1M2OB

Crystal structure of the sec23-sar1 complex
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
167
structure length
164
Chain Sequence
GKLLFLGLDNAGKTTLLHMLKNDRLATLQPTWHPTSEELAIGNIKFTTFDLGGHIQARRLWKDYFPEVNGIVFLVDAADPERFDEARVELDALFNIAELKDVPFVILGNKIDAPNAVSEAELRSALGLLNTTGIEGQRPVEVFMCSVVMRNGYLEAFQWLSQYI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords protein transport protein SEC23
publication title Structure of the Sec23/24-Sar1 pre-budding complex of the COPII vesicle coat
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein transport/signaling protein
total genus 47
structure length 164
sequence length 167
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-06-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00025 Arf ADP-ribosylation factor family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1m2oB00
3SR0A 2JLQA 1X1RA 4PO9A 4D4JA 4OHYA 2RHMA 3KJGA 1VG8A 3M6AA 1R0YA 4TSFA 2AD1A 4JLJA 4NCHA 4PZYA 3ICEA 3BB3A 5DI9A 1P61B 2VF7A 3AF4A 3L0PA 1PLKA 2NTYC 3KQLA 2WKPA 1NG9A 3NEJA 3UATA 1G3RA 5L3QB 3GQBA 1TX4B 4W5WA 3THYA 2C8VA 5EUMA 4NH0A 3DDCA 4KU4A 5FUYA 2WKRA 3CNNA 4POAA 1F2UB 1P2TA 4D25A 3B1YA 4H9GA 3ND8A 2BKUA 3T1OA 2G0NA 1KY2A 2YWHA 2EWWA 1T5IA 4I1UA 3X2SA 4EKDA 4OQLA 2F1HA 1Z0DA 3DMDA 4KCGA 1JQJC 1GP2A 4A2QA 5A4JA 1CR1A 2V1UA 2XB4A 2G1KA 3MLEA 2JIZD 4M0LA 4OJQA 2KBFA 4WZ6A 5BQ5A 1NKSA 1G5RA 1GDDA 2FPMA 2AR7A 4Q4JB 4DSOA 3KUCA 1KI2A 4C7OA 1ZC3A 2YINC 1R6BX 3ZZ0A 2HF9A 1Z06A 3P27A 3SYNA 4NDZA 2IS6A 1N6KA 4RSGA 4WZAE 1CS4C 2X77A 4PHHA 3NH6A 3QI2A 3PJRA 3EZ2A 4BWYA 4TLAA 2Q6TA 2GESA 2ZRMA 4JZKA 2QSYA 1WBBA 5KSZA 2HJVA 4GMXA 1Q0UA 1NVXQ 2BM1A 3MMPA 2NPFA 1KI1A 2ZTSA 4G5OA 1X8LA 1YRAA 5FTNA 1P6XA 2AHOA 2RMKA 4XSGA 1G5TA 2PH1A 1QBKC 1E2HA 2WWGA 4HZUA 4MRSA 4RD2A 1UEIA 5FL7D 4BASA 5JI3E 2QAJA 2O0JA 3FFAA 4GFDA 1I4TD 4GOJA 3ASZA 4D4KA 2QBYA 1SHKA 4V02A 4E22A 2CCGA 3W9YA 2ZRIA 4ZI3A 1UBEA 2JJ2D 3CPEA 3FHOA 2WMOB 4M9ZA 1QDEA 1Z2CA 1ZIOA 4XVRA 2GZAA 4CEIB 3OESA 1G4AE 1C1YA 4ZCLA 1FFHA 3QSYA 4HSEA 1M1YE 1SVLA 4YMSA 5HE9A 1UAAA 4OK5A 3TW8B 1NVUQ 2Z83A 3GFTA 4JL6A 2OCAA 3TE6A 1ZINA 2W6ID 3C8UA 3UWOA 4MRPA 4AURA 2W83A 1ZNYA 2I4IA 3LH5A 2GCOB 2RGDA 3LXXA 1KNXA 2YNMA 2IK8A 721PA 4MA4A 3CNLA 2QROA 5BN5A 1KKMA 2GHIA 2IUTA 4E07A 3NG1A 4R9UC 2CCKA 3KZ1E 3PEUA 4WVFA 3U3JA 1WXQA 1E2JA 4RZ2A 1E9RA 1FL9A 3TQFA 3BBPA 1SVIA 3HU3A 1QHHA 3AVUA 4UNRA 1X3SA 3VR2A 2C03A 1UEJA 5SZJA 3JVVA 3ZVNA 4C0SA 4D0GA 3PUXA 1UM8A 5CJ2A 1M7GA 2WTUA 1CLUA 4JBWA 4C9BA 3QUSA 3VU9A 4EJSA 1G7SA 4JKYA 2DFLA 2H18A 1WBDA 1JPNA 3RHFA 4ZIRA 2ZXUA 1YJ5A 2W6IA 2FSHA 4JT4A 4Q9KA 5CLQA 2G0TA 3CX8A 4JVLA 1NY6A 5CLLA 1P4SA 4IRUB 3Q72A 3MWLA 1G64A 4B43A 4CIDA 2AKYA 1GIAA 4NCKA 4Q4HB 4F4JA 4QGGA 3OEED 1UKYA 1OXUA 4B74A 5KDDA 4LJ9A 1K6MA 1LB1B 1ESNA 2Q3FA 4KHZA 3THWA 2IS2A 1KK1A 1LF5A 4O2RA 2RGNA 2PZEA 1LVGA 1W4BA 2HCBA 1MABA 1O3YA 1GILA 1AM4D 3P26A 2Q9AA 1DG1G 4S2EA 2R2AA 2HEIA 2FGJA 2P6NA 1GL9B 1CJVC 2IT1A 1NSFA 4ZI2A 3QNUA 1DAEA 2IYYA 4B33A 5EUQB 4KLNA 2ZJ8A 1SXJC 1F6BA 1V43A 1E2KA 3DM9B 2ATXA 4DCTA 5E7IA 4K8OA 4Q7KA 1F48A 4OQMA 2IBMA 4ZV4A 5GJBA 2QTFA 2KWIA 3K8YA 2VL7A 2ZI6A 2ZREA 3K9NA 3O8BA 3SJAA 4FWTA 1R0XA 1N6IA 3AB3A 3E2IA 3OEEA 4TL7A 4A0GA 4EDHA 3N2EA 1GNRA 4MUAA 2Z0MA 1E1QA 1XD9A 1YRBA 3TGPA 2PX3A 1PJRA 2I3BA 1NI3A 3V4FA 4C0JA 1OXTA 3GLHE 2JLZA 3AVTA 1W44A 5M04A 1E32A 5FBWB 2ZS8A 4RCZA 2CHVA 4V0KA 3A1VA 4ESVA 4A36A 3NEYA 1LW7A 3J81k 3MD0A 3QVVA 5FOTA 1JNYA 5EQTA 5SZIA 1OKKD 4B73A 2N46A 2R9VA 1OFTA 4LJ7A 1E96A 2DY1A 4HAXA 4P4SB 3IO3A 2YOFA 4E03A 1LFDB 4O0MA 2G6BA 4DLUA 4Q7LA 1M8PA 2Q3HA 2XTMA 3PEVA 4QC2A 4DUGA 2AFIE 1E2IA 3OIYA 4IDQA 2GAAA 2IXFA 4MYTA 3LX5A 4Q4AA 4A92A 2JLUA 5CK4A 2ZUBA 4RVCA 1ZNWA 3IIMA 1G8HA 2O5VA 5KYKA 3TK1A 2JJ1D 4CW7A 2B7CA 3NVAA 3BGWA 3OZXA 4G3XA 4B2IA 5AJWA 3KQUA 4IOLA 3MAAC 5EZ5A 1GKYA 1Q44A 4P0TA 2QMHA 1DELA 3F3YA 2BOVA 3ZQ6A 1F2TA 2HDNB 2V8OA 4QM7A 3FKSD 1GG2A 4OHVA 1KO7A 2QAGB 5AR1A 1U8AA 3EPJA 1WQ1R 2GJ8A 1UBCA 3OIUA 4YMWA 1U0JA 4NZYA 1W0JA 2QT0A 4XD7D 3AVYA 4R2IA 3RABA 3IEUA 2W2XA 3VHLB 4NONA 1HH4A 2VEDA 5FH9A 1ONBA 3EIHA 3UWKA 1ZUHA 1XJCA 4FXPA 3EIEA 4Q19A 2OLKA 3L43A 2JJ2A 4L16A 4LYJA 4PHGA 2CHQA 3QOFA 1R8SA 2WWHA 4JL8A 2BJVA 4BZQA 5DHFA 3AF2A 5EXPA 1GWNA 3T06B 3M4YA 1XEXB 3K0FA 1CULC 4LDJA 4OBEA 1W1WA 3HU1A 3TJZA 1S2MA 1T4GA 2C9YA 4QHTA 1NMXA 4FN5A 3VAAA 3QF7A 3K9LA 2P67A 1FTSA 1NJGA 5FPYA 3K09A 4O25A 1Z28A 4EJSB 3KL4A 1BMFA 2P3SA 4BLPA 4WXRA 5AUOB 3R9WA 4ZO4A 5L3VA 5CYOA 3N70A 1VG9B 1OHHD 2IXGA 4LV8B 2DYKA 1BOFA 4TYPA 2VQSA 4Q1EA 2JLWA 3D31A 2GRJA 3ZLJA 4XVQA 2ZU0C 2BMJA 4UKDA 4BQSA 3A1SA 2CVHA 4LCBA 1R5OA 1GFIA 1Z0FA 5JHGB 4L8GA 1EGAA 521PA 2UZ3A 1XZQA 2JIZA 2CL6X 4M1KA 1MV5A 2I1VB 1XTSA 3C5HA 3T34A 1W4AA 2P5SA 3T35A 4D80A 2B21A 3M1IA 3DZDA 1JEDA 1LS6A 4MRVA 2ZANA 2YOHA 4PXAA 2BWJA 2AX4A 1G19A 1F5NA 4LJ8A 4X8LA 3ZH9B 4BFZA 2AK3A 1N6NA 1RE0A 2DPXA 1G7RA 4LYHA 3EZ9A 4B2PA 4KV9A 5B30A 1ZNXA 4MKGA 2HXSA 1M7HA 2HCJB 3BJIC 3QY0A 3PITA 2O0KA 1W2GA 2GBLA 1CKEA 2VSOA 2QL6A 5DI3A 1ZIPA 4DSNA 2HJGA 2A5FA 2PLFA 2N1BA 2ZJAA 4B2LA 4B76A 4URXR 1KI9A 4B3BA 1CJMA 3IBGA 