1N1GA

Crystal structure of leishmania mexicana glycerol-3-phosphate dehydrogenase with inhibitor bcp
Total Genus 128
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
128
sequence length
349
structure length
346
Chain Sequence
KDELLYLNKAVVFGSGAFGTALAMVLSKKCREVCVWHMNEEEVRLVNEKRENVLFLKGVQLASNITFTSDVEKAYNGAEIILFVIPTQFLRGFFEKSGGNLIAYAKEKQVPVLVCTKGIERSTLKFPAEIIGEFLPSPLLSVLAGPSFAIEVATGVFTCVSIASADINVARRLQRIMSTGDRSFVCWATTDTVGCEVASAVKNVLAIGSGVANGLGMGLNARAALIMRGLLEIRDLTAALGGDGSAVFGLAGLGDLQLTCSSELSRNFTVGKKLGKGLPIEEIQRAVAEGVATADPLMRLAKQLKVKMPLCHQIYEIVYKKKNPRDALADLLSCGLQDEGLPPLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords glycerol-3-phosphate dehydrogenase
publication title Anomalous differences of light elements in determining precise binding modes of ligands to glycerol-3-phosphate dehydrogenase.
pubmed doi rcsb
source organism Leishmania mexicana
molecule tags Oxidoreductase
total genus 128
structure length 346
sequence length 349
ec nomenclature ec 1.1.1.8: Glycerol-3-phosphate dehydrogenase (NAD(+)).
pdb deposition date 2002-10-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus
A PF07479 NAD_Gly3P_dh_C NAD-dependent glycerol-3-phosphate dehydrogenase C-terminus
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1040.10 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 1n1gA02
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n1gA01
2AG8A 1F8FA 3GGPA 4OXKA 2ET6A 1FMCA 4MVJE 3RU7A 1F12A 3LF1A 5CDYA 5DCUA 1U28A 3DO5A 4BUCA 3DZJA 1HZZA 3S2GA 5T8KC 5JC1A 4XCVA 3FI9A 3JQ9C 1YOVA 2B5VA 1QR6A 4JNKA 4AL4A 5ITVA 1YQDA 1SO8A 2I6TA 1YKFA 1WNTA 1J5PA 1PR9A 1Q0HA 2CF5A 3PRJA 3QWFA 4FJ1A 3PI7A 1P1RA 3MTGA 2WE8A 4BOYA 2Y67A 1VJ0A 2D4AA 2HRZA 2AMFA 1SZJG 3C7DB 1QLHA 4GVLA 4CMHA 3GZ4A 2Y05A 4NK4A 4UVGA 4BKPA 1C1DB 4CLHA 5TIIA 3NUGA 5A9TA 5JCXA 2EJWA 3N7UA 4HADA 5DN9A 2XOXA 3WGOA 4IJWA 5ADHA 1ISMA 3WIEA 1LSOA 3ZNPA 4II3A 3PQEA 1Z82A 4W4TA 3G1UA 3W1VA 2OBYA 2P9GA 1LRLA 1ZZEA 3MJTA 5CDGA 4H16A 5DOVA 3IJRA 2I66A 3LC2O 1SAYA 4HXYA 4JBGA 3RU9A 1KC1A 1GUFA 3RBZA 2RIRA 4EBFA 3H9QA 2C54A 3PPIA 3LLSA 2PWZA 2DBVO 3R6DA 3GR6A 3AW9A 1P77A 4KWHA 4ZGWA 4W7IA 3W4KA 2FR8A 4G2NA 4LSMA 3JQEA 3JQDA 4CMKA 4F6LA 2B0JA 1GQQA 2DBRA 4PZEA 3A14A 2SCUA 1KY4A 3BZUA 3HUDA 2VHVA 3DAPA 4ILKA 3V2UA 1LDBA 5F5NA 5IDXA 3WