPYB 4RZ3A 1GRNA 3QOFA 3RABA 2C95A 3PV0A 4JLPA 3K9NA 1VIYA 5CYPA 1FW6A 1BS1A 4OJQA 4Q9KA 2WWWA 1CR0A 2ZRDA 4TMVA 3PQCA 2DR3A 1WQ1R 5B57C 2ZYWX 5J4YA 5J47A 1TU4A 4I1VA 1SKQA 2JLXA 3SQXA 3KQNA 1W36B 5FPTA 1W0KD 2E9SA 3PXGA 3CO5A 1JQJC 1L8QA 4P31A 3JVVA 1E2HA 1M74A 2ZRCA 3I61A 1AGRA 8OHMA 1JXOA 5CB6A 3B1VA 2BMJA 4ESHA 2E1RA 2ZE5A 1KI6A 1W47A 3RRYA 1SVOA 5HZKA 1Q57A 2O0JA 1XU4A 1Z06A 3C5HA 3HU3A 5TARA 3TQCA 2FNAA 1S4QA 2BDTA 3B60A 3H4MA 3WP1B 2FEMA 3SJZA 2FFAA 4LI0A 5CJPA 2BMEA 2FPLA 3NHAA 1R5BA 4V0MA 5LB4A 4FCTA 4LBWA 1Q1EA 2FSIA 4YLGA 4QOSA 1FMLA 1X3SA 1GNQA 3SYLA 2OBNA 3TRFA 3TR5A 3KFVA 5CIQA 5FOVA 4I4LA 2F1IA 1YJ5A 1LS1A 2IEYA 3F0TA 1ZU5A 2IA5A 3PEWA 2IX3A 3W9YA 3EZ9A 1DAFA 2QTVB 5DI3A 3W6NA 1KNXA 2G0TA 4UJ3A 1GUAA 1KZ7B 4MDEA 4FCVA 2HLDA 4DLUA 4GOXA 3VAAA 1EESA 4MH0R 2C98A 2EW1A 3NIBA 5EP1A 5CDFA 1KKMA 4PHFA 1CR2A 2PEZA 3CX6A 4B6FA 2JIZD 1FUKA 3KTAB 5FPHA 2W0SA 3AF3A 4IFBA 3ADCA 1KDOA 2DFKB 2VPPA 4ZCLA 1ZAKA 4ASUD 2GXUA 3QXJA 2YOFA 3OHMA 2HLDD 3OFND 3WXMA 4QNRA 4PAOA 3FVQA 2X2EA 2BMFA 5LD2C 1N5JA 2NO6A 5KHOC 4XVQA 2GJKA 3FE2A 1IBRA 3UKDA 1VECA 1XJ0A 2R6AA 2W2XA 2G9NA 2QBYA 1YR6A 2P67A 4AY2A 4MUBA 5EE3A 2CCKA 3CM0A 1RFLA 1LTQA 2BWJA 4ZV4A 4W9MC 3KXIA 3A4LA 1A2BA 2UKDA 4CEHB 4BFVA 3CRVA 3CW2A 3WYGA 4BUJA 5JEDA 1KK3A 1YZKA 4A6PA 5BWMA 4KYIB 4MKHA 4TQUS 2F1RA 4DSOA 1TQ2A 3DO6A 3HDTA 3GJ3A 1Z6AA 1Z07A 1WA5A 2F7SA 3BH0A 2ZE8A 4OQXA 4HAWA 1VHTA 2JDID 4GBMA 2R6GA 1WXQA 1Z29A 2J7PD 2XTNA 2EQBA 2WWHA 3BOSA 1COWD 1XPRA 3GLIA 3TSWA 2W2VA 4FI3C 3U4QA 4DLRA 2GA8A 2WWGA 3JZAA 4OI4A 3EPJA 5CM9C 5EJEA 2ASEA 4B44A 3B1XA 2QPOA 5AJVB 1GTVA 3OESA 3GEEA 3TVDA 1EWRA 4GOKA 5DH9A 4C0HA 5JWOA 4JYCA 5KYKA 1J8MF 1N5KA 1U2RA 3EARA 4PC1A 2Z5FA 2J3EA 4N1AA 3R7WA 1MRSA 2ZVQX 2GVZC 1W0KA 2GVDC 2NO0A 1NKSA 5FOSA 2XOKA 2B6HA 5CB8A 1G8HA 2PMKA 4DT1B 3AKDA 3AKEA 1E0AA 5DN6A 2EWWA 3K0EA 2CHVA 1KSJA 1W2HA 2YNMA 1ZC3A 1FPMA 4HAYA 2O8FA 1G4UR 4AC9A 3QXSA 3UATA 2WHXA 3QI2A 4IFEA 4TL7A 4OJKA 1R4AA 4G1UC 1GOTA 2HXYA 3JVUA 4XSHA 1GNPA 1RRFA 1XD9A 2IW3A 2W2TA 2YWGA 1E0JA 1MT0A 2R62A 5JCZA 5FTNA 4KITB 5AJYA 5EE9A 3CZPA 3KJEA 4TMXA 2FPMA 2AWNA 3C41J 4LBVA 1X8LA 3B1WA 3I3SR 2IUTA 3KB1A 4JZKA 2G1KA 2ZTSA 4TMTA 4EJSC 4BEJA 2YWFA 2W6JA 3RLFA 5KSZA 3CONA 3NEJA 3NTUA 3SS8A 4ZI3A 5DN6D 3ICEA 2Q9CA 3LW8A 5HE8A 2V6JA 1CR1A 2PLFA 4LPKA 3SBEA 4EUNA 1GITA 1E4VA 3BRWD 4MA4A 1S9DA 3BE4A 1Y3AA 3AVUA 2GDJA 3ADKA 1F2TB 2HEIA 2NOAA 2B8TA 4ZCMA 2P3SA 3OEEA 1FP6A 5EZ6B 3K70D 2N46A 3U61B 3VR5A 1Z2CA 1SHZA 2VIIA 3BGWA 3TLXA 2ZJ8A 4CEJB 1GKYA 1XTRA 4MDFA 5DISB 1DTSA 4BZQA 3CX7A 1ZP6A 3OE7D 3FGNA 3PUZA 2G77B 1IY1A 1Q12A 1R5OA 2EFHB 2NIPA 2PL3A 3SQWA 1YZUA 3MWKA 2P5SA 4A4DA 1YZNA 3GLIB 4LV6A 5JZVA 1NJGA 2WAXA 1S2MA 1T91A 4RZXA 2O8FB 1JQLB 2YC4C 1NN5A 2V1UA 4A0FA 1CR4A 5L3SB 1CTQA 3LVRE 2A7QA 1W36C 4DSTA 4HEJA 1G20E 4QM7A 3A6PC 5KTYA 3ZQ6A 4ZIRA 2JAQA 1XXHE 4C2TA 2OESA 4RD0A 3QPUA 3QQ5A 1P2VA 2FWRA 1VPLA 2OM2A 1KI8A 4QHTA 1CJVC 3EPHA 1AGPA 2ZRNA 3KKOA 4PHGA 4UNPA 3IHLA 1UADA 4MYCA 2WOJA 5JJIA 2GF0A 4PHTA 2B8WA 2IYXA 2OLKA 1K5DA 3O8BA 2JATA 2WIAA 2IWHA 4BE7B 2GK6A 3RRNA 3ICQB 1G9XA 4JBYA 3BJIC 1E2FA 1E9AA 2OT3B 1QVAA 3CRW1 3IBYA 2IHYA 4QC2A 1UKZA 2AD1A 4FW9A 2KWIA 3W5IA 1ELOA 1AQUA 1ZBDA 2QE7D 5DHAA 4I1UA 1D9ZA 4YDHB 1F2TA 3DEFA 1E2JA 1F60A 1AIPA 1DE0A 3IBGA 2ZAMA 5FPKA 4JS0A 4B34A 1QHYA 1XZQA 2IYYA 1OT3A 4LRWA 5K8LA 2ATVA 1E2DA 2QAGA 3QY0A 4R2IA 1P7CA 