2R6AA 1EWQA 1KJZA 3QJYA 4DLTA 4M9XA 1NMYA 4QOSA 3GJ8A 3TSWA 5DIFA 1OW3B 4NP6A 3PVSA 1T0HB 4PSAA 3VNUA 1KSJA 2ODWA 3KB1A 1NN0A 1U9IC 3ONWA 1IOZA 5FUWA 3RWMB 1N6LA 3B9QA 2QT1A 2R6FA 2XZPA 3KKMA 4LJ6A 3ZDQA 4WA7A 2Z4RA 3K1JA 1ZVQA 4LPKA 3FWYA 2PL3A 4B47A 4DBLC 5KDOA 4C2UA 3U6BA 1KDRA 5FPTA 2WSSA 3RRYA 3EARA 3JVUA 3LBNA 2GCOA 1AIPA 1EX6A 2CJWB 2IS1A 5FUVA 1GZSA 2J9RA 5DNYB 1WP9A 4JJKA 4Q48A 3PENA 2ZQ5A 4NYIR 4HAUA 3AKCA 3TMKA 3KUDA 4CT5A 1JECA 1RYHA 1E69A 3FPAA 2C98A 3O47A 5FOVA 2V6JA 3QPUA 1JR3A 1W49A 4XJXA 4Q9JA 1QHNA 1VCIA 2WJYA 1FZQA 5CJPA 3W90A 1LTQA 1E2MA 4X8OA 2OCYC 1J90A 1GNQA 2AFHE 3AP1A 4DLYA 4P3YA 4L9SA 3GLHB 4RZUA 3RC3A 4JIMA 5TV2A 4LUCA 3AGPA 4Z8XA 5JWRA 1OH8A 4EQ6A 3QKUA 1H8HD 1RRPA 3BERA 2J0UA 3L2OB 2BV3A 4NU0A 2CNWD 2J5XA 5BN4A 4UXIA 2ZE7A 1RKBA 2ZITA 3I32A 3W6NA 5JMTA 1P2SA 2QP3A 3EG5A 3T61A 2XNSA 4P4UA 121PA 2E87A 3VU9B 2XAUA 3WYAA 1QRAA 2OUKA 5DHAA 4EUNA 1E1RD 2FV8A 4LYFA 4XVUA 3MJRA 5FBVB 1Z6AA 4AD8A 4TYQA 3QF4A 4BE7B 3TVTA 4WBSA 2QP9X 2OAQ1 5JJKA 4LX0A 1NJFA 1TEXA 2ZRCA 1LV7A 1R4AA 1UPTA 3R8CA 3MFYA 4DWJA 2NMVA 3K0AA 5LDDC 3NDPA 5IRCD 1NRJB 1IQPA 3W8NA 1OYWA 2YC4C 4RCYA 1W7AA 1X1SA 5KNDA 3LY5A 3UG6A 1IY2A 3GLGB 2ZJBA 5JS7A 2PX0A 4DIDA 2BVNA 2ZRAA 3ZQJA 1PZNA 4JKIA 1XPOA 2PBRA 2ZRGA 4ON9A 5FUXA 1SKYE 2XOKD 4ZKEA 2C5LA 1EFRD 1U2RA 2ZYUX 1ZM2A 4YDSA 3RS3A 3KFVA 1IN6A 4C7OB 2B8TA 3AQ4A 4AYWA 4LBYA 3EPHA 3QKRA 4N0EA 5KOYA 4AYXA 3KFXA 1VIYA 2HYDA 3TNFA 2B7BA 5TY0A 3LBIA 4B3DA 2Z43A 2ZVPX 2VHJA 4HUQB 4IEIA 5J4VA 4TWZA 3CIOA 5CB8A 1KSGA 1ZMXA 3AVXA 2IHYA 1PUJA 2O8EA 1GOTA 1D9ZA 5DO9A 3QKSA 4NCIA 1SKQA 1E98A 1Q3HA 1TQDA 2VP2A 2F55A 2XTZA 3AVWA 5FPKA 1XPUA 1XD2B 3DL0A 1NBMA 4LV6A 2CLSA 4FCTA 3VR6A 1P9NA 2ZE8A 2GJ9A 1S3SA 3CH4B 3O8CA 3W34A 4TLBA 4RFSB 3TSOA 4BLSA 4C0LA 5LPNA 3ECCA 4TMWA 1CP2A 2D4HA 2R6GA 1DO0A 4AY2A 4ITRC 1E2DA 2AK2A 1DOAA 1F3OA 1YU9A 1ZU5A 2BBWA 2HV8A 2OXRA 2PJZA 2XJ9A 3GJ4A 3QXSA 5CIWA 4M8NE 1P72A 1Z8FA 2IYTA 4PHTA 2H8KA 3B82A 1JAHA 4URUR 1XTJA 4UNSA 3QENA 1AQUA 4MYCA 4DJTA 1IXRC 4QBIA 2JLYA 2ZIAA 5LB4A 4ABYA 5CM9C 2LCFA 1N6RA 1T0JB 4MYUA 5J40A 3A1UA 3SYLA 2J3EA 2QMOA 1AKEA 2VHCA 3U7HB 2CK3D 2W0SA 4QKQA 3TLXA 2AXPA 1K5DA 3ETLA 1SVMA 4MQBA 3CWQA 3I8SA 4IDHA 2BEJA 1XMJA 3RYTC 1Z6GA 4DCUA 1TTTA 1R7RA 4PAMA 1Q20A 1KK3A 2J0UB 2GZDA 2J7PA 1TMKA 1OIVA 2GVZC 3CBQA 1E2LA 3T1TA 2A5DA 2A7QA 4NCNA 3CUEF 3V9PA 3B1XA 3Q5DA 2AWNA 5LB2A 2OM2A 2AXNA 3E1SA 2XSZA 4D82A 1ODFA 1CRQA 1XU4A 4AKIA 1KO8A 3DOFA 2BKEA 1L4YA 3LX8A 1OF1A 3BXZA 4IEEA 2O8CB 1E0SA 3D6TB 4DSUA 1BYUA 1MT0A 3TAUA 2H17A 5L3QA 3VNVA 4Q5IA 2QPTA 4LY6A 2JLSA 5EP1A 4RKEA 3LBHA 2XZOA 4A6PA 4QBHA 4DRZA 4A82A 1NKTA 2ZS7A 3Q5EA 3THWB 2IYUA 4NMMA 1UF9A 1YKSA 1W4RA 1W36B 3QQ5A 1XJ0A 3EA5A 4Q4JA 3ZIAD 2PCJA 3GP8A 4ZDKA 3THYB 2F43B 1SZPA 1VDZA 3B1VA 4LJAA 2QPAA 3EC1A 1R2QA 2H16A 3CO5A 5HCNA 2JLRA 1JR6A 3D8BA 3GLGA 1DAKA 4GRAA 1FP6A 1UBFA 2IYLD 2VYFA 2Z5FA 4TYYA 3T1VA 1YR6A 2IF0A 4JLPA 3OE7A 4ZPXA 4B71A 4G5QA 2CCJA 3IIKA 4TMVA 5FTJA 3I61A 1ZM4A 1XP8A 3GLIA 1KMHB 1CJUC 3W6PA 3PFIA 5BYJA 3WMEA 1D2EA 2BM0A 5EE0A 3QKRB 3RS0A 1II9A 1SULA 1OIWA 3B78A 2NO1A 2GJAA 3UK6A 2WWWA 4TL8A 1WF3A 4KITB 1G8PA 2ECKA 3W5JA 3A6PC 1NIJA 2GXQA 3ZGXA 4AKEA 1YR9A 2FA9A 1G4UR 4ZKDA 3EX7C 1MKYA 3DMNA 2O8EB 3KB2A 2F3TA 1H8ED 2HUPA 4DCNA 2VP5A 3SE0A 1QG2A 3QBTA 1VG0B 4TTQA 2OBLA 3BOSA 1G8YA 3CNOA 2XX3A 5BYKA 1Q1QA 1ANKA 4MGKR 1G21E 4H1UA 2ZRPA 3GLIE 4OL0A 2J0VA 1AJEA 1ZUNB 4IVPA 4ZDWA 4XWOA 1Z6XA 2OT3B 4XOIA 1P3JA 4HLUC 2G3YA 2XOKA 4M1MA 1T8UA 4C0BA 2ZYVX 2FFBA 5EXSA 3K70C 4HUTA 3Q9LA 5EP2A 4D81A 5IDVA 1QHGA 2R8RA 5CDFE 3KXIA 4I99A 2JDIA 2QPOA 1TQ2A 4Y0VA 2ZSAA 2GK7A 1UKZA 2YWGA 3FB4A 1EK0A 4LYAA 4MGYR 1G3UA 2OCBA 4CVNA 2FWRA 4IDNA 2BCJQ 2ZR0A 3EWAA 1QVAA 1J2JA 4KFTA 2VP4A 5SZKB 3BRWD 1KK0A 2JLVA 2W2VA 2EU8A 3RWOA 1KI3A 4I1OA 1W46A 2ODBA 4Z54A 3QEJA 4Z1MD 4NYMQ 1E1RA 5F98A 3OAAD 1FX0B 1KZGB 1X8KA 3B9PA 1KZ7B 2C04A 4WIAA 4CEJB 3L82B 4BLOA 4URZR 2KJQA 3HJNA 4JYCA 1ZP6A 2V6IA 4M53A 3OIWA 2DBYA 2QAGC 3RSOA 4A0RA 2SHKA 4KSCA 2BJWA 1FNMA 4DEXA 5JECA 4EPYA 1IN5A 1MABB 2XTNA 2IL1A 2OG2A 3AF3A 1YZUA 2EQBA 4BFYA 3TH5A 2ODEA 5JEDA 2C99A 2DWOA 2PZFA 3GPLA 3CR7A 2D2FA 2XJ4A 2ATVA 4I4LA 3MGCA 4LRWA 2NGRA 2RHDA 2FEMA 1MOZA 2MSDB 5CYPA 5KNCA 1E0KA 3QPWA 4U7DA 4DIEA 2WJVA 5FR1A 2V7QD 3BFKA 3C7KA 4M9QA 4DXAA 1AKYA 3DVLA 1EXMA 1VCOA 2GEUA 4I1SA 3CPHA 3A4MA 3PUYA 4JT2A 1RIFA 2RGGA 3JZMA 3QXCA 3KKOA 5FI1B 3T1QA 1RW4A 1P2UA 1CF4A 3M0EA 1XMVA 3MG9A 1SXJE 2YV5A 2W6JD 5IK2D 2ZJ2A 3AF0A 3FTQA 4M1WA 2G9NA 3QG5A 3EASA 2QMUA 4EPRA 1FTNA 2QN6A 3LDAA 1I4LD 3GMTA 3SEAA 1VIAA 3IBYA 3CPJB 2GKSA 3THXA 2O8BB 4DVGA 4PQYA 1G3QA 1UKVY 1XEFA 5ELXA 2ZE6A 1E99A 1L8QA 2D06A 5LBIA 1IY1A 1GM5A 4JVMA 1GL6A 1XX6A 1N6HA 2EVWX 4TQAA 1OXXK 2WJHA 3T15A 1E4YA 4BPBA 1G6OA 2QM8A 3NHBA 5B64A 2GDJA 4GMDA 1GRQA 2WOJA 3OF5A 2FEOA 2QQ0A 1Q57A 4NYJR 4LHYA 1EESA 2BHRA 4CRWB 4JYBA 1D9XA 2OO7A 4ZCMA 3VQTA 1FW6A 3V00A 1NN5A 3KKQA 1KHTA 3N5CA 4KFSA 4QG7A 1AS2A 4UXHA 1TAGA 4GT1A 2JATA 2FSIA 3SBEA 1KJWA 2LKCA 3B6EA 4P4TA 2H92A 3TQCA 5JBQA 2PMKA 4UJ3A 5E3HA 4LHZA 4TMTA 4N3NA 1IXZA 4RD0A 4OQNA 2GBLC 4X8MA 3L0SA 3WP0A 5F9FA 2PT7A 2IF2A 3PR1A 3O8RA 4RFSA 1N0UA 3WMGA 4OHZA 2B92A 2Q0HA 4P31A 5CB6A 1JEEA 2NG1A 3DEFA 2QU8A 3ADBA 2ANCA 5HR5A 2LKDA 1CU1A 2XEXA 1HE8B 2IEZA 2ZRKA 3BE4A 4UQOA 5F3WB 3H84A 1E0AA 4TZ6A 2ZI3A 5FFMA 2B6HA 3W3AA 4PANA 3GJ7A 2DWPA 2OAP1 2REOA 1UDWA 2P6RA 3FMIA 2CLDX 3I8XA 4KYIB 4O3MA 3B7GA 3AM1A 1GKIA 3R8FA 1XNJA 1U9IA 1Y3AA 4UJ5A 1ZJ6A 3FHTA 4TLCA 4OKSA 1AQYA 2PT5A 3MWYW 3RS7A 4DCVA 1F2TB 4DEYA 5C2JB 5EE1A 1TL7C 2EYQA 3UANA 4A8JA 1MRNA 3Q7PA 1N0WA 1W48A 1HEIA 4GPTA 3VR4A 5KSYA 4DT1A 3IGFA 4XIGS 1D8TA 1FUUA 2IYXA 4R2HA 8OHMA 1N6PA 5K8TA 1ZM3A 4FMCF 2PZGA 4AG6A 2O8CA 2ZRJA 4OK3A 4EFNA 2GETA 1EFRA 3SQWA 1KGDA 4DB2A 2OESA 4OQXA 3K53A 4C3ZA 3WHLA 4G5RA 1SVSA 4ILEA 3K9GA 3L0IB 3HU2A 4EIWA 1EFHA 1HQCA 2KBEA 3GJ6A 3P20A 4F38A 3P32A 5DE3A 1US8B 3NXSA 1P5ZB 5GVRA 4DLWA 5BWMA 1ZM7A 2X1VA 3R9XA 2IUSA 1G6HA 2UZIR 3A58B 3LA6A 2DHRA 2QQEA 3TIFA 5JCPA 3ND9A 1Z6TA 4NYIQ 1NLFA 1ZD1A 4HLQB 3VMFA 1QVRA 2P5TB 4FMCB 3GFPA 3WYGA 4GI7A 4URVR 4BLRA 4HDQB 4D4LA 2XXAB 1Z29A 2I1QA 4IOMA 1RZ3A 4Z8YA 1T3HA 221PA 4RD3A 2VSXA 1XTKA 1YVDA 5AK0A 1FUKA 1K8RA 5H70A 5KDLA 3U61B 2A3RA 2F3RA 1SVWA 5EXTA 2R65A 4NKRA 3NC1C 2NPIA 5CITA 4Y0AA 2C78A 2O52A 3ZS8A 1CRPA 1IONA 3AKDA 2CE7A 4K46A 3BFXA 5JRZA 2GF0A 1WB9A 1I4DD 2QE7D 4FMDF 4DB4A 2IWRA 3THOA 1UFQA 4NL4H 1U90A 2RGEA 3RVBA 4EPWA 2V4ZA 2WVJA 2H57A 2CXXA 2WWIA 4MRNA 4MDEA 5A5GA 2IWHA 2CNWA 5HTKA 2O8FA 2RH5A 1M6NA 1RJ9B 4PSKA 1DPFA 4JVSB 2WPDA 2FGKA 4QJ3A 3ADCA 2O8BA 4H1VA 5E95A 1XXHE 4S35A 1RVDA 4D6PA 4JL5A 4N1AA 3OIVA 1P9WA 3T5DA 4U02A 3FYHA 2OFXA 4Z51A 4ZCIA 3F5FA 1KDTA 4W5JA 1HUQA 4XTRA 3RANA 1MO3A 5KPJA 3P4XA 4ZDJA 2OCPA 1KI4A 3KKPA 5FTMA 1S96A 3CF2A 4AKHA 3IILA 2GJKA 4MYHA 1OKKA 5FTLA 4XSHA 5DLQC 2QRNA 2ZEJA 1Q1BA 1G18A 4B44A 1R10A 3UKDA 4QM6A 2ZR9A 4NHOA 3PUVA 1KAGA 2FMXA 3R7WB 3CB4A 1PVOA 3I5XA 1IN4A 4OQFA 1ZBDA 1S0UA 1Q3TA 2BEKA 1KO4A 4HLDA 4KO8A 1BYIA 5G40A 2YZ2A 3WP1B 4HAYA 2Q21A 2WICA 4A2PA 5JCZA 1DE0A 1T91A 1CTQA 1G3IA 2IEYA 3BB1A 4HAWA 5FPSA 3P1JA 2XGJA 2CE2X 1RC8A 5JI2E 4G5GA 2G77B 3N2IA 1T8TA 4QJ4A 1OXSC 2P6UA 3CZQA 1TU3A 4PSVA 5FR2A 3LVQE 4TYNA 3SC3A 5EXXA 1AGRA 1S9DA 3GLFB 4Q4LA 3HP1A 4DDUA 3KJEA 1E2EA 2H1LA 2XITA 4NYJQ 2ZRLA 4MDFA 2IYWA 1JALA 1KDOA 2J41A 3TBKA 5P21A 4TMXA 4MKFA 3E5HA 4U00A 5GADl 1GTVA 1XTIA 3FMFA 1DAMA 5FOWA 2V1XA 2G83A 3K70D 1DADA 4TN1A 2ZYTX 2OBMA 2GF9A 4LZZA 1TF7A 4XWKA 3SNHA 5E7JA 1QF9A 3BORA 2RB4A 3LXRA 4CEHB 3BH0A 2GJSA 1VYTA 3DKPA 3ADDA 3TRFA 4BRWA 1O87A 3SOPA 1XEWX 3EW9A 2CL7X 5HKKD 2QI9C 2QZ4A 1GL7A 1OFUX 2WM9B 4R98A 3GLHA 1II8B 3K0CC 4L4UA 1W47A 3UXMA 3G5UA 4KJZA 1NNEA 1SXJA 4DKXA 4A0HA 4CEJA 1C4OA 3AVPA 4P33A 3REGA 3PV0A 4HI0E 3K0AB 1BKDR 4R7ZA 3PXGA 1G9XA 3K9HA 4IFBA 3SDZA 5K8UA 4AI6A 1KKLA 2X2EA 1COWA 3EPKA 3VTKA 3U4QB 2OFOA 1JXMA 3AUXA 4LSGA 3ZJYA 4KFRA 1KSHA 5J4LA 1IJFA 5JS8A 5GVSA 1Z08A 3HYTA 2REXB 1ESMA 2QMEA 1NVVR 2ZE5A 3PQCA 3VFDA 3WYFA 4YQFA 2QGNA 4LBZA 4YXWA 2ZUCA 3UMRA 4OI2A 3SHFA 3QF4B 2FF7A 2VF8A 2V9PA 3AV0B 2GVDC 4BFXA 2W2TA 4LJ5A 4W7SA 4DSTA 5H8WA 4U5XA 2GEDA 2J87A 4KVGA 4W9MC 4FWIB 3A4NA 1BMFD 3WNBA 4LC0A 5KSPA 1ZC4A 4MGIR 3SHWA 821PA 3W8RA 1RRGA 1Z22A 1OLOA 1GSIA 4JBYA 4L15A 2DWQA 1Q1ZA 3DPUA 3SFZA 4D0NA 2YKGA 1JXOA 3BH7A 4M22A 2WWFA 3SFVA 3UG7A 4B75A 4PPGA 2ZJYA 4TYWA 2IYSA 2ZI9A 3KDSE 1M74A 2F9MA 5KNBA 2D3WA 1KIMA 1D2MA 1TPZA 1Z63A 2RGBA 3LRPA 3OHMA 2JA1A 5J4HA 1JB1A 1TQ4A 1XMIA 2ZJ5A 1G5PA 3SS8A 5JWHA 1I2MA 1G291 3NC0C 4G01B 1GITA 5JRJA 2QY9A 2WWXA 3QKSB 4F91B 2PEZA 1PUIA 4EAQA 2ZS9A 1TEVA 4TLDA 5LD2C 5TARA 2FOLA 5TB5A 2EW1A 1MH1A 5D3MA 1XRJA 3E70C 3KTAA 2O8DB 1MRSA 1PLJA 3OAAA 4YMUA 2DFKB 3U60B 3MWJA 2IYQA 3A36A 4LBVA 4N0DA 1W5TA 1YE8A 2Z6VA 4M1TA 1WMSA 1R5BA 3BK7A 4PC3A 4JSTA 2DCUA 1YQTA 4IOKA 1G8FA 3KKNA 3QXXA 5AUQA 3CLVA 621PA 4OYHA 4BFTA 5EE5B 4XTCS 2C77A 1OFHA 1KI6B 4DUGD 4JVNA 3KQNA 2YWEA 1COWD 3WNCA 4A8JB 1MO4A 3QIAA 3I5YA 1N2CE 4C4PA 1CIPA 2MMCA 4KI0A 5KU1A 3O8DA 4QFMA 2ZM5A 1FOEB 1SXJD 1YZTA 4HB2A 1DAHA 2JDID 1E2FA 1AN0A 1XCMA 1A2BA 1V5WA 4GOXA 5EE3A 1XWIA 1CR4A 2ZAOA 2WZQA 3I3SR 1N5JA 3QKTA 3FDIA 4CZ2A 5H68A 1TADA 4EPXA 1DAGA 4K81B 3KXLA 4XWAA 3WHKA 2HLDA 1ZCAA 1G7CA 5J5CA 3RDPA 3PG5A 5EE9A 1U8ZA 4TT3D 2KB0A 5HZHA 2GA8A 5JJIA 2E1RA 3NIBA 3VKGA 4NPHA 1P2VA 3ZD7A 4BEBA 1JQLB 1E2QA 2VIIA 2V55B 3KXKA 5KTYA 2CEAA 1XTQA 4UNNA 5KSOA 1W0KD 3DZ8A 2WJIA 3R9IA 2W58A 4JSYA 1OB5A 3X1YA 4CDGA 5L3SB 4NCJA 4Q7MB 2Q3MA 2G1JA 2V54A 3BS4A 4FCWA 5DYIA 1GAJA 4FINA 3X1DA 1SQ5A 4ARZB 1TUIA 4KLZA 3MCAA 4YMVA 4BUJA 3SJCA 5A0FA 1A7JA 3VHXA 2JASA 3FMPB 4L9WA 2XXAA 3TUJC 4V0NA 3CONA 3UIEA 1ZM9A 1DAFA 3TR5A 1KMHA 4ACBA 3H2YA 2WJJA 4P32A 2ZSBA 2XSZD 1J7KA 1A2KC 2ZRDA 3OE7D 2OFWA 2YYZA 2Z4SA 3CF6R 4GL2A 1KNQA 4EJSC 4F4CA 2X8AA 1SHZA 2WAYA 4URYR 3UPUA 5K8IA 2EFCB 4QJ5A 1RPZA 5TXGA 2J7PD 3EC2A 4YXWD 4LPSA 4CYMA 5FBQB 2F43A 1J99A 1NN1A 5BXQC 1FMJA 2QGZA 2PCLA 2CVFA 1YR8A 2F7SA 3AKEA 3LAWA 3MRSA 3CRMA 1MO5A 2TMKA 2X2FA 4Q9LA 3ZYCA 5C4GB 2A5GA 4MITA 1YHNA 2GK6A 4MUBA 4IXMA 4WAUA 2VPPA 1NY5A 5L8VA 3WBKA 1G7TA 1KI8A 2WPDD 2VO1A 1XMSA 4G0NA 3S1AB 3GLIB 2WHXA 2VA8A 1Z0IA 3PCRB 1HTWA 2ZSFA 2ZU6A 4PHFA 