4W7SA 2VSOA 2CLCX 2H57A 4JYBA 1G3MA 1JPJA 4EPRA 2RGGA 1ESMA 1WE2A 1XBTA 2BKUA 1NRJB 2J7KA 2JJ1A 1H8HD 2IT1A 1C4OA 1NN3A 3QXHA 4IDHA 2G1JA 2AL7A 3X1DA 1ZD1A 1KSHA 1Q1ZA 4HAUA 3N70A 1RRPA 2P6UA 3CH4B 4EAQA 4IOMA 1NY6A 1QG4A 2VP9A 1T4GA 5FFMA 2FH5B 4LYFA 721PA 2BOVA 2ZI5A 1X1RA 4NKRA 3V4FA 5IF9A 4B2PA 3GJ6A 3CIOA 1OXSC 2FE4A 1SXJA 1FNNA 3IO5A 2C8VA 4WOPA 1NP6A 2VP2A 1TQ4A 1IN6A 2PCJA 4KFUA 2UZIR 3A8TA 3FKSA 5FL7D 4ESVA 4L5BA 2BBSA 2QU8A 4JVLA 4IRUB 2VBCA 1PV4A 2WOOA 2J7PA 4M1WA 3T15A 4KI0A 3FYHA 1WBDA 3FFAA 4Q7MB 1DBSA 3KQHA 1VG0B 1E96A 1TTTA 3VR3A 4A2PA 3T35A 2A2ZA 4LJ7A 4DIEA 6Q21A 3RS3A 2FFQA 2VF7A 1KDRA 1IONA 1Z22A 2QM7A 3WBKA 4AYTA 4D82A 2OFWA 3FHOA 1SGWA 2C9CA 4RVCA 4D2IA 3VFDA 3DPUA 5JJKA 4DLSA 5C2JB 1WCV1 2IXEA 1ETUA 1G8GA 1OXUA 4CGZA 2WJVA 1CRPA 5CLQA 1SVLA 3VKHA 4YXWA 2KBEA 1SXJC 2CCGA 5B64A 4EDHA 3ZDQA 2GXAA 4DVGA 1G8YA 3QSYA 1XMSA 3U44B 4A8JA 4V02A 1YRAA 3RVBA 4Q1BA 2VL7A 4TSFA 2QORA 1W2GA 1Z47A 3OFNA 3U5ZB 1X6VA 3ZD6A 3G0HA 1Z8FA 3GLHE 1Z3IX 3QG5A 3IQXA 4RD6A 1OFTA 1S0UA 4LOAA 4UQOA 1JR3A 3IEUA 3ONWA 4IOKA 4QNMA 4TMZA 3VNUA 1YZLA 1E32A 3U3RA 5E95A 1KO7A 3I5XA 2QSYA 4DCTA 1TPZA 4PAMA 2Z4SA 5FUYA 4DB4A 1G41A 4ZPXA 2EFEB 3T5DA 2ZRPA 4IEEA 4DHEA 4DLXA 3BXZA 2WV9A 1KMHB 3RS5A 2ZI7A 3MRSA 4F38A 3U6BA 3N2IA 2F55A 4B32A 4IXMA 4IXNA 1TU3A 3MSXA 1M7GA 1XTIA 1AS2A 2NZ8A 2ZE7A 5BQ5A 5SZHB 3K9GA 1AN0A 2OFOA 1U8AA 1ZMXA 1R2QA 1JJVA 2FOLA 1GIAA 5F98A 3Q72A 1IOZA 2O0HA 2JA1A 2BM0A 4PX9A 2SHKA 5KDOA 1XXHB 2ZI9A 4LV8B 4NDZA 4DDUA 1IXSB 3Q5DA 1N25A 2EYQA 1FMJA 1KIMA 2J0UB 3AVWA 2ODEA 1DG1G 2F3RA 1KI1A 4QKQA 4FWIB 1OYYA 2XSZD 5L3RA 3HYTA 4MRVA 3TGPA 2NZJA 3CRMA 1DADA 2PJZA 4L15A 3ASYA 1KSFX 4UNRA 5DIFA 3NEYA 5J40A 2QMEA 4A0GA 2IYVA 2NG1A 1U94A 3GLGA 3EWSA 3ZS8A 2KBFA 4RJLA 3RC3A 1LF5A 1TADA 4OBEA 1F2UA 2CE2X 1M8PA 2VA8A 2YV5A 3CNOA 3K0FB 2JLRA 2R6DA 4D4MA 4XVUA 3ETLA 2NO7A 1M7HA 4PAQA 5C46F 4KFSA 2ZYTX 2CXXA 2JJ1D 2ZJZA 5ANRB 1FOEB 1JB1A 4B71A 2N1BA 2H1LA 2CNWD 4K81B 1OE0A 2OILA 5JRZA 1G21E 4B75A 5IHPA 1A7JA 1X86B 5JHHB 2G83A 2DHRA 4DKXA 4C0JA 3LO5A 3OAAD 1E99A 4BFUA 4R2HA 3EAQA 1DARA 1KI7A 4B43A 1OIWA 1NKTA 4NH0A 2DB3A 3BC1A 1VDZA 3ZGXA 5BN4A 4YONB 2FJUA 3KTAA 1PLLA 2H8KA 521PA 1UJ2A 5HKKD 1VCOA 3MJRA 1XB2A 4F4IA 5AUQA 5FOWA 3RWOA 2KJQA 4XWKA 4TLEA 5DGXA 2VLIA 2V9PA 3JZMA 4Q66C 3AP2A 3GLFA 1P6XA 3GLGE 3Q8XB 1NG1A 1TF5A 2F9LA 1UDWA 4C0BA 3PEYA 3SFZA 4TT3A 3ZVRA 2QTFA 2HXSA 2VQSA 3T5GA 1DG3A 2XZLA 4WZAE 2WMOB 1ZJ6A 2V55B 4TYPA 2F3TA 3OZXA 1D2MA 1CU1A 1KY2A 2RHDA 4HLQB 1X1SA 4LBYA 1TAGA 1Z6XA 2JLVA 4NPHA 1NLYA 2OXRA 3AQ4A 5KSPA 2ZAOA 3UIEA 4B3FX 2AFIE 3EX7C 1I2MA 1SXJE 1XD2A 1ZNXA 3Q5EA 4FMDB 2ZS9A 4EIWA 5FH9A 4C7OB 2F1HA 4P4SB 1IAQA 1KJYA 1FP7A 2PLRA 2O8BB 3FMOB 1KI6B 1XF9A 1NVXQ 4E5UA 1TNDA 4BFSA 2HCJB 5J4LA 2V54A 2AK2A 3C15C 2J0SA 4M1YA 1XMIA 3WMEA 1D5CA 2CLSA 4A1FA 4F92B 3GLFB 1AKEA 2BCGY 2HCBA 3IO3A 4Q4JA 4D0LB 2CHGA 2ODBA 1DAIA 2PBRA 4LJ9A 4JKYA 4BFWA 4HZIA 4JKIA 1N6HA 1IN4A 1NSTA 1E1QA 1FTSA 2OBMA 1G5RA 1WF3A 3EPLA 1QHGA 5C18A 1IXRC 1OW3B 3P26A 3VR1A 2RGNA 1JXMA 4F91B 5DLQC 3BH7A 3AV0B 1OH8A 4P33A 3VKWA 3PJRA 3B13B 2C99A 3TKLA 4BEBA 4LSGA 1DAGA 4QBIA 2V3CC 4GL2A 4LDJA 2RCNA 4PQYA 1ZCBA 3KJIA 4KLNA 1GFIA 1AS3A 1E79D 2CEAA 4HDOB 2WPDD 3B1ZA 4JLAA 1ZNZA 5TMPA 2O8EB 4LC1A 1MKYA 4FMCF 1P3JA 5JS7A 1NY5A 4JBXA 3L82B 4Q9IA 5D3QA 2H7VA 2REOA 4NTZA 5GADl 3UMRA 4OHVA 4XVRA 3VX3A 3Q7QA 4ACBA 