2RGNC 1FQKA 5B58C 2OILA 3SQXA 4LV5B 3W5IA 2OBNA 1ZUIA 4NE2A 3NKVA 5CDFA 4F92B 1XDBA 4OK6A 2OZEA 1JR3E 4BFUA 5HPYB 1D2NA 3RLFA 4YDHB 4FIDA 2D7CA 2J59A 2QRZA 1N0VC 4QBGB 2CHGA 2ZJOA 2FFAA 3GLFA 3EAQA 4QHSA 5FOUA 2BC9A 1OH5A 1E9BA 5JJLA 3ZD6A 1FQJA 5AUPB 3HPRA 1EFCA 4JLBA 3AUYA 3ZZTA 4DLSA 2QEQA 1C9KA 3CH5A 4QGHA 1YZGA 4YMTA 2OEPA 2R6CA 4Q66C 3K0EA 1KY3A 4TMKA 4A1FA 2BCGY 5KUTA 2GXUA 3IHLA 1VHTA 4PPFA 4JS0A 2ZPTX 4YC7A 1EWRA 4AG5A 4FCVA 1UADA 5FL7A 2IYZA 2ZRNA 4UNQA 1S9HA 1QHSA 3OEHA 3MSXA 3AVVA 5JHHB 3LW7A 4PC7A 4DC9A 1IHUA 4LHVA 5AUNB 1YZQA 1Z07A 1FX0A 2NZJA 421PA 1XF9A 4NBSA 4HAZA 5CM8B 4PQRA 4PQFA 1AS0A 5G3YA 4A6XA 3LLUA 4KFUA 2VHUA 4KBFA 5GJCA 2EYUA 5JWOA 2EFDB 3NDBB 3TSZA 1TF5A 2ZRHA 4B35A 4OHWA 1L4UA 1R0ZA 2BBTA 3X1XA 1XCGB 3AH8A 4PZLA 1G41A 2ZROA 3U3RA 4MKIA 3FOZA 2AWOA 1BIFA 1DAIA 4E5UA 1NL3A 3VR1A 5FBRB 1TU4A 2DFTA 4WOPA 3GLGE 4F7WA 4TTPA 5K8LA 2Q9BA 4ASUD 2NO9A 1IN8A 1SXJB 2A2ZA 2OLJA 1U0LA 1TQ6A 1A82A 2ZR7A 5JSZB 2FN4A 4Q7JB 4ASUA 4V0ME 4HDCA 4I1VA 3HPQA 2DFNA 1OPXA 3T5GA 2DR3A 3I1FA 4B48A 3ZS9A 4DLRA 4PAQA 1N5LA 1KYIA 3CM0A 3GEIA 3MWKA 3TKLA 1S3GA 3LV8A 3NBYC 4WXPA 3U4QA 5JFGA 4Q02A 2VBCA 3WRYC 4M9SA 1W4CA 3IDQA 4US2R 2ZAMA 3AP3A 3L8YA 3IQXA 4FW9A 2FH5B 2A78A 3C14C 3IHWA 1RYFA 2P65A 3H4MA 4PC1A 4AYTA 3RNLA 2GNOA 4BLQA 3RC8A 5AWFC 4KSBA 1IY0A 5GJWC 1NLYA 1R5NA 3ZZUA 1GRRA 3K09C 4A15A 2RGAA 2PMDA 5AJXA 4OI1A 3X1ZA 3LLMA 2NQ2C 2VP0A 4B3CA 2CL0X 4RD4A 1W36C 1II0A 5E4FA 1NIPA 5HZKA 1M34E 5J4KA 1HQYE 1KO1A 4RJLA 1XB2A 1ZAKA 3ASYA 3DM5A 1EX7A 3Q3JB 1VECA 1J70A 4C30A 1GKUB 1EFTA 2ERYA 2QG6A 1DTSA 1IM2A 1P7CA 2P2LA 3FKQA 4NTZA 5D3MB 2W00A 2HT1A 4KBGA 3GD7A 1ZU4A 4JLKA 4MGZR 2RAPA 4JLMA 5UKDA 3CX6A 3UMSA 1D6JA 4FI3C 4HEJA 1NG1A 2D74A 4UXJA 4DCSA 1DARA 1GVNB 1F60A 1QG4A 2J7KA 4A4DA 5G53C 5BN3A 2Y8EA 3GEEA 1IXSB 1E2PA 4IOJA 4CEIA 3DKVA 1J8YF 2NZ8A 3EZFA 5L3RA 2BBSA 5EZ6B 3ZVMA 2VHQA 1E94E 1N25A 2V7QA 4KXFB 1VMAA 3GJXC 4IXNA 2HXYA 4Q9HA 2WSSD 1QHYA 1AZSC 2FNAA 1DO2A 1E9AA 4B6FA 1JJ7A 1ZW6A 5SZHB 1XXHA 3FGNA 3GJ5A 3SN6A 5J47A 4MH0R 1ZRHA 1EG7A 4RKFA 4HZUB 4GNKA 4WZBE 5IF9A 4LGMA 2EFEB 2PEYA 4JMPA 2ONKA 2KI5A 2QNRA 3HDTA 1YZKA 5DN6D 3PUZA 1ELOA 1FPMA 4US1R 1FNNA 1NF3A 4BZXA 1S1CA 4HLCA 2BDTA 3QXJA 1KI7A 2ZJZA 1JR3D 2FPLA 2BMDA 3NWJA 4X8HA 1KTVA 1QHHB 3T12A 3RS4A 1AA9A 4TT3A 4LOAA 2IYRA 4TL9A 3U3OA 3ZVRA 2NOAA 4A9AA 1IJEA 1P75A 3LQRA 4M2LA 2VSFA 1JBKA 4IW3B 4ACAA 2RGXA 2WIBA 1BS1A 4CEHA 1E79D 1JI0A 2NO0A 1U0HC 2R6DA 4RFVA 1NN3A 1HT1E 3W3ZB 3ADKA 4BFWA 1Z47A 2QUZA 1QZXA 4DT1B 3QG1A 1WA5A 1LS1A 1NSTA 2XNDD 4DHEA 2JJ8A 3U44B 3CRRA 1G20E 1EFUA 5FI0B 1QHXA 3V4RA 2FX3A 4Q1DA 1WE2A 4GP7A 4II7A 2OV2A 1TNDA 4UNPA 3SI7A 4TMZA 1KOFA 1W0KA 4TLEA 5AJYA 3CWZA 4C2TA 3LWNA 1P60A 5KPDA 4AWXA 2ANBA 2A5JA 1P73A 4Q01A 4Q00A 3LNCA 1OIXA 4V0MA 3G0HA 4TL6A 4LBWA 5B57C 1K5GA 3LVRE 2C9CA 4M4SA 1GRNA 2ORIA 1FMLA 3KX2A 5DYGA 4BRUA 4HB4A 5J4YA 4GSYA 1U94A 1U98A 3U3MA 2WSMA 2HLDD 4PPQA 1Q22A 4DZZA 2XZLA 2JLXA 3Q85A 1US8A 1F2UA 5JLJA 4IVQA 2R62A 5F9HA 2DB3A 3MJHA 4KVAA 2ONJA 1NLZA 3B5JA 4IHQA 3TVDA 2RKOA 3A1WA 2ZYWX 4YLGA 2ZRFA 4C0HA 3MUFA 3LO5A 1RFLA 4PX9A 2Q9CA 1S1MA 3NH9A 1VKJA 1SVKA 1H8EA 1KDPA 2IXEA 2OHFA 2WWYA 2FFHA 3S1AA 2ZSDA 1S4QA 3LW8A 5KO2A 3RSLA 2VP6A 4JBXA 4HUQA 1TF2A 4B34A 1LNZA 3B1WA 2KE5A 2WIAA 1X86B 4LI0A 3D7MA 4C0KA 5TMPA 5FOXA 3ICQB 1AS3A 3DHWC 4FD2A 4HLUA 3QE0A 4HATA 3R7WA 2BIFA 3AF1A 2HT6A 1M2OB 2A9KA 2WJGA 3CR8A 1Z5ZA 4JJZA 1W0JD 1U8YA 4M1YA 3WRXC 4D26A 3AVOA 3GCGA 2CMKA 3C41J 3TR0A 2F1JA 2O8FB 1E2GA 1RJ9A 3EIQA 2REBA 1W5SA 4LHXA 3AGQA 1WCV1 3U6KA 4LHWA 1E2NA 1A5TA 3R20A 1XJQA 2JEOA 4AKGA 2E9SA 1NBME 3ZVLA 2NIPA 4GZLA 3SJBA 1A1VA 1DBSA 1PV4A 3OFNA 2V3CC 1MO6A 3NBFA 1E9DA 1UJ2A 4RD6A 4DDTA 3A37A 3C15C 3FMOB 4TTRA 2JJ1A 2YWFA 5E7MA 4BLTA 3TAHA 3DOEA 3RS2A 1SVOA 1Z6YA 4FMDB 2F9LA 1G17A 3IQWA 4OHXA 3NHAA 1UKEA 2AL7A 1R8QA 1KK2A 1OH6A 4Q18A 3HR7A 4V0LA 4XD7A 2J0QA 3B13B 1GUAA 3L0OA 1IN7A 5CK5A 2QTHA 4AIIA 2IS4A 2K5UA 2QAGA 4BFSA 2FZLA 3CW2A 5DGXA 1X8JA 5DH9A 2ORWA 3H1TA 1H65A 4MKHA 3FKSA 5TVKA 2QTVB 4RZXA 1KMQA 2ZI5A 1GNPA 1XEXA 1JAIA 3H0KA 1YZLA 5HKKA 3KQHA 2VTKA 1NP6A 2A30A 1CR2A 2JGNA 3SU8A 4EFLA 5C1BA 1QHIA 2C96A 2D2EA 2BMEA 2YJTD 4Q1BA 3EZ6A 1N5IA 1Z3IX 3HR8A 1G16A 1LY1A 2YVUA 3U7EB 3K0FB 4US0R 5FL3A 1L2TA 1T3SA 1CR0A 2ASEA 5C4MA 3RRMA 2ZVQX 1Y63A 5LD2B 2GXSA 2CDNA 2CK3A 2L0XA 2QENA 2QSZA 2UKDA 1SKYB 2HYIC 3VX3A 1JJVA 5H1YA 1Z0AA 3TW4A 2ZRBA 3A1TA 5TDHA 1UBGA 3B1ZA 5EP4A 3I73A 5JSZA 1II8A 1Z0JA 2BBOA 2XNDA 1L7VC 4KAXA 4QL3A 3TUIC 3VKWA 4TQ9A 2ZSEA 5GJVC 4PR0A 4Q4HA 2FJUA 2IYVA 4IKEA 4IJMA 2C95A 4URWR 2AN9A 1DG3A 3B60A 1E1QD 2PLRA 3Q7QA 1G1MA 1E9EA 1U81A 4JLNA 3RRZA 2AD5A 4D2IA 3U7FB 3GJ0A 1E9FA 1D5CA 4BEJA 1J8MF 1OYYA 3BIFA 1JPJA 4PFSA 1KSFX 1AGPA 3IIJA 3VX4A 1XZPA 2IA5A 4HAVA 4Q1AA 3F8TA 3JZAA 1IBRA 1R0WA 4KYUA 3FFBA 4LJYA 1XD8A 3ZIAA 1A4RA 5DN6A 2FZ4A 1B0UA 1KJYA 3SYKA 3I72A 1XEWY 3WMFA 4I81A 4JLAA 2J45A 3AKYA 4B3GA 3LQQA 1E9CA 1E6CA 3GLFE 4O2LA 5C46F 2HF8A 5DSZA 2MMGA 3QEOA 4BFVA 4LC1A 2B8WA 4HDOB 1ZCBA 2QP4A 3CRVA 1ZNZA 2OE2A 3FHCB 1NMZA 2GILA 2QE7A 3AVQA 3IKJA 4V0OA 1IAQA 4PZZA 3THXB 4PO1A 2FG5A 3P4YA 3I4LA 4HZIA 2OSBA 1NVWQ 5EJEA 2C2HA 4P4SA 1P62B 2AKAB 4OI0A 4QHYA 4QGAA 4GDFA 2FU5C 4QRHA 3A4LA 4C0AC 4Q03A 1VTKA 5F2EA 4A8JC 4BECA 1DEKA 2R44A 1KAOA 1XCPA 1OFIA 1M7BA 1XTRA 4D4MA 3KQKA 2GWHA 4PC2A 2EFGA 4QNRA 2F1IA 4QGFA 5ANRB 1B23P 3C16C 3NTUA 3D3QA 4CF7A 2BMFA 1XXHB 4HB0A 4NYMR 3BWDD 4IVRA 2J1LA 4PPNA 1AK2A 3KTAB 5JEEA 4HB3A 1DVRA 5FOSA 2O8DA 2QBYB 4A2WA 3I92A 3OFND 1LF0A 1VYUA 1YZNA 4KODA 2QA5A 1CXZA 2IUUA 4Q1FA 5B2ZA 1MR3F 3X1WA 1RRFA 5BW8A 2GZHA 1P9RA 1WDTA 3CZPA 1DS6A 1Q1EA 3U44A 3EPLA 1I2DA 3IPXA 4Q9IA 3C4JA 2VHTA 3IEVA 2CJWA 4G5SA 1KI6A 3FVQA 5IT5A 4EFMA 3VR3A 3SBDA 5HCIA 3NBXX 3QPVA 4QNMA 4DDWA 4JLOA 1HYQA 4GZMA 2F1RA 4J0QA 3QVUA 4E09A 2QM7A 5AJZA 1CEEA 1ETUA 4EQ6B 1H8HA 2X19A 3Q8XB 1HE1C 4M21A 2P0EA 4R71A 3PEYA 4TZ0A 4DLXA 1NBMD 2FPKA 3CRW1 2PJRA 2GXAA 5G3ZA 3W6OA 4YONB 1XFAA 1KO5A 4Q21A 3U3KA 3U5ZB 1UDXA 4ZDIA 2O0HA 1OJLA 2WKQA 3AP2A 4A0FA 1N3BA 3UMFA 3L8ZA 3A8TA 3BB4A 1PLLA 2ZUDA 1VCMA 1W36D 4RZ3A 2WAXA 2RCNA 2VLIA 3CRQA 4GOKA 4ZIRB 4F93B 3WXMA 2W0MA 5FPHA 4B3XA 2IX3A 1CJTC 1VHLA 1E9SA 3CKLA 4B3FX 4RD1A 1HY3A 4PAOA 2VRWA 4B6EA 2NO6A 4EPVA 1OXVA 2ZI7A 2GTPA 1N6OA 3PEWA 4B32A 4OJKA 4GBMA 3K70B 5HE8A 3HWSA 4ARZA 2ERXA 4QXAA 3H86A 3KJIA 1OH7A 3F0TA 3U2QA 2MSEB 1OT3A 1Q12A 3PIRA 2VH5R 5L3SA 4DLVA 4L5BA 4LWZA 1T5LA 3NBZC 2FE4A 5CIQA 1RRCA 3CF0A 3BD9A 2WV9A 5JZVA 4IDOA 4Q47A 2GCPA 2MSCB 5G41A 3VR5A 1WRBA 1E0JA 5EP3A 3OEHD 2JCSA 4GP6A 4PTLA 2FSFA 4Q1CA 4LK2A 2LWIA 3B2EA 2ODNA 3KJHA 1X6VA 2VP9A 1ZYUA 1BH2A 4WW0A 3SJZA 4ERNA 1ZD9A 4CGZA 3HYRA 1XPRA 3LD9A 2ZI4A 2ZETA 2UVQA 3TUZC 4W5HA 4DDVA 5DI3B 2FSGA 3PUWA 2RGCA 4M1SA 3U7GA 5DISB 4JLVA 2F6RA 4DLZA 1T9HA 4V03A 3EWSA 2GEVA 2ORVA 3WBJA 2XB2A 3VKHA 3GEHA 4LJ4A 1W2HA 2YHSA 1E4VA 1E79A 4G1UC 2NO7A 2EFHB 1HV8A 3GJ3A 2W6JA 5IK2A 1T3LA 2N42A 3GFOA 1ZD8A 3WNDA 1CBUA 1Z83A 3I62A 2IC5A 2D7DA 2C9OA 3C5CA 2IW3A 1VPLA 4TQUS 3SZRA 4M1OA 4AK9A 3RRNA 1TUEA 1HT2E 2QORA 3QBVA 3IO5A 4CT4B 3REFA 2FDCA 5AJVB 2KSQA 1SGWA 4TSFD 1OB2A 2WMNB 2GAOA 1XD2A 2H7VA 2OXCA 4IFEA 3G82C 3LFUA 3B8HA 4JLDA 3BFVA 2EWVA 2WBLC 3WY9A 4Q4AB 1OE0A 4HYYA 3AEZA 3B85A 3CX7A 3QXHA 4IDPA 3DO6A 1YR7A 5KHOC 1XBTA 4MRRA 3RS5A 1OV4A 3IUYA 1N5KA 1Q21A 3EZ7A 1G8GA 3BC1A 4PO8A 1Z2AA 2G88A 1BO6A 3K0CA 6Q21A 4QBFA 1U99A 4BZPA 3EA0A 1OSNA 2YOGA 2CBZA 3BAFA 1G3MA 1VCNA 5C18A 1OHHA 2GCNA 5IHPA 5D3QA 4F4IA 3RAPR 4ESHA 2J46A 4C0QC 2J0SA 3BH6A 4EPTA 4BGDA 1HURA 4AC9A 1AZTA 2H5EA 3EXAA 4Z1MA 2YC2C 1VYVA 3FE2A 1CJKC 1T6NA 1NVVQ 4XH9B 2FFQA 3IPYA 4RY2A 4PC6A 3K0SA 1E3MA 2JAQA 2D62A 1HA3A 2CLCX 2WOOA 1VG1A 4OI4A 1Z0KA 2A5YB 1FP7A 1S8FA 4FMBB 5FBLB 2IHBA 4D0LB 5FTKA
chains in the Genus database with same CATH superfamily
2CXOA 3VR6H 2ID9A 3KJGA 1KU0A 1VG8A 5ALFA 1R0YA 2AD1A 3IQZA 1H0RA 4JLJA 1P2DA 4I36A 1HE5A 4OSOA 5ENVA 4BV2A 3HVIA 4F5DA 3DXXA 3BIOA 5JD6A 1SQ0A 4M76B 1L7EA 5ADHA 5DOVA 5J1SB 3BXFA 2VRNA 5I3CA 2WIKA 3CU5A 1FYXA 1NX6A 2WKPA 3Q1LA 5BMOA 2XQJA 1G3RA 2HQRA 3DG9A 3GQBA 4QPDA 3ZXSA 3JWGA 4EUSA 5BT8A 1WM1A 3S29A 2VTBA 3A6KA 3AHIA 1V7CA 2O2EA 3JD1A 3P0JA 2IXDA 5JADA 3DDCA 3R3SA 2ZB7A 4JU8A 4ZVQA 1PN3A 3RK4A 3KYIB 1TYDE 1B2LA 3OIDA 4AFNA 2PX6A 5DYYA 1YR3A 2QKYA 3DV0B 1QRTA 4L9AA 1D2CA 2TSYB 5AKEA 4CWAA 1KY2A 1Z2EA 4BP8A 4DMHA 3FNBA 3X2SA 5D01A 3AY0A 2DM6A 2H1IA 3DMDA 2IEBA 2CNNA 5HBRA 4RKQA 2MU1A 4QUBA 5A4JA 2W6QA 2PS1A 3HEMA 3OU7A 1XLTC 4KLAA 3WISA 4ARIA 2XB4A 1H1DA 3I9KA 3ZPXA 1DV1A 4MV9A 3GRYA 3IVCA 3RH0A 3CN9A 1NKSA 4DWOA 1G5RA 1QVVA 2O05A 2D1QA 2FPMA 2X9NA 5CT5A 4CF5A 3L4EA 2ZCVA 4YJHA 4YS6A 1E3DA 1UZUA 3AHGA 1BWQA 4HSGA 4NZNA 5TX7A 1DRJA 4AJIA 2PKQP 4UPDA 2HJSA 3KBBA 2H65A 1ZRSA 2HWYA 3BDIA 5CPFA 5EJMA 3V7FA 4L3WA 1FUEA 2QM3A 2RJNA 1NQTA 3WBFA 1CS4C 3NH6A 5JASA 3DWFA 3DZHA 4ND5A 4D9MA 4RS4A 3U13A 5FWXA 1HORA 4BUZA 5FH9A 3HUUA 2ETXA 1A9TA 1NW9B 2Q6TA 4JZKA 1IHOA 3SX2A 2HHLA 2HJVA 4OGGA 5CA0A 4GMXA 1Q0UA 2XUQA 3EXEA 4FCCA 3JPYA 2XUDA 3V33A 1WUJS 4LXIA 1OI3A 1YRAA 2WTAA 3Q87B 4L6IA 5FTNA 2GCEA 2Z3WA 3TJMA 1VRWA 2B4AA 2IOYA 3K4PA 2WWGA 4LY9A 4RD2A 4BASA 5C1BA 4Q3NA 2I2AA 2QAJA 2O0JA 3A9SA 3UJBA 4GOJA 1I4TD 5KNBD 2F8TA 1S7CA 3HY6A 5A3SA 1AUQA 3M83A 4I2VA 1K2WA 3RHZA 4E22A 1XKTA 3COYA 3KLOA 4ZI3A 1AO3A 4QTXA 3PYLA 2WMOB 5MGBA 4YJKA 4P3OA 1WV0A 1QDEA 2BR5A 3KV3O 3ZU6A 3S2UA 4CEIB 1SVUA 3ZU3A 1G4AE 1C1YA 1HFKA 2HU2A 2Y0PA 1KBOA 1M1YE 5EJFA 2VDWB 3UCXA 1FS4A 5HE9A 4CE6A 4XQCA 4MWCA 1UAAA 2DUWA 2E55A 2OV4A 5F33A 2P62A 1VMIA 3I23A 2W6ID 4LOLA 3E9QA 4S1TA 1ZL2A 1TI7A 4YDQA 2I4IA 2WU3A 4N4AA 5IT4A 5BO5A 3JAWB 4QOEA 1KNXA 4P4NA 1PT9A 1NVBA 2IZ1A 3A9UA 2VDKB 2IK8A 3LECA 1ULBA 721PA 4MA4A 3X0DA 4BNIA 4CBVA 1E8DA 2APJA 2VJQA 3C70A 3NG1A 2CCKA 4MOWA 4S04A 1RQXA 4IHJA 5HDBB 4WFJA 2F64A 3KZ1E 5IZCC 4WVFA 4FOLA 1WXQA 4NK4A 1E2JA 1FL9A 2QVGA 3GU3A 3OJWA 2PIDA 1Z4MA 2PQ0A 3EQZA 1OLUB 2WHPA 3A9CA 3BXHA 4RJIA 3HJGA 5G0UA 1L3CA 1VKNA 3VR2A 1YAJA 1DDOA 1T2UA 2E1PA 3KZVA 3L6EA 4KMSA 4MRMB 1EHCA 1MVNA 1EFVA 2CVOA 1UM8A 1PQWA 1Z3CA 4IIXA 4D74A 1MAHA 3IP7A 3NXKA 1HNNA 5TRTA 3DOCA 1CLUA 1BJRE 1MDFA 4QYWA 4V1CB 3CZRA 1L8LA 2XQGA 1G63A 3TSYA 2DFLA 3BF7A 1H1LB 5AM3A 2H18A 