1LF0A 4O2RA 1HEIA 2BJVA 4HAVA 5AK0A 5J5CA 1N6PA 2OAQ1 1ZM4A 3IPXA 4A9AA 3GJ4A 4JLJA 2O8DB 2QENA 1YRBA 3SE0A 1N0UA 2ZUDA 4OL0A 1W0JA 4MYHA 5TV2A 3L8YA 3MGCA 3CF6R 4KBFA 1MH1A 3UK6A 4PZZA 3DMDA 3KQLA 1AJEA 4BRUA 4ZDWA 2GK7A 3A1TA 3Q9LA 2O8BA 2AD5A 2RMKA 3NVAA 3KJHA 4JBWA 3M1IA 1M34E 5DHFA 5FOUA 2XXAB 2OZEA 4OK6A 5GVRA 1Z2AA 4WZBE 3LDAA 3F3YA 1RJ9A 3AVXA 1KO1A 4TL8A 1DAMA 1BYUA 1US8A 3TR0A 1GSIA 4L8GA 2D2EA 2LWIA 3NWJA 3BD9A 1G3QA 3ASZA 4BQSA 1S1MA 3LXXA 1BYIA 3LY5A 3MWYW 2ZU0C 3NBFA 1IN7A 2EWVA 3EZ2A 2FZ4A 2ZSEA 4DB2A 2MSDB 1KO8A 1E1RA 1FQKA 4JVNA 4MKIA 5EP3A 2X8AA 3UMFA 1G3UA 2JCSA 3N5CA 4BGDA 4XWAA 1GVNB 2D7CA 5DO9A 3HPQA 1N6IA 3WMFA 1VHLA 1SXJB 1OFUX 4MUAA 2QT1A 2F1JA 3QF4B 1E1RD 3NXSA 1E9CA 3PG5A 2JLYA 1F48A 2RGBA 3MD0A 2JEOA 2QE7A 2ZI4A 3G82C 4KU4A 5DE3A 2VTKA 2GKSA 4TL6A 4ZKEA 4BECA 1VG1A 4Q4AB 4DWJA 4P3YA 2DPXA 5JCPA 1U90A 1D6JA 4RD4A 4XTCS 1KOFA 1J90A 3ZZUA 2JJ2D 4IDPA 5FPYA 4TYWA 1LB1B 3HU1A 5BYJA 4NZYA 4S35A 3UWKA 1G7TA 3TUJC 4ILEA 5BYKA 1UBEA 2CL0X 2GEDA 3KQKA 2I1QA 2ZJ2A 2AK3A 2O8CB 1FL9A 2RGDA 3IILA 2F9MA 4TTPA 5HR5A 3QKSA 4DLVA 4YQFA 4KSCA 1VG8A 3EZ7A 4V0KA 2DFLA 1KI9A 2Y8EA 2BHRA 2GBLA 4FD2A 4JSTA 2IBMA 1G7RA 5LB2A 3MG9A 1E9BA 3B8HA 4C0LA 2XX3A 2O0KA 2ERYA 3ND9A 4CW7A 2DFTA 2Q3HA 3TJZA 4DZZA 1AZSC 2VO1A 4CVNA 2D62A 3QENA 2XTMA 4U02A 2YYZA 1TUIA 3VTKA 5EXSA 1RVDA 2GXSA 1W7AA 3VU9A 3LQQA 2QZ4A 5EUQB 3BS4A 3SYKA 5FOXA 4Z1MA 2FSGA 2CJWA 4AG6A 1WBBA 4Q21A 3P20A 2FMXA 3RRZA 2GAOA 3QVUA 4FCWA 1E2PA 1JECA 4M21A 3LBIA 1WRBA 4QHYA 1EXMA 1KSGA 3MJHA 1F5NA 2I4IA 1GZSA 4OHWA 2GESA 5FPSA 4OHZA 1U99A 1FX0B 3SU8A 3ZIAA 3WY9A 3T1TA 3OEHD 2AHOA 4QGAA 1MOZA 2VP0A 3W3ZB 1DAEA 1CJKC 3SOPA 2FSFA 4B73A 3SZRA 5CDFE 2QRNA 1PUIA 3K09A 4CEIB 2IS4A 2WIBA 4A8JB 2IHBA 2QPAA 4U5XA 3FTQA 1XCPA 5C4MA 4OQFA 3J81k 2J87A 2W58A 3AEZA 3QVVA 3LQRA 4GT1A 3TVTA 1Z08A 2EVWX 3KL4A 5TY0A 4XTRA 3T1VA 2CDNA 1LY1A 1XXHA 4GZLA 5TDHA 1E2MA 1H8EA 4K46A 1VCMA 3QKSB 4PZLA 1IN8A 1K8RA 3KDSE 3R8CA 2MSEB 3SR0A 1Q3TA 4KCGA 1OH7A 3QKRB 3WNBA 4U00A 3RAPR 2ORWA 4PXAA 2WAYA 3ECCA 4XIGS 1XCGB 3ZZ0A 4BLPA 4O0MA 2CLDX 3AF0A 2J46A 3B2EA 3EZFA 4OHXA 1NN0A 3CZQA 4IJMA 4LHYA 4B2IA 2QROA 3DKPA 1GKUB 2D4HA 1EG7A 2R44A 3AKCA 3K0CA 2QUZA 5CITA 1GG2A 5GJBA 1CEEA 1KI2A 1AA9A 1N0VC 4DCUA 1NBMA 4OQMA 2C03A 3T61A 2IC5A 3KXLA 2IYLD 1U81A 1W44A 1OIXA 1HY3A 3X1YA 1VCIA 2MSCB 1U0HC 2IXGA 4PZYA 1Z5ZA 4RCZA 4TZ0A 5EXTA 4UXJA 3W8NA 1KJZA 1P62B 2J41A 4TTRA 3X2SA 4AIIA 4TN1A 2LKCA 1KO5A 4JIMA 5IK2A 1II8A 4G5SA 2XB4A 2NO9A 4YMVA 3I5YA 5F9FA 4M22A 1RYFA 2ZR7A 1KKLA 3WRXC 4AD8A 1GKIA 1UKEA 1PVOA 5BXQC 3EPKA 5EP2A 3EG5A 4WVFA
chains in the Genus database with same CATH superfamily
1SHLA 3EGCA 2P9HA 5EJ7A 1N2XA 4MQMA 1L5LA 3TBHA 4GGPA 5JOQA 5BQXA 4E4RA 3GDOA 4UUAA 3PUJA 5CUQA 5FLXA 3IBFA 2P7HA 4EFMA 1CQPA 3BN3A 3NBUA 3WLNA 2EAUA 3OZVA 5GP1A 5IRCD 2GD0A 4OJYA 5K8TA 1NT2A 4BLSA 3UK2A 3LA6A 2HLHA 4M9CA 2X23A 2WWIA 2EZ9A 3V48A 2G82A 1O96B 1VXOA 5AVJA 1I6MA 1EXWA 2QUKA 3D3WB 3HZHA 4JLSA 4YJHB 5KNBD 2PGNA 3UPDA 4CDRA 1GSOA 3EF3A 3I92A 1N78A 2REXB 3AILA 1CUHA 2EG5A 3C6QA 2FWNA 3W8EA 3ZCVA 5AHRA 5HFJA 2YW9A 3KBBA 4OIFA 1ZCAA 5EMKA 4ZVLA 5HIKA 4CFYA 4G07A 1NG9A 1ZD5A 2XBLA 2UV8A 5CVDA 4Z8XA 1Y5IA 3RAFC 4KOEC 3NTQA 1D2CA 1FYFA 1SA0B 2A30A 2AH5A 2XWSA 2EHDA 4HB3A 3TF5A 4DR6B 2JGJA 4ZEWA 5TVKA 3B1FA 4BNLA 3VC3A 4LZPA 3TL2A 2DKOA 3IALA 4PVDA 3RSZA 3T7RA 2DOKA 2ANBA 2VNJA 3L2OB 4GSYA 1T25A 2O2EA 3DBLB 4MKXA 4QFMA 3SXUA 1ZM7A 4RHCA 3CVWA 1NIPA 2C2HA 2GPNA 3K53A 5LQSA 3D6UA 4ER3A 2I8CA 4LBZA 2H1WA 2Z30A 5A9TA 1E69A 3TB4A 3PTAA 3VJRA 3TSCA 3SP1A 3IAEA 4EITA 5LIPA 1XJQA 1B74A 1R66A 2Q6VA 2QMHA 5C5CA 5M5BA 2JAHA 5DI3B 2ZANA 1E2BA 1SO8A 1DCFA 3L0BA 4QPPA 2F3UA 4PQEA 4RZ2A 2GPTA 4ACAA 2GRAA 1DIRA 4US2R 4C0QC 2FN7A 4CQMD 2DCUA 2ZT8A 2JGKA 2C78A 3NNNA 1M2GA 1YR7A 5IJ9A 3MIIA 2ZSFA 3VJKA 3BFKA 3RSLA 1Y8ZA 4W9NA 4WX2B 4BX2A 3EASA 5JQWA 1ZR4A 3TQSA 5C8YF 4ZPJA 3HV0A 2XQFA 1H69A 3MTBA 3ZK8A 1IPFA 2YVUA 2CCJA 3MNFA 3VPBA 3PFFA 5A3RA 4BMSA 1HT0A 2G4CA 3C7KA 1RC0A 1YQQA 1VRCA 3FSGA 1RJGA 3UJ8A 1Q92A 1Y1LA 4B9EA 5CVJA 3UWMA 1B6SA 1HO3A 5D3MA 1DWPA 2I8AA 3E58A 4OK3A 4QYIB 2ZTLA 5IAAA 3NTVA 4OHYA 1ISSA 1W30A 3L3BA 3GFFA 3O26A 4G89A 2NUAA 3EZGA 2LVBA 2PYIA 2K7ZA 4WOBA 3ZHTA 5IJZA 5J2TF 5KCZA 3V1UA 1SU4A 2AMYA 3DUFB 1COWA 4UHBA 4FINA 4BGIA 3WLOA 2HHAA 2VYCA 2J0EA 3ONFA 4EHHA 1RAAA 2WTBA 2YMMA 3DTVA 5IVDA 2OZLB 4PGFA 1VIVA 1HETA 2ZCUA 5KYUB 3I52A 2CMHA 4WACA 1E3JA 4JJ7A 4I6GA 1V6AA 1ZEMA 4G8BA 2AYYA 3M89A 5CK5A 5TS3A 4TXHA 5DNUA 3OIVA 1IBKB 1HXHA 3KKMA 1TUBB 2HCFA 3QF4A 4OXQA 3R7LA 5F12A 5IC4A 1FMFA 1H85A 4A5SA 1LV8A 3F5QA 4WD3A 3EFHA 1RACA 2OKGA 3DCJA 3LG2A 3O73A 4I4TF 5F5NA 3TW0A 1QHSA 4PLTA 4DIOA 1QRUA 1W25A 2XEXA 3A0UA 4IVPA 3SFTA 3PIRA 1E4YA 5JXHA 2XE6A 4GC9A 1VTKA 2B7BA 3RSOA 2O54A 2J1LA 1Y3DE 4Y2YA 3H11A 5JS2A 2P2YA 3DB1A 5L3QB 3IUBA 4FGUA 3LTNC 5BN5A 1I7PA 4P2BA 4R5HA 5P21A 4EB6A 1TEZA 1JDBB 1IQRA 1X2EA 1Z0DA 2BEJA 3PTZA 4WOKA 2BKVA 3KO8A 5FO0A 5FR2A 3S55A 4BQPA 1SK8A 4C3UA 1SUIA 2G5CA 2I7TA 1OBHA 4F6RA 1W29A 1YMVA 4HRYA 4H4CA 4P80A 5D5PA 3AHEA 3IP9A 4QU9A 1TM4E 4PGGA 4RD2A 1G60A 2VF8A 2LRHA 3EFOB 2PG3A 2F6RA 5DPMA 2I5PO 4G0ZA 1YVRA 2UVPA 1JSXA 4QFCA 1NJFA 2JIDA 4NI5A 3CT4A 4BHTA 1BEZA 3T7AA 5JZOA 1WZEA 4LV5B 3JQAA 2ZTHA 1RWOA 2RH4A 1UDRA 4HLUC 5H0IA 1OZHA 4ARSA 1ABFA 3I62A 4GOMD 1BO6A 3C0KA 1C30B 4MW2A 1OYVA 2V3VA 3NM4A 3HMKA 3L1UA 4KWCA 4QOGA 1DFIA 4PIPA 4TLCA 3C6BA 4D4IA 2N47A 2KQUA 3J80A 3BGIA 1QANA 4RGYA 1G8JA 4IV5A 1DDGA 1RM5A 4OQDA 4E5PA 5LBUA 4JHLA 1NYTA 1OLSB 3GH3A 3TNJA 2XMQA 2QLMA 3KT0A 3B1KA 2PA0A 2ZDGA 4FHGA 4C4AA 4ZYUA 3NDIA 4YCJA 2NYVA 4UE3S 2QDXA 2RC5A 2JGNA 1XLTA 4ZCRA 2ZK7A 4C2AA 5A5GA 1XTUA 1Z0FA 2JBWA 4GX5A 3X2EA 4AIRA 2WVJA 2ZLBA 2ZRQA 3PD7A 5ITZB 1THTA 1E4EA 3NHMA 5A7GA 3UA3A 1D6MA 3F4KA 4A5OA 1OFHA 1H05A 2GT1A 3QVGB 4HBZA 3RBXA 1BOOA 3BSWA 3WIUA 1I2ZA 1JG7A 2I8LA 2B2XA 3C1UA 3OQ1A 3R7AA 4B3TB 2WD7A 1O3YA 1U7XA 2AEMA 4U2EA 1KR2A 3B36A 2Z8XA 2XZOA 1M1NB 2J5XA 1T1GA 2XNHA 4KYUA 1R18A 3CX8A 1TF7A 1WO8A 3RJ5A 2QQGA 2Z6AA 2Q7XA 1EFRA 1G5PA 4XVHA 1MV8A 3VPDA 1E0DA 4CEHA 1D9XA 2JLBA 3R44A 3DO8A 3ODGA 3R0XA 1O4VA 2ATXA 2G8NA 2P9GA 4KWIA 4NATA 4P2GA 3UWPA 3WE7A 1XQ6A 2WE7A 2NZYA 4KQJA 4OI2A 3OCJA 1T3SA 3DOEA 1MO5A 2GYYA 4YJ3F 3TBFA 2AOUB 4Q5IA 1VJDA 1Y48E 1K8YB 3RR2A 5H81A 4OYHA 5LDGA 5HBGA 4DV5B 1NX9A 4RZHA 5F21A 1ZOIA 3OH8A 1CIPA 4L27A 1WB6A 5ALPA 2A9VA 3A2KA 1OXTA 5AJWA 4RPIA 3FBWA 4DR7B 1XD2B 2C7BA 4URVR 3Q9UA 1YE8A 2V5AA 3GLVA 3NALA 2FU5C 5TSDA 3WZLA 4FBLA 3ZX5A 1HV8A 3U7JA 2AQIA 3MT7A 4D4JA 5I7SA 4Q1CA 5TEVA 2C31A 4LJ5A 2ZJ0A 4KO1S 4ISCA 3OX3A 3Q2IA 4B3XA 3DHNA 4Q9JA 2OZLA 2R00C 3ZLBA 3ENKA 5EKDA 3VR4H 2P90A 4HCJA 1KAMA 4WBNF 1YMUA 1IHOA 3RC7A 3WRYA 4N0DA 1Z2EA 1K5GA 4OK5A 2O2ZA 1TUBA 4FQ7A 1C7JA 3UKJA 3O8RA 4KHZA 3WJAA 5JJ5A 4NBKA 