1B14A 2X4LA 2COKA 2AOTB 5EIBD 4RDIA 1QWSA 3ZTYA 1YJ5A 1EFLA 1I4WA 1T34A 1HEYA 2IYEA 5JR3A 1T13A 1EAMA 3WLIA 1YIDA 2G0TA 2SKDA 3WQHA 3WDKA 1NY6A 1OMOA 1RP1A 2ALJA 2CXNA 2O2IA 3ED5A 3QX7A 5CLLA 1YRWA 4QOHA 4B43A 5BVGB 4Q4HB 2I1WA 4F4JA 3WE7A 5FJIA 2B1GA 3VHRA 3T9CA 1KE2A 1L9XA 4PNHA 3N39C 5AOBA 2QUHA 4JDPA 2DLDA 4X66B 3FFTA 3CA8A 1WQ3A 3JWIA 2RGNA 4J0IA 4FMPA 1Z4KA 1LVGA 2PZEA 4NICA 2MYNA 2P40A 4EX7A 1QONA 2OCDA 1GILA 1AM4D 4YBRA 1DG1G 1JG3A 1NUPA 2PDAA 4XCVA 2P6NA 4ZI2A 4FM9A 1OX4B 3VHXB 3BA1A 4B33A 1Z2NX 1KFCB 2ZJ8A 3R2JA 1F6BA 4JIGA 1E2KA 1IXKA 3EQ6A 3W78A 1RWWA 2OHOA 2J0EA 1FUYB 5JS6A 4PLWA 2G1AA 2D13A 2ZVJA 3NJ4A 3F73A 3PDWA 3DHVA 4Q7KA 1OY1A 1TW2A 2VL7A 2ZXFA 3ACCA 3KOYA 3AOEA 2C88A 1R0XA 1N6IA 4HBGA 4EDHA 1EBBA 4G8DA 2P9BA 3DF9A 4GXQA 4HHEA 2Z0MA 2H59A 4FLFA 3ROEA 4W82A 1PJRA 2I3BA 4FPXA 5IN5A 2Q9UA 3GLHE 2NSYA 3UC9A 3GZJA 3UV6A 4C0JA 3ERCA 5KYXA 4HRXA 1WDMA 4RCZA 1CK4A 1T1IA 1U2ZA 2CHVA 3GWZA 1YR1A 3WB1A 1M0SA 1TT7A 2EV9A 2Q50A 2VNSA 3LNTA 4ESVA 3AV3A 1ZH8A 1P0PA 2PZKA 4XPZA 3ZY2A 3G0DA 2IBTA 2PFGA 5E3JA 3R7BA 5K45A 4KPFC 2OD7A 4UC0A 1H05A 2N46A 1I2AA 1N3LA 2R9VA 1TD1A 3GX1A 3EGWA 4JOBA 2DY1A 5CVCA 4EO7A 3P2YA 5IJ0B 5B12A 4E03A 3L4KA 2HO5A 3K94A 4O0MA 1MQAA 2VDJA 3HZOA 4BS9A 2Z2JA 2G6BA 5JO0A 3DZCA 1YOVB 1U8XX 3A9RA 1EZZA 1U1FA 2ZWAA 1IZ8A 4FEGA 4G23A 3VR2D 4QC2A 3OUZA 5C3UA 1Z33A 2AFIE 1Q92A 3C48A 4IDQA 5LQKA 3H2JA 4HN9A 4H6VA 1R12A 2BDEA 1SBIA 3ZBQA 4A92A 3IIMA 1I33A 1G8HA 2O5VA 4ZGWA 3OT1A 4N0QA 5JQGF 3G2OA 5KYKA 1KRWA 3OZXA 1YQEA 2VXCA 1MC8A 2F67A 4ND8B 5ICCA 4JGIA 3WB2A 3A4TA 5SYMA 2UUCB 2HF2A 4BB9A 2PYDA 3EPRA 1Q44A 3QBDA 4R1OA 1O9BA 3RJZA 1E66A 5GV8A 4PZ0A 1Y3BE 2BOVA 4D96A 3PL5A 4PCAA 4BMDA 5AKGA 2OO5A 2NU7A 3ZJTA 2HDOA 2I54A 3ZH2A 2NUTA 3NEAA 4IZOA 4PG4A 5IH7A 1GG2A 5SY6A 4XM1A 2DHQA 1EMDA 4OY3A 1WMDA 1A5SB 1JAXA 4OHVA 1KO7A 2WY2D 1ZVKA 3UZUA 4M7WA 4CKCB 5LIPA 2VF4X 2QW1A 3LO8A 3OD5A 1URPA 4FE4A 2VTDA 5DMXA 3C98A 1HF3A 3G5MA 4XD7D 4BMVA 3AVYA 4IGAA 3RVMA 2IGBA 1X94A 2F59A 3L0ZA 2ZT8A 4G84A 2HU5A 1KARA 1ONBA 2V7WA 3AJRA 3EULA 4RK6A 3SJ7A 4FXPA 2P41A 3EIEA 4Q19A 5I48A 1NA5A 1NDQA 3KSZO 5JNTA 2PA3A 3QOFA 1GCUA 1R8SA 2GAFA 3CINA 4JQOA 3TB4A 3AF2A 5EXPA 1GWNA 1UJBA 2C7VA 3E1KA 3HSSA 3L04A 1K98A 4GBJA 3K0FA 4IHKA 1CULC 4R2MA 3FZQA 1TZBA 4RACA 1P6QA 3F3MA 1HRKA 3GVPA 2AMFA 5T3YA 3QF7A 2R6JA 1IATA 4E12A 1JLRA 2LBPA 1NJGA 1XCBA 3G2MA 3FWKA 4RKWA 4W9RA 4O25A 4P7KA 4C07A 4BLPA 3FKJA 2C2OA 3R9WA 5L3VA 5CYOA 4M54A 3DBVO 3GEBA 5D6NA 5E9AA 2EC5A 4LV8B 1JJAA 2IXGA 3COSA 3G17A 3HZHA 2DYKA 3CZAA 3P0EA 2O0LA 3D8RA 3NVDA 3LDHA 1BOFA 3L1IA 3QLVC 1EDOA 1BXGA 1WCIB 2VQSA 3JSXA 2CUKA 2IIPA 3HLKA 4YGXB 2OA0A 1VKHA 5DTEA 1MF7A 1Z4NA 1T8WA 1PHPA 3E7DA 2NU6A 3A2MA 3LT4A 4UKDA 5ECYA 1DU4A 1HZZC 3A1SA 5HRAA 2RG1A 1X19A 2XB9A 2FWNA 1EGAA 3MJEA 2QQGA 4OG2A 4G86A 1AQNA 2QX9A 2I1VB 1XTSA 4G1VA 4I9HA 5ALRA 2CBGA 3FI0A 4D97A 5IX8A 3C7CB 3VI4B 1W4AA 3BQ9A 2P5SA 1S2OA 3I05A 1SHLA 4WK0B 5D5HA 4D0RA 5AD1A 3W3AH 2D1RA 3G5LA 1V1RA 3DZDA 4U6SA 3SX4A 3KOWA 3UB3A 5CLHA 4MI1A 2PUFA 5ICFA 3BJRA 1V4BA 3DUFA 2ESRA 2AK3A 3C5VA 1LJLA 2I33A 4LYHA 4EYKA 1MAVA 4BQRA 4J0FA 2CMGA 5JPDA 4MKGA 1P0QA 2J07A 3UOAB 2WK1A 3R9KA 2HCJB 3RIXA 1C80A 4QXPA 1BC5A 4Y8VA 2ZQZA 5DI3A 3AFOA 5CVUA 4DSNA 4ZZIA 2N1BA 2ZJAA 3U81A 1NULA 3LY7A 4B2LA 1MH9A 2DCMA 5IVPA 4B3BA 2DT5A 1FFYA 1KJZA 1UOOA 2DG2A 2DBZA 2WZBA 1FJXA 3FETA 1NJ8A 5EUCA 3Q0TA 4M9XA 1NMYA 3GJ8A 4PYLA 4U8HA 1N5OX 3AU9A 3GGJA 3AR8A 2B20A 3K9QO 4H1WA 4PSAA 1QYWA 3FIUA 3RFXA 1U9IC 2OR3A 1FVFA 2VFAA 3ONWA 2GRAA 2SECE 4YJGB 3ZGNA 3ZHXA 5B3KA 4QO8A 3OWXA 2W8BB 2YWJA 4LE1A 5HF5A 3VKFA 4WZBB 3IT3A 1N6LA 2XXJA 3TQOA 4DIFA 4N0PA 5WRFA 2RHOA 3JY6A 4B9AA 3TJRA 2MT9A 3FNGA 2IP1A 2L69A 2PL3A 3IT0A 3OZSA 4DBLC 3U6BA 1QZ3A 1E1CB 1X80A 1DBIA 1DKOA 1XWWA 3FUWA 4JP1A 4JQCA 4RSMA 1KC1A 4UCWA 1TA4A 1Z6PA 3SZGA 3EARA 2E48A 1LUAA 1Q0ZA 2LCIA 1X7WB 3JVUA 5JNSA 1H66A 1AIPA 1VKZA 1X1BA 2AFIB 3A4IA 2C00A 3ED1A 3FGOA 2CJWB 1AE1A 4GXTA 1N36B 1A95A 1GZSA 3TPFA 2DPLA 2YHIA 5HJ5A 1A9QA 1AKRA 3PENA 1IUPA 3G89A 4N54A 4BLWA 5AOAA 5MN6A 1COZA 3N2LA 3GXOA 3CUKA 3FNQA 1B8PA 4UAGA 2BGIA 4AZ3B 4EY6A 4YRCA 3FPAA 1E69A 3IP9A 5FOVA 4BC1A 1YJBA 4KIFA 2X0DA 4MAFA 3AEQB 3TTWA 2VEOA 4JHXA 1QHNA 1N75A 1VPEA 1FZQA 1UT5A 2WJYA 3KOXA 5CJPA 3TE7A 1LTQA 4X8OA 4ICIA 2O7RA 3Q3IA 2AFHE 3L5KA 5AKZA 4PEVA 1QIFA 2ZW9A 3DH0A 3GLHB 3HA2A 3KB6A 1RMTA 4A91A 3Q98A 4MV1A 2I0FA 3VA7A 1EGHA 1DJNA 4LUCA 3M5PA 4YI3A 1UOPA 1YDFA 3EIUA 4W1QA 2E5WA 4Z8XA 4HH1A 1OH8A 1F8UA 5AHXA 4Y67A 3WMRA 4CODB 3JTEA 3ASUA 1O95A 2MSWA 2J5XA 4EY3A 1YL5A 5KKCA 4B3MB 3W6NA 4N7JA 5A03A 3QUCA 5TJ9A 1P2SA 3V42A 3FR8A 3GVIA 4UFPA 3EG5A 2X8JA 4BNMA 1ZEJA 5TT0A 4EQZA 1KBZA 1DXYA 1Y4SA 4LZJA 1RRMA 2E87A 2ZZMA 3SYMA 1LRJA 1ZK3A 4H7KA 1PKXA 2LZ0A 4GXRA 4NY1A 2YDXA 4QIHA 1E1RD 4EUNA 4X93A 3FPJA 4XVUA 5F2NA 3JXEA 1Z6AA 5IBPA 1W19A 5DM1A 2SBTA 5E6SB 4PVDA 4BE7B 4RNCA 2W2KA 3A7DA 2QP9X 4OBWA 1XUOA 1NJFA 1TEXA 2XWQA 1M9NA 2Z8YM 4BP3A 1R4AA 3R8CA 2C2ZA 3MFYA 1P2FA 1L5VA 1NU8A 4Q4HA 2NMVA 2WABA 5LDDC 1I2CA 3NDPA 3Q40A 3QVGB 5I9SA 4CG2A 1IQPA 2YC4C 4R1TA 2GN1A 1NV9A 1ZKDA 