5KNBA 5HBRA 1FE8A 3OHPA 2EZUA 4PVCA 3WLAA 1OIVA 4X20B 5HTKA 1ZJJA 4K9LA 1VI6A 3CG4A 1XCBA 3B6IA 1Q16A 3RSFA 4B5LA 1QF6A 3I0NA 2J3HA 2GLUA 1J0BA 4XJSA 4KR3A 4NL4H 3KB8A 3WYFA 3EYWA 5ED0A 1H5UA 1FBTA 3C2QA 1R5JA 3NGLA 4Y2GA 4B31A 5IBRA 5IT0A 1OD6A 1QHIA 2J6HA 4LRSB 4TQGA 5E0OA 4H1VA 4CM4B 4PHHA 3QFSA 5LQDA 2PKWA 2IF2A 4BNKA 4PIVA 3ZEAA 2Z9DA 4GHWA 1TJNA 3P2IA 1ODJA 1Z35A 1ZA2A 2FHSA 4G0NA 2OO5C 2V7PA 3AV3A 5DM0A 3RFXA 3W78A 3ZDBA 1EK5A 1V8PA 4MRRA 2NVOA 2LW7A 1YL5A 2E89A 5EJ9A 3LT4A 1MQ9A 1QH1A 1VE6A 2EYUA 2XNSA 3C3CA 4HXFB 2QMYA 3KU4A 1ITZA 2RAPA 2YXEA 4D57A 2Q4TA 4AJPA 1G98A 3COJA 1WVGA 3KFXA 4CT0A 3IJPA 1U2ZA 2PS9A 4ZVRA 3UOAB 2HJVA 1KBZA 4RDHA 3EGXB 3INYA 2C9ZA 5HF8A 3ZGVA 4B0PA 4C4TA 3IEVA 3ZCUA 3IDSA 1OXVA 2B5WA 3U4IA 2WKSA 4JJZA 1DKRA 1UPBA 4K9NA 3UPTA 4GPAA 3IULA 3WLLA 3HXKA 3WLJA 2QBYB 3ZW9A 4RH3A 2RI0A 3MJVA 3SXJA 2VZLA 4GUAA 1NMEA 3BMOA 3OTOB 3BIFA 1H8HA 2GZSA 2WPDA 1A2OA 4RF3A 3AKYA 3RC1A 5JI2E 1E79A 1GZVA 1SHUX 1WQ3A 3EMBA 4QUEA 2AYXA 2P11A 2G4VA 4UNQA 4HXEB 2PGOA 2WUWE 3WYCA 2VHEA 1QZ3A 1A1VA 3QMPA 1XLWA 3V1YA 3EDOA 3PXBA 5FKJA 3REFA 3MFYA 1IEWA 1RVV1 5EAIA 2QYSA 2BJHA 1XZBA 4D4HA 4DLZA 1LFDB 2J9RA 3I83A 4WVLA 1U3DA 1YZFA 4I1SA 2Y1EA 2X5XA 4A8PA 2F43B 4MVJA 2A9KA 2RIRA 2WJ4A 4PXYA 4C4YA 5E7JA 4U7HA 2VCHA 3WISA 5DW3A 1SJ9A 4GM4A 4XQGA 2IYAA 3PWTA 1HLGA 4GEKA 1QGUB 4QUKA 2GHTA 2WQ6A 2ZWMA 3B6JA 3O8OB 4HLCA 1Z0IA 4DSZA 5KHLB 3NVDA 3BMNA 4YUAA 3VDNB 3GEIA 3OZEA 3W3AA 1ZOOA 1C1DA 1XZEA 2GRJA 2NN3C 2NU7B 1Q19A 3K2BA 4PCLA 4YRDA 2QTCA 3ZWPA 2J9XB 4K6HA 4P93A 3PJEA 3PXAA 4KV9A 1WMAA 4E5NA 3H2BA 4PTZA 2I34A 2ZEJA 2IU0A 3VOTA 4NCIA 3NTOA 4G01B 3TTVA 1JLKA 3QTTA 4G23A 4C9BA 2VDLB 3H1TA 2JFPA 3D1VA 1R0XA 5ESWA 1P6QA 4U3JB 4NCNA 4BLRA 4IDAA 5DM1A 1L6IA 3LBHA 3BUSA 3N39C 2ZQ5A 2WWFA 2RGAA 4L7QA 4OGKA 5G3YA 4N82A 1ONOA 5DCLA 5B1DA 5IVIA 3ZK9A 4NOKA 3DE5X 2CVFA 1P77A 3KWMA 4F5WA 3C6XA 2VNIA 1RRMA 2QJTA 4RABA 2J30A 3OCWA 5CA0A 5HCIA 4EY4A 5EZQA 1ZD8A 4XWWA 5K0BA 1SU6A 2CB0A 2H18A 2J08A 1QHHA 3PB3A 4C29A 4DCOA 4EZEA 1V3QE 4PC3A 2VYQA 1R8QA 4J0GA 5CCDA 4YCSA 2AKEA 1O5TA 3CE6A 4OUDA 2HWWA 3B3FA 3J7TA 4NV0A 1AX9A 1EFPB 2EFYA 3KKNA 1T9CA 5A2QA 1AMUA 5KPJA 2YFYA 2HXGA 3BIWA 4HH4A 5T57A 1PUJA 4CFSA 4ES6A 1OPXA 4Z53A 1A2KC 1QSGA 3EXG2 4D80A 3PXXA 4HDSB 4J4TA 4IDCA 3LSYA 1VA4A 2RGCA 4GFDA 3AY6A 1P4AA 4KWEA 4OQLA 1X7WB 5LP6C 5JCOC 3MMZA 3SJAA 4EL5A 4MI6A 1TUEA 3A7EA 3FWYA 4C7KA 4K3VA 3CBQA 3WGJA 3WGIA 4KRFA 4F7DA 2AFIB 1CCWA 3H11B 4O08A 1PK7A 3GRVA 4YC7A 2DWQA 4UEOA 3WLEA 1WV0A 1I1QB 3ZU2A 3PNYA 1JG6A 1W4RA 2ROQA 3TRIA 4YS6A 1XPUA 1HDOA 1MT3A 3RVJA 5C1OA 4YRMA 1CJCA 3EEIA 1N34B 2EFGA 5FYQA 2NACA 2OBXA 4RZQA 4KRXA 1GGNA 3JQQA 3PGLA 4TS1A 3C7CB 4AJLA 1LA2A 3BWCA 2QI9C 1OR8A 3TTYA 4EO7A 2J3IA 2VHCA 4I81A 4DUGD 2BEWB 2ZBUA 4HNRA 1N0WA 3KSAC 2VHQA 3EXEB 3L9XA 4NE2A 1N92A 1JU3A 4RMGA 1IVNA 2JANA 2Q3JA 1JH9A 4J91A 2NZXA 4HTAA 1OH6A 4YRJA 1QZUA 1O0SA 1T0PA 1HE3A 3SHFA 1NBEA 4FZJA 5SY6A 4I5DA 2PANA 1PJTA 1JDNA 3HKBA 5BSVA 1FTWA 5T4HA 5CCBA 1MX3A 3A1UA 2QTHA 1W5TA 4LN1A 3TOSA 3D5EA 2I7VA 1MQ8B 1RCTE 3RBZA 1N6KA 3ZZTA 3VX4A 2R6R1 4C1BA 4QGGA 2REBA 4H1UA 4H1TA 4AJ1A 4D1YA 1KI3A 1I3NA 1IMOA 4R8KA 4R8RA 4FFMA 4FYMA 4J03A 5LP1A 5HIAA 4UM8B 1VKNA 3JQ8A 2BM1A 3R0IA 1TT7A 2J09A 2WKRA 3NP9A 1NULA 4J7XA 3NC1C 1IK4A 1Y4AE 4JENA 1U5CA 2YMPA 5AOCA 2VYNA 3W5SA 2ZRGA 3WAKA 3BD7A 2ZTVA 1QHEA 3WL3A 2KHZA 1G8PA 3NS7A 1N6RA 4GXTA 4HP8A 3L4EA 4GM1A 5SY9A 1X7XB 2ZI6A 4MP6A 5CD1A 4YT8A 2FX5A 4YMSA 1JBKA 1N5RA 3KSMA 2WQ7A 1ZGZA 4IS3A 3Q3GE 1ANKA 1UBJS 2W90A 3F4BA 1Y5RA 1AKTA 2FUCA 4HAOA 5EZYA 3U56A 2JGDA 2QXUA 1KRWA 1G21B 5FBVB 4YV0A 2X0JA 3U4HA 3M3HA 1BNCA 3KEFA 4CU2A 4GBED 4LQ4A 3M5WA 3PEFA 1UDXA 1YR2A 2BUCA 4LNUA 3WLIA 4BQOA 3CA8A 2CXHA 3U1VA 2CE7A 2XMRA 3QJYA 2CZCA 2P65A 3DDOA 3L06A 4R69A 2QP3A 5JALA 3OP4A 221PA 4ZCPA 1B6TA 5JHGB 1M2KA 1TUGA 3RS8A 5KYTA 4G5GA 2Z3WA 2PUDA 1RJEA 5I48A 3OJWA 3TLAA 3ZQ4A 3C4JA 3FYUB 3E35A 2IYNA 3ZW8A 5K8UA 5MGBA 1VKRA 1Y3IA 2G04A 3JQ7A 3L8FA 4QPJC 3RUPA 1NBIA 5AKIA 3ST7A 1KAOA 4QWWA 4BNNA 1NR7A 2F8SA 4NULA 1P61B 1KMHA 4HQKA 3MCUA 4B7ZA 4Z4EA 2IQ5A 2R6ZA 1PGNA 1KH3A 2FF5A 2WMDA 2WNHA 3UA4A 5HRAA 2BR3A 5ICMA 2ID4A 3BXXA 1C41A 1JL3A 3LD9A 3G5LA 1EP9A 4MW7A 1EWKA 3IP8A 1LDEA 1U2EA 5EQFA 4JL5A 1T9AA 1S2GA 1H4QA 3N5KA 4UCXA 1DAKA 3GGGA 3SX2A 3CWQA 2UXDB 3F97A 1H42A 1WF6A 4I1OA 3HU2A 4UUBA 3IPCA 3IMCA 4MQEA 3FGZA 1XZGA 2ZIAA 3JU3A 1NVVR 2ACEA 3KPUA 1NWCA 1T5IA 4XUDA 4KX3A 1SM4A 2G5PA 2DX7A 4LUCA 1R0CA 4XGNA 1F0PA 2C7RA 4TTTS 2X3YA 3ZGLA 5H70A 2NXNA 1V8DA 3W34A 1EPUA 4ZO9A 3S70A 4IIEA 3H97A 3HG7A 5EQTA 1CZRA 1XZLA 3UB4A 4ZIRB 3R23A 2HTEA 3K2IA 5LNK6 4X94A 7YASA 4KC0A 4Q7LA 4COKA 4PNHA 3MCTA 3UG7A 3M4ZA 3SMQA 1GEGA 4Z4QA 1E2KA 2B0JA 4B8YA 1N36B 3MT0A 4FBGA 4ZHQA 4KPUB 1M75A 4C3VA 1Z4MA 4RK4A 3NHSA 5CLLA 3GLFE 1J42A 2C3OA 3AIMA 1RI1A 2PUEA 1ENOA 2IV7A 3P97A 2BW0A 5IXJA 4U8HA 4PSKA 1ZR2A 1QPGA 1F7UA 2QAGC 3NHKA 4YHHB 1J21A 3N58A 2P3QA 1YHNA 4RWZA 3UYLA 4JEHA 2B99A 1UPAA 2QTAA 3B53X 3DG9A 2WY2D 3WG9A 3GPCA 4FXPA 1MABB 2P78A 3LPMA 2GTIA 1W581 1ZL2A 4WIAA 2RSLA 3ZEIA 2XNDD 3ZCPA 2D1QA 2WYHA 3WTCA 2PBZA 1XT6A 3D8BA 3VDQA 3LZCA 1KOLA 1M1XB 4IQ8A 5FUXA 4Y6RA 3PFKA 3VKGA 2Y9PB 4QBKA 1J9ZA 1ZLYA 2WTNA 4KO3S 1IL0A 4EMUA 2Q9BA 2HM7A 2WJJA 3LYHA 3SOZA 3BBPA 1II0A 1JAXA 1WPGA 2CK3A 2VSYA 4W6QA 1TRHA 1GGFA 2PXXA 2UYQA 4LVUA 2AWOA 2DTXA 4TVOA 3PUWA 5LBIA 4BVGA 5BNWA 1P45A 2IYFA 2OGWA 3BIOA 3DC2A 2PUFA 2DETA 2V9CA 2Q5IA 2HQOA 5JY6A 3IIIA 5L4NA 1TX4B 1Q83A 3ANTA 1CPYA 3QWAA 3BGSA 1VI5A 4ITRC 2ZFUA 4RZUA 2HU2A 1E3EA 5FI1B 3RVQA 1PGQA 1YR3A 1IEQA 1NJ2A 2EU8A 1JAHA 2FPOA 2JFZA 3BE6A 3E84A 3FWNA 3LYAA 4JR2A 3ZXXA 5M04A 1UPFA 3OF3A 4WKNA 5HKKA 2OCLA 3PNOA 4ZOLA 4D6YA 2VPWA 4UULA 4Q7QA 1LBTA 1V5GA 4QGSA 2XHEA 1HTWA 3K9QO 1T9DA 3UHPA 4QO7A 4RX1A 3ROTA 4DJ5X 2AXEA 4YI5A 3INNA 2NO1A 1GZ4A 2ZYHA 3V8MA 4UM9B 2EKLA 4H3VA 4EW1A 4AYXA 1YB4A 1QUFA 4Y1GA 4D56A 4CIDA 1VHWA 3A9RA 3FOZA 1E2NA 1GPJA 1KL7A 2HF8A 3QXXA 3HJTA 2EGGA 4MHTA 2WQZA 1KKUA 1L4NA 3D7NA 5C35A 2B4RO 5LMNB 3CLTD 1TECE 3S6JA 4M1SA 1F06A 1P8JA 4MUEA 5CYFA 4QEDA 4I8IA 5BN1A 3R4VA 1H66A 3F7MA 3CNLA 1OFIA 2DKNA 4KX5A 1U9IA 4U9HS 1M54A 3KAKA 4AWAA 4DDWA 2Q5JA 4KNYA 4K9OA 3THOA 5F7OA 1P1FA 1BMTA 1U0EA 3A32A 1QJCA 3QUSA 3BMQB 3VHLB 4TN5A 4IIXA 3E2IA 3ZHRA 1F6BA 1SB9A 2CWWA 2CHEA 1NN1A 1PGJA 2JDIA 1I3OA 3WK8A 4GKKB 1SC4A 1Z6QA 4GL4A 1ZD2P 1QWOA 1GA1A 2AVDA 8ADHA 1VLMA 5F9MA 4E4TA 1KDZA 2P0YA 3N07A 1AKRA 1FZQA 3HJGA 1Z36A 1JJIA 2ZR9A 3O1HB 4M6WA 1PW5A 1XHFA 1XZNA 1KVTA 4R31A 2RGXA 2GCPA 3FETA 3IPYA 4GNRA 4BJ3A 2QGFA 3GFGA 4KQMA 3A26A 3H1EA 1TK3A 3CCFA 1QO9A 2HHCA 2FF7A 1UBLS 5IKEA 3JAWA 1B8OA 1B6GA 1BD4A 1YQUA 2BZ1A 2V9ZA 2XF2A 3UXEA 2HFJA 2DVMA 3QXCA 2PMFA 3JW8A 4IIJA 4YP9A 3URKA 1H8ED 4CMIA 4D45A 4EB8A 4ZKDA 5DYNA 2JJ2A 2YJNA 2FP4B 4KQXA 4U7JA 3GLHA 