4RCYA 4EGQA 3TGLA 2G4CA 4DUZB 4EHNA 1TO6A 2H7CA 3LY5A 5EERA 1B8OA 4MW2A 3HHEA 1UJCA 4MUXA 1GTZA 4I6GA 3HP7A 5EN4A 5M3BA 3VJKA 3ZDEA 1NXWA 3EIXA 4MI6A 1N3IA 3I9MA 3WR5A 5JS7A 2XMQA 4DIDA 1GEEA 2BVNA 3DE5X 1HL7A 2MOKA 2CZQA 3AINA 1XVUA 2J9XB 3MGGA 3P9CA 2OTCA 1TT5B 3JQFC 3V2IA 4IWYA 1OX5A 2ZRGA 1TCBA 1FFXB 3DXZA 1SKYE 3GCXA 4RTMA 2C5LA 1U2RA 2ZYUX 4ML3A 2VBFA 2ZJ3A 4YDSA 4L27A 3RS3A 3ZDFA 4M83A 4E31A 5CA1B 1L7RA 4UHEA 4BX3A 4AS1A 1UM9B 1NLMA 5FKJA 2IOFK 3QKRA 1Y7LA 4AYXA 2FUG1 1R0BA 4XGQA 4X1YB 1YQ9A 3USES 5JMPA 4FVTA 2ASVA 1L4EA 1YRYE 3R5SA 4IEIA 3GUCA 3QLUC 4J0EA 4TKVA 5J4VA 4TWZA 2V9CA 2B1JA 3FCSB 2JCXA 3GHYA 2FW6A 8MHTA 3L1HA 6ABPA 4YP7A 3WK5A 4KPYA 3HVJA 2C58A 4TZKA 5DO9A 4XQEA 4NCIA 4M9CA 5K6AA 5KWSA 1D3AA 1Q3HA 1TQDA 3AIIA 3T6KA 5LSAA 4II2A 2JFZA 2O3JA 4ENSA 4IKPA 4D9BA 2IP2A 1XU9A 1XD2B 2ORED 3DQZA 3F67A 4KN8A 1CUCA 3R0QA 3S3TA 1OZ0A 3KJXA 4TXMA 3MCTA 3SC2B 3FUUA 3ZGZA 1AHNA 1NQVA 2GJ9A 2ZE8A 3KJFA 4FNGA 4Y6OA 3LYAA 4NC9A 3EWNA 4BP1A 3O8CA 4CMJA 3ZIDA 1X80B 3WHPA 3EH1A 3TSOA 4DZRA 1WPRA 3F49S 4B9EA 3ECCA 1PG5A 1Q6YA 3GRKA 1CP2A 2D4HA 2E7ZA 3FM9A 3V1YA 5GONA 2QL6A 2GI4A 1DOAA 2GN0A 3GFTA 2XJ9A 3I12A 4PRZA 2DQYA 1P72A 2IYTA 5EMHA 5G0SA 3O3MB 1P8JA 1E3EA 1AY0A 2V7TA 3SAJA 4DSZA 5I9IA 2BR3A 1JAHA 3PSHA 1PJ8A 2R5FA 3ILXA 4MYCA 4UNSA 3SSMA 4DA9A 4DJTA 1IXRC 3ORFA 4QBIA 2JLYA 5DMHA 3AUAA 5BW4A 2VWHA 3OQHA 4HNAB 1N8SA 4NF2A 4ABYA 2LCFA 2XRMA 5U9CA 4MW7A 1HFEL 1AKEA 3QELB 4DAOA 4QVGA 4QKQA 3TLXA 5LBUA 2GUWA 2PVCA 4AX4A 1WP4A 5JO9A 1JN0A 5BYBA 4CTJA 3DLAA 1XT6A 1XMJA 1OVMA 4O4IB 1VCHA 4MCJA 4PR3A 4CT0A 4DCUA 5EJ4A 4MPDA 2Z58A 4CLDA 1TTTA 2G09A 1F1JA 1R7RA 3IS3A 1W1IA 2GQ0A 1KK3A 3DE0X 3UO8B 3EHDA 1OLSA 1OIVA 2WILA 3FCUB 4IH9A 1E2LA 1JIVA 2D2VA 5IM5A 4D98A 2HR1A 2G9UA 2M6SA 3PGXA 3A1CA 2GPSA 2PMBA 4LVCA 3ZQ4A 2DF8A 4COKA 3TZLA 1DKQA 2JGEA 3E1SA 4EHBA 2C4TA 3AM5A 5H59A 1YJ8A 4B79A 1SIBE 2OG1A 1ODFA 1LBEA 4D82A 4BXOB 5FWYB 2CUNA 2FVXA 1PDOA 1KO8A 4GUAA 4CTNA 3BAZA 5C0OE 2SKCA 5FAKA 1R15A 4M60A 4CDMA 1Z16A 3UOWA 1OF1A 2PWBA 2O3SA 5LUBA 1U7WA 4IEEA 4O8ZA 3FVVA 4Y18A 2Z95A 2QSUA 3A06A 3LK7A 2CYBA 3ZCRA 1N2XA 2UZ0A 1BYUA 3ETJA 4Q9DA 1TYAE 4KOAA 2O7VA 1FDTA 3VNVA 1HFWA 3QTTA 4BY9E 2JLSA 3ZOKA 4MLZA 5AM1A 1DZ3A 2Z4TA 4A6PA 2OFPA 2VRBA 1Q5PA 4EAAA 2ZS7A 3QVXA 1WOYA 2IYUA 3GGPA 4O63O 1UF9A 1W4RA 5T64A 1FTQA 5E0KB 1D2GA 4HN4B 3CUYA 4LXXA 2PSEA 4K6MA 1MPTA 3DNFA 1XNGA 4KTTE 4AROA 3GP8A 2F43B 1SZPA 4RHFA 4UUAA 4AB1A 5HQJA 1XMOB 5MF6A 1RCFA 2OZLA 4RZIA 3RF6A 3X1JA 4BN0A 2AEEA 2IYLD 1JHMA 1RKXA 2QTRA 2XMCA 4TRMA 4UCQA 1C3VA 1YR6A 4QWWA 3OE7A 1DBRA 1NHGA 3IIKA 1EWVA 4HDRA 3GPCA 3L8EA 2ZT6A 4NJMA 3HWX1 1KL7A 1L4BA 5SY4A 2C0QA 2GMWA 1FNCA 2Q62A 3PFIA 5KVQA 4I5EA 1RKVA 3PWKA 1D2EA 1NXXA 2BM0A 3STVA 4C04A 3IT2A 1ZWKA 3KSBC 2ZBDA 4HNGA 1W76A 4YA6A 3QKRB 4KR9A 4F21A 2YZMA 1QCYA 4G56A 3VM6A 3P2KA 3ZCXA 2FRDA 2VWQA 2YQ5A 4INAA 4KITB 2WWWA 1QTIA 4TL8A 4ZO7A 1QIEA 4IO1A 2X7JA 3L8DA 3A6PC 2FSPA 2DZDA 4H35A 5B3JA 1HG1A 4M1EA 3RVJA 4D02A 4DWWA 3IRUA 3EQ9A 4NPCA 4AKEA 1G4UR 1K3UB 2HWKA 2Q3BA 4KVZA 5FNVF 3WB9A 3T4PA 1SU6A 2X0IA 4HGRA 1H8ED 1NVEA 3CGGA 4BVBA 4HRAA 1IY9A 4B17A 1RLIA 5FB3A 4V2UA 4DMUB 1QG2A 3QBTA 1GGFA 1Y4AE 2A0YA 3BOSA 1W94A 1G8YA 2NYAA 4PG8A 4WERA 5BYKA 4CCYA 4MGKR 2J5BA 3TCKA 3ZHQA 1W4ZA 2ZT7A 2XF2A 4R05A 2JRLA 3GLIE 4HWPA 2W4QA 4KRYA 1MJFA 5JALA 4IVPA 4ZDWA 3VXKA 3EIFA 4XWOA 4RPHA 1Z6XA 3EZGA 1HNZB 3AOEC 2P9ZA 3MLBA 2FEXA 5TQ0B 3BMOB 1WIWA 1RHQA 1U6IA 3HXKA 1RZRA 1NNUA 4NOJA 4FFPA 2B5WA 2V7EA 4NMLA 1SN7A 2A1UA 2LW7A 1NBAA 3V1LA 4ZXPA 5AM2A 2JFUA 1QHGA 2R8RA 3O93A 3KXIA 3HJAA 3E3NA 3OHPA 4I99A 3HJFA 1DKRA 5HZMA 2FETA 1TQ2A 3AW8A 3WGGA 1MGPA 4KX3A 2PKRA 2AG6A 5IULC 1CUDA 4HBZA 2GK7A 1XRMA 1RHMA 3HNRA 1CUSA 4C05A 3LLCA 1EK0A 5F4BA 4ABTA 1NQUA 4BEVA 3PNLA 3DV9A 5AJUA 2OCBA 1WV1A 1IQ0A 3GJZA 3PC7A 3QQPA 4IDNA 4WOCA 5GPBA 1JVSA 3I04A 3HA5A 1J2JA 1EEXB 2C5FA 2VP4A 3U9SA 5JXWA 5I5GA 1G5QA 2RFLA 3ORQA 5IJAA 3RV4A 5C3MA 1VL6A 3TM4A 3AYZB 2R5WA 3RVPA 1DP4A 1Z45A 3H83A 2BZ1A 5TNXA 2EG5A 3ENVA 4BKUA 4EGAA 2XV1A 3RYCB 5LQSA 3RLIA 4OLBA 3SBXA 5F98A 3EQ8A 4XX1A 4QQRA 4WJKB 3B9PA 1IZZA 1YS4A 2H85A 3FI9A 4CEJB 3A4VA 1FP1D 4PFJA 3HLTA 4URZR 3V5NA 5I5EA 1V16B 4KXYA 1ZP6A 4NZMA 1U0NA 3VNSA 4RJKA 3EN0A 3WAJA 2HCRA 4MKXA 3NYWA 4AW9A 1LGYA 5JV5A 2QAGC 3C87A 2P2SA 4A0RA 2SHKA 1MB4A 4KSCA 3YASA 4MW4A 3M5WA 4F5ZA 1IN5A 3IIIA 1PJ3A 4OJNA 5K0CA 2XTNA 2IL1A 3WYCA 1CF2O 2CLLB 2IPXA 2DR0A 3OX3A 2WTXA 1XIVA 2C99A 4ZAFA 2DWOA 3VRHA 2PZFA 4MNTA 4UE2A 1CDDA 2O7QA 2QZPA 3WKAA 3KUUA 4U0KA 1NE7A 4UBOA 2FPUA 3CR7A 3VYRB 3PQ3A 1M1UA 4G0MA 4P34A 2C4VA 4DIMA 2NGRA 2FEMA 2PSHA 1QYVA 3L84A 4BO3A 5JSQA 3AR4A 4EK9A 1H6BA 2JKYA 1BVYF 1TM7E 4XDYA 4MROA 5HIKA 1R8JA 2V7QD 3BFKA 3C7KA 1Y6GA 3FMGA 1MG0A 3LBFA 3PEEA 4OQDA 4GLFA 3GRUA 1VCOA 4RPLA 1V2GA 2ZUWA 4K28A 2OC9A 3G9XA 3QXCA 4PBSA 2IH4A 3ZXIA 1LWOA 1P2UA 4DQXA 5J2UB 3G8DA 3T3HA 4BGVA 2BLNA 1ECGA 1G66A 2LPMA 2ZJ2A 3AF0A 3WK7A 4G0UA 1CUYA 1GY8A 3ZC3A 3EASA 4LTMA 2QMUA 4GM1A 1FTNA 1JBQA 2AEJA 2QN6A 2QZ9A 1I4LD 3LDAA 3MERA 2EGGA 1U9CA 3D0QA 3IBYA 1EVEA 3ESBA 3THXA 3DWEX 1G3QA 1XEFA 