2VJBA 3AHGA 2OCAA 3DBIA 1SR8A 4NXMB 3GQBA 3RJ9A 4R98A 2PZKA 4R1UA 2AMJA 2QN6A 1YUNA 1XWIA 3C3JA 4YJ2A 2B25A 5H9VA 2VBGA 4MLCA 1QU2A 1HTBA 3OSUA 2BUAA 4QQNA 3TFQA 3D3QA 4K9PA 3UAZA 1JFSA 2JGRA 1WMEA 1CV2A 4JDPA 1V8ZA 3UCEA 1NFQA 4S1WA 4AS2A 4CRWB 1U1DA 1Y98A 2RHLA 2O23A 2H52A 4V3BA 2C5GA 1M5TA 2XE4A 4MXDA 4PLGA 1U5BA 1RXVA 2EKPA 3BRWA 3L0IB 1JLLB 1M6EX 3LDHA 3N7TA 5CVUA 1DC7A 5FUVA 3AF4A 3PPIA 3K0FA 2QUHA 3FW1A 3QVSA 3RSHA 4EI8A 1U8EA 1UOEA 2PSJA 2R87A 3CHYA 4NCKA 4M0EA 4YXWD 3ORSA 4N6OA 4AURA 2JRLA 2RFLA 1PJRA 2J32A 3C6ZA 1W1UA 2YY5A 4C4PA 1AHPA 1KK1A 3ZTWA 2MHCA 2F4VB 4Z9AA 2C2MA 2HRDA 3V42A 3O3CA 1IUNA 4GO1A 4M2LA 4PZDA 4CR7A 4DDHA 3EVAA 5HJ7A 3EEYA 3GRZA 2ZE6A 3FPEA 1BDMA 2ZYSA 4MVJF 5DLEA 3HVKA 2CK3D 1GUBA 2JIMA 1BDBA 2CYCA 1TGYA 4NBRA 4K0KB 4J43A 4HX9A 4J07A 5IKXA 3AJAA 2Z04A 2A94A 2VH5R 4ND3A 3ROMA 5AVWA 1XZKA 3I2GA 3OCXA 3FOEC 2YWRA 5A4IS 3FNIA 5TF0A 2XLCA 1V8BA 1PJ8A 2WMNB 3LRXA 3GP8A 1Z4IA 1ESDA 3BCSA 5D2CA 5JO0A 1EK0A 4LQCA 1OLUB 3KAPA 3OKAA 3EXHB 7MDHA 3THXB 3NOQA 5P8WA 3P1JA 5FOQA 3I3OA 2CJWB 3ECSA 4H0FA 4WBNB 1KFEB 3E5NA 1TMGE 4L6AA 3SEQA 3TNLA 3I4LA 1NJSA 5SYMA 1DDIA 3S1AA 1E6EA 2OLEA 4F0JA 2H6EA 3NHFA 1E3SA 1Q1GA 3PDCA 1CETA 5E4JA 2IL1A 4XA8A 4BMXA 421PA 1PQYA 3TB6A 1Z4OA 1HUQA 3T7SA 4E13A 2OYCA 5KTMA 3EYAA 2CYAA 2FPUA 5G41A 1J06A 2GEJA 4HYYA 3W6UA 1DPGA 2H29A 4BWYA 1EHYA 3CG0A 5TXGA 5A9SB 2OOKA 2VOEA 3NWPA 4RF4A 4TMWA 2IHNA 2C9MA 3G0BA 4FYIA 3OOEA 4BV8A 1T34A 4RIFA 3FX2A 2AEJA 2EOAA 4D4LA 4UBIA 1IQUA 1CYEA 3PIDA 4RAOA 2GILA 1A1SA 2H5JA 5T4EA 2HJGA 3IR7A 4Y98A 3C7AA 3DULA 1RBQA 1SQFA 1T0HB 1HSOA 4B6QA 4FOTA 5CDUA 1RYMA 2BD0A 3CGWA 4MGIR 2PH7A 5M3BA 4GMHA 3OEED 2BGJA 1A04A 5FI5A 1KYTA 1EG2A 2OQ2A 3DEIA 1H3FA 1WSAA 1T4BA 4G81A 1CE8A 2XIQA 2ZUCA 3EZ6A 4UAUA 4EVSA 3IEXA 4F93B 4AS3A 2BSQA 3D4OA 1BE8A 4L3WA 4M0LA 1FLVA 4B46A 4UJ5A 2ZB8A 3AFOA 5CVVA 4M9UA 1SPBS 4A0RA 2JGDB 4H7PA 2GJAA 1HK7A 2HMAA 1ISPA 2R11A 3GAMA 3LH5A 3TWOA 2DCMA 2WU3A 4QJIA 3U5TA 2BGWA 1Y7TA 1XTBA 3HBJA 1CKEA 4TYQA 4FFSA 4BQRA 3E70C 3IRVA 3LX5A 4TTSA 4NBTA 2YHBA 1ILWA 4LVNA 3WTBA 1G17A 3ZKWB 4ZRMA 1KWGA 3IHKA 1POXA 1TJ5A 1N5LA 4ZYWA 3FKQA 4K6CA 4MVXA 5H8WA 4BBZA 1PHRA 1P3Y1 1NQAO 2UZ4A 2Y71A 3WLTA 2WZDA 1Y4ZA 2W2KA 2XYVA 4ZU3A 2I6QA 4I4NA 3VJMA 1NRXA 2H06A 3I2JA 1P1JA 1OV4A 3CF4G 5BV8A 3ZJUA 1S89A 1H6BA 3KM0A 5ALHA 3ZLTA 4B40A 4Z51A 4J0QA 2PQ0A 4LZZA 5DB4A 3UY4A 2NXCA 4KDFA 3GNTA 2BFCA 1CEQA 2B4KA 2ENWA 3OLWA 5AKLA 2ZJOA 2QW8A 3FG9A 3FFWA 4WN3A 3PBKA 5EC8A 2QIPA 1LVGA 1Z37A 4Y18A 4AKGA 2OMKA 2DQSA 3FBTA 3GEPA 4MV6A 3ZE8A 4NVRA 4DLTA 1TJ3A 1CUJA 2VSNA 2VQDA 3MD9A 1T3GA 1G6KA 2A5JA 3GRRA 1WMBA 1TCUA 1EK1A 3GD5A 1ZVQA 2P27A 4IUBS 4P83A 4HK4A 4QDTA 1OXBB 2JLAA 3ESCA 3GYBA 4PONA 3GMIA 3IDOA 3ZR4B 5ALLA 1XRJA 3N2LA 1J56A 3MYRA 4L4RA 1JR2A 4LZWA 4E88A 3ZVNA 5CFLA 1F9AA 4Y6GB 4RFLA 2ZUEA 4LCBA 1BXKA 2P40A 1GUDA 1L5MA 1AVTA 4GPTA 3FFTA 2D8AA 5AXAA 3IV6A 5KTPA 2C42A 2FOIA 2VSXA 4KKVA 4P3PA 4JI5B 4PS1A 1EM8B 3QKRA 3UVEA 3F98A 4AKIA 3T5PA 1BGXT 2KMLA 2DKFA 4NYMQ 1GU7A 3SI7A 2PO5A 4TV9B 1H4SA 1F4VA 1V25A 4AS1A 2ZRMA 1SU7A 4WW0A 3MXTA 4FMPA 4KL8S 1J4AA 3N76A 5CGZA 3RU7A 1A8HA 4MQ5A 1R64A 4C6TA 4EPTA 4PC2A 1JU9A 1YCFA 2R85A 2FN4A 2ZT5A 4EG1A 2GI4A 1DBVO 1EBBA 1L8LA 3P0JA 2I3BA 1RPNA 2PFKA 2YYAA 1XRQA 4HGQA 4IW3B 3ZOZA 2ERXA 2H4WA 3CVOA 3LLSA 5K0FA 3L0YA 3IAXA 4DXAA 1ZG3A 4HMQA 4BMCA 4D96A 2D00A 2Z43A 1QFSA 2YV1A 