3L79A 5ELXA 2QLMA 4GPIB 1L8QA 1LPNA 3G49A 4JD5A 1KQNA 1IY1A 1T43A 2Y66A 3GXBA 5J3JA 5B7QA 5AJHA 3D54D 5EMMA 4ZOLB 3SS9X 2R85A 3BJZA 5TS3A 3NHZA 2XUZA 5B64A 2D1SA 3SLGA 1WXGA 3DNMA 2YW2A 2WOJA 3M7IA 5LZ5A 1BHQ1 4GLBA 4D42A 2W37A 1ACJA 4BVHA 2FEOA 3K7EA 5KCMA 1QH9A 2I5PO 4YP9A 2BHRA 2NUBA 2YY7A 1Q1NA 3QE2A 4IMPA 4IGEA 1D9XA 3MGKA 4IJQA 2YVAA 1ZMBA 4C4XA 2D8MA 5JSYA 2Y77A 3CR3C 4KPEC 5KYXB 4RVOA 5EGNA 4YAKA 4QG7A 3KKQA 1H2YA 3N5CA 3EG9B 5J59A 2FOXA 2JJYA 2TMYA 4UXHA 4P22A 2JATA 4ZI7A 1D1QA 2UZ1B 1KEPA 3B6EA 2OXEA 1JF8A 1W35A 3PYMA 1WF6A 4P4TA 3GAAA 1SHUX 4N65A 5ILQA 2RC5A 3HXQA 4UJ3A 2VWPA 2B82A 3HBFA 3I04M 4LHZA 5BWCA 4I4TF 1M5RA 4RD0A 4RH3A 2JIMA 3LLSA 5CNKA 3PK0A 4XLLA 1RWVA 2IF2A 2PT7A 3PR1A 3Q15C 2BD0A 4ZJZA 4EF5A 3BMOA 2VQDA 1PQUA 2NP6A 2YX1A 2HOQA 4H7HA 1EGMB 4R9NA 3ADBA 1MOQA 5CNJA 4IIHA 5CBKA 2Q6LA 1WZ2A 1TKCA 3A1NA 4OHMA 3UB2A 4UQOA 4MAMA 1ECPA 3G9TA 2KHZA 3H84A 4S1OA 4ZRNA 3H5NA 3ZHSA 2KS6A 2BP7B 2W4IA 3ZY3A 1Y6QA 3GJ7A 2DWPA 4TTIA 5IVDA 3DCIA 1UMCA 3E18A 3FMIA 3MS4A 3WAKA 2CLOB 3B7GA 3LQ2A 3R8FA 2MIIA 1U9IA 4Y2HA 3RF7A 3ZE1B 4REQA 2MCFA 2PFSA 2FZ5A 2CD7A 3RS9A 3FHTA 4NFLA 4DCVA 1CW2B 4EG3A 2GPAA 3BE8A 4CIXA 2EYQA 5K09A 2WA1A 3TS1A 3PLAE 3OO0A 4A8JA 4PLPA 4Z7JA 2O2XA 3GGDA 1PR3A 4DT1A 3K2IA 4XIGS 1K06A 1OLXA 2O4CA 1D8AA 3O3NB 4MWEA 1A71A 1O96B 2A33A 4FFNA 4R2HA 1J39A 2ARKA 1ZM3A 2FJ0A 3WC4A 1D1TA 1SBCA 1EXDA 2O8CA 4EBBA 3DZJA 2RH8A 2GETA 4TKUB 5JDIA 1R0LA 4IQ4A 3SQWA 1JHOA 1TMOA 2WLSA 2VPZA 1DIGA 1KGDA 1NUTA 4YMLA 4DB2A 3VTAA 3M9LA 3FTCA 5EIFA 3HU2A 2X15A 1QDLB 1EFHA 1OXBB 1AKWA 1T8YA 2W71A 4OHPA 5LBTA 4BO8A 4F38A 5BUZA 2R1VA 5LMCA 2FMIA 2QL5A 3PSAA 3AM4A 4ZQGA 4ZEVA 1IG3A 5GVRA 4CUJA 2X1VA 3DR3A 4EF4A 2HCFA 1EFKA 1WABA 2Q41A 4QT4A 5JVDA 1J42A 3IEIA 2QQEA 3TIFA 2G5TA 3CURA 3QITA 4UBNA 4R41A 3GEPA 4B46A 1K7CA 1RDFA 1CUGA 1ZD1A 3BT7A 4J16C 5H4GA 2P5TB 4FMCB 4EYQA 4URVR 1E1LA 1P7VA 4K9DA 3ZEAA 1PR2A 4EI9A 3PD0A 2JHCA 2I1QA 1RZ3A 1XPJA 4X94A 1VSVA 1T3HA 3MTQA 4YMGA 5LZ4A 2QRHA 3H7AA 3V34A 4DLSA 1XTKA 4EOGA 1PZXA 2A3RA 1LQ2A 2F3RA 2P8SA 3OOYA 2JJMA 1IIBA 4YAFA 1IMOA 3IAS1 2O52A 3FN4A 4GI1A 1E8MA 4HDKA 3UOGA 3HI4A 1VL8A 3X2EA 3DEAA 2HSJA 3AXTA 4OIFA 2A94A 3OKFA 3O83A 4Y9UA 4N47A 2RAFA 2PKWA 4RGYA 2QYSA 3DPSA 3K71B 3P19A 1B6GA 2EBFX 1I4DD 3TEFA 1WB9A 2IWRA 4H0NA 3IODA 3AM3A 5CD9A 2RGEA 1EAYA 1RYZA 1X70A 2HRBA 2PY6A 4R1PA 3V6LA 3ZGLA 4BLUA 1P5FA 2H57A 1I7QB 4X65B 2O06A 2PGOA 1BGXT 4MDEA 2O8FA 1OWLA 1T2CA 1K3TA 1M6NA 1NF8A 3GD5A 1WEKA 1DPFA 3ABZA 3NIDB 3L1KA 4TRNA 2OVBA 4G9GA 2EF1A 4JJIA 2C7RA 2PZJA 1KA9H 2RSLA 4D6PA 1E7RA 5F35A 4JL5A 5FQOA 5KWIA 3TF5A 3OIVA 3T5DA 1YV9A 4D4IA 1ISPA 4BTLA 4DMMA 2YJGA 4UHFA 1SNYA 2QXUA 1T4DA 3S55A 4KQGA 1HUQA 2XNJA 3UJ7A 3UW3A 1MO3A 4MUJA 2YWRA 2UXCB 5DGHA 3LIPA 5C51B 1K63A 4AQDA 5BV2P 2OCPA 3AF6A 1SVNA 5FO1A 5FLKA 1OKKA 3EMBA 4Z1OA 4XSHA 3TGWA 4R9RA 1Q1BA 3V8PA 1RZUA 1RP7A 2JKVA 3UKDA 2O23A 4QM6A 2ZR9A 2AFIA 3G5TA 3PUVA 4P80A 3R7WB 2E4UA 3VC3A 1IN4A 4INPA 4OQFA 1RLJA 5K3CA 2BEKA 2Q4BA 3KT8A 1PTJC 4WTOA 3W04A 1XMQB 2XEDA 2WICA 3AFMA 1DE0A 2QQFA 2BCEA 4HAWA 3PHBE 1V47A 4IJWA 3T38A 5A9RA 3F5QA 2A59A 2AQ8A 3NGLA 3NNSA 3WQQA 2CE2X 1NR1A 2GDZA 2AV6A 3L7IA 4D9HA 1RC8A 2Q29A 3EXG2 4YCCA 3H6GA 3PHGA 3EVEA 1W87A 1D7AA 1SCDA 3SC3A 2IH5A 4G8JA 3BK1A 4F84A 4FGUA 4Q4LA 3WWOA 4DDUA 1C8LA 2ATCA 3SVLA 3ZUGA 2WDPA 1KIAA 4XYGA 4MDFA 4I55B 3V46A 2KQUA 1QIHA 2P9QA 4Q6WA 3F9CA 3AI1A 4TMXA 2DY0A 4YQZA 5P21A 4X1OA 4U00A 1DAMA 2LDBA 1U0EA 3BE6A 3M70A 4K8RB 4WT7A 3TOXA 3W3AD 2I8AA 2V1XA 4OA8A 4CQJA 3UH0A 2G83A 2G0AA 3GROA 1KOJA 1VRVA 4BQOA 1PGPA 2VJMA 2WJ3A 4LY0A 3BORA 2RB4A 5CA0F 1TRHA 4MVJM 4L6CA 2GKOA 2H9IA 2WU1A 3DKPA 4ER0A 5ICEA 5CX4A 3SOPA 2PUDA 1Z26A 3EW9A 3DD1A 2PUBA 3U39A 2CXPA 3H75A 5LA6B 4IHAA 1O96A 1O54A 2WM9B 3GLHA 5KTTA 1QORA 1A76A 1G9TA 3EXFB 1F38A 4JLUA 4YEDA 2X4IA 4KJZA 1SXJA 4I46A 3PKJA 4O08A 5A6SB 3NP7A 3U7IA 3BL5A 5BNWA 2Q5FA 1Y6JA 1YH3A 2ZJ1A 3AVPA 4ZQHA 2HN9A 3REGA 1VE9A 4AJ9A 3KZKA 3UM9A 1BKDR 4LJLA 5CCEA 4F5EA 1WZCA 4D5GA 2X2EA 9LDBA 4F46A 4D99A 3GDFA 4BWVA 1COWA 4S0ZA 4DZTA 4GVPA 3VTKA 2CSUA 3DFIA 2EJUA 4GPAA 2BFMA 1A9ZA 2H3HA 4WD3A 2OFOA 4AJOA 4UHHA 3ZJYA 1QG0A 1KSHA 4AF8A 4JR0A 5HUQA 5J4LA 1FQWA 5KJ6A 1J8VA 1K5HA 1Z08A 3HYTA 3PQCA 2ZE5A 3WYFA 2B4KA 4N3CA 2WT4A 3KD3A 4WN3A 3JQAA 3D6JA 4Q3BA 1Q7GA 2ZUCA 3CBGA 3HCEA 5G2OA 1B00A 1Q6ZA 1X1AA 2BE7A 2AIRA 1X87A 2V9PA 2GVDC 2NQTA 2P8JA 1EVZA 3AV0B 5LDGA 4XX0B 4YMHA 3FAKA 4E1AA 2H31A 3Q3CA 5EJ9A 4W9MC 1NFRA 2INGX 3T5MA 1BXZA 4LC0A 1Y4ZA 2EJTA 2Q4EA 5KSPA 1N2CA 1ZC4A 4MGIR 3H17A 2XUOA 1RE1A 4Q3AA 2HMYB 1L5NA 1CWUA 2B4QA 3MJTA 4UDOA 1SA0B 4MUIA 4XCXA 4R0VA 3GMIA 3NHFA 4MUKA 2YWXA 4L15A 1EDBA 1RJWA 5A4MS 4RIEA 3SFZA 4D0NA 4M22A 2X6QA 1UWVA 2ADMA 5CLIA 2WWFA 3DWGA 1U3UA 4B75A 4BHTA 3C5EA 2ZJYA 5I7RA 3Q0IA 4EYOA 5CRIA 4CM1A 4RTPA 1XLWA 3KDSE 1M74A 1V1JA 4CG3A 3CEHA 1F8YA 2GEKA 4OLJA 4I1YA 4C3OB 1KVRA 2PVPA 5J4HA 1A4XA 2AFRA 2JA1A 4B84A 1JB1A 1NM5A 1TQ4A 1XMIA 2C20A 1H85A 2ZJ5A 3FNRA 3KWFA 4ZCPA 3GJRA 3S6JA 3SS8A 3ZKAA 1WD7A 1I2MA 3LKZA 3PC4A 4BWGA 1F20A 4YRBA 3NC0C 1W30A 4H3SA 5JRJA 1MVOA 3QKSB 3L