4N8DA 5JADA 3DKVA 1OI2A 4YT4A 3DL4A 4GP7A 4TXMA 2CF5A 1A5TA 2V7QA 5LQAA 3K5PA 2J4FA 3VMFA 5IULC 4J1TC 4RJLA 1QGED 1DIHA 1XI2A 3CUVA 5DSXA 5YASA 1VJ5A 4BZPA 4DYHA 1E98A 4CIVA 4D4KA 2O1EA 2NMVA 5KB3A 3K16A 5C3MA 1YRQA 4EBBA 2ZRKA 3OQMA 1Q1QA 4XAQA 3LI2A 2RGNC 1Y1PA 4RA9B 1ODSA 1OX6A 2YHSA 4MYDA 3ZWVA 2P8SA 4ZYVA 1AQNA 2C54A 4NENB 3DL7A 3W5JA 2JARA 4NPAA 4ER6A 2I99A 4IRXA 4PCAA 2FMHA 4P38A 1RYZA 2HAEA 2W6ID 3BT7A 4FFNA 1G0NA 2E21A 2H1VA 3H2SA 5E8RA 1ULSA 5IAEA 2EL7A 3K0AB 4CCYA 1YS2X 1V1MB 2AXNA 2N1MA 3L7AA 4MKRA 2EFCB 5CYGA 2ZKIA 5T7BA 1PZHA 2QR3A 4BX8A 3EPRA 3R9WA 5BYBA 2CWDA 3KUKA 4H08A 5AM3A 4IRMA 4OHMA 4TWBA 1JBEA 3HO6A 4RL4A 2A6PA 2GA9A 4HDCA 3TZCA 5AKZA 1WSWA 4C0SA 2GFHA 4NLLA 4CMIB 4DLLA 2QI9F 3BHMA 4DA9A 1YQWA 1DC8A 1WR8A 3L4BA 3E1SA 5CA1F 2V3WA 2PU5A 5SZIA 5DHQA 4EEKA 2J6BA 5TLSA 2Z5LA 3EZXA 1XU9A 3P96A 3S2GA 3NVMB 1JJ7A 1NTOA 3AERB 1RQNA 3MLAA 5EERA 5EN4A 1PJ3A 1NPYA 1OF1A 3QPDA 3RYFA 3IJ5A 1RAHA 5EINA 2BKEA 4KQ2A 2QRGA 4NEQA 2QY9A 7REQB 5ALTA 3O1LA 4J94A 2BBTA 2O5EA 4EF6A 4DADA 1EE1A 5A7HA 1EFHA 3GN2A 5EJGA 2CF6A 1DPFA 3TD9A 1K3UB 1NQOA 3FZYA 2Q1SA 3L7YA 4GICA 4OKNA 4AP9A 1OHHA 3U3OA 1ADCA 4IIFA 5LOVB 1CG6A 3EH2A 3OFVA 3JYQA 3D8TA 3QA3E 2RHWA 1SCKA 2QX8A 3BCHA 4BFLA 1QE5A 3HPRA 4FZ5A 5H3CA 3SHWA 3U60B 3PGXA 1D2EA 3AHCA 5EKSA 1OGIA 4JFRA 4B7AA 4BO4A 4D7AA 2O50A 3UMGA 3E9DA 2FN3A 1O6FA 4RORA 5K20A 1JLMA 3CVXA 1DQSA 3EGDB 2XCLA 4LYYA 2AFHE 1SCBA 1E9VA 3IMFA 3O93A 4KKXB 4U6QA 3DE1X 3OCCA 5GJVC 4PSUA 3E7PA 1O08A 2X76A 1IU9A 1M2WA 3DAHA 3Q3EA 4RBNA 1P60A 1UAAA 2A5FA 1E61A 2ZYUX 4GUDA 4QUJA 1GL7A 3NHBA 4QGFA 5AI8A 2C82A 2PLWA 1RXCA 1DXHA 2ONCA 2F64A 2Q3LA 2CNLA 3ZI7A 4O3FA 4RA6A 5HW0A 2B78A 2WU4A 1RRGA 2WYWA 3PGKA 4O3MA 1XTQA 4ZXPA 2XOXA 2JFFA 4RV9A 3TRDA 3H19A 4UNIA 1HURA 3NB0A 3OX4A 3P2YA 4H77A 1NUHA 4IQFA 4P92A 4Q9NA 3RO7A 5B5SA 2HK9A 2AJCA 4JBIA 4OM7A 1W5EA 1FNMA 2Q4DA 1EK6A 3HI6A 3AR9A 1DAPA 4BNXA 2Q45A 4JLKA 5EIFA 4B3DA 3ICWA 5DGIA 1GSHA 4DSUA 1NW3A 1SUDA 4BNDA 1EUCB 1R6VA 1MO6A 1F4PA 2DQZA 2AN9A 2ERCA 3ZD8A 3FY4A 4JP1A 2JBHA 2Q0HA 3MBOA 1GA4A 1SFRA 4UASA 4RF5A 1T8UA 4QXMA 4H7KA 4TKZA 1PWZA 2VDMB 3FMGA 4IKOA 2QNRA 4K9KA 5I4BA 2AE1A 3M6VA 3RBAA 4IH1A 3PC8C 3JS5A 3AESB 5FHQA 5DBIA 3DBLA 4ER0A 3V4SA 3VR6A 5KNDA 1AU9A 1JHMA 1GEEA 4E09A 1XLTC 1CJMA 1YGYA 2YCBA 4X1YA 4R7ZA 3T41A 4CLOB 2WSIA 4O2AA 2COKA 1N2IA 2W6IA 5FUWA 3ZVLA 1LBIA 2ZZMA 3CKMA 5K2MA 2ZRIA 2EBHX 3NATA 3V7UA 3WGNA 3BL5A 4IIYA 3SYMA 1EFUA 2WJIA 1AZWA 1GFZA 2I6GA 3EW9A 3IBSA 4G3XA 3CF0A 2D7JA 3KTFA 4NYJQ 3ZIAD 4HAZA 5LBTA 1U8TA 4EW6A 1KFKB 5KSYA 1VLHA 1AZLA 4OMDA 5TPZA 4HC4A 1ZK2A 4B4OA 4NE7A 1B1AA 1QMPA 2B1QA 1XKLA 4YO8A 2GFQA 5D6OA 1JRLA 3IBCA 2IS2A 2Q1XA 3DLTA 3ZDDA 1C3LA 4XX0A 2JLSA 3KUDA 4KMRA 4UDXX 1JDZA 2I87A 4NJOA 2HJSA 3B6ZA 3EQ2A 3K0KA 4TZKA 1IIRA 4GRAA 5BQOA 1J39A 3H5LA 2R1VA 4OYLA 1STOA 4WSOA 3IIMA 2YJTD 1JAZA 3ENVA 1GQ2A 3V7WA 2X2PA 4BJ5A 5L9AA 2C5LA 4C43A 5MFPA 1UC5B 3MFQA 3OIGA 1W88A 5BMVA 1JH8A 4RPJA 3I8XA 4BNIA 2FFHA 2VDUE 1OX4B 3NWOA 3VR2A 2IP4A 2WKQA 4DGQA 3VQTA 5K3EA 4X85A 5HPYB 4MVJE 4RZ3A 3NGXA 1H2ZA 2D59A 4ZT6A 2E7ZA 3O94A 4H3HB 1IN1A 3W3AD 3KQHA 3R4CA 3H6KA 1PG2A 4OJQA 2WWWA 3BWYA 1CR0A 2YW2A 4GP9A 4IUCS 3PQCA 1F8FA 3DXFA 4LC9A 2JJQA 2J5RA 4YYZA 4ZFNA 4B3RB 2HWUA 4Y1FA 3PHLA 5EL0A 5J4YA 4BPBA 2WA1A 2HRZA 4I1VA 5JYCA 1YNSA 3OPVA 4YYEA 3KQNA 1W36B 4MVJD 4M55A 5FPTA 3V1KA 1ZIXA 1TVEA 1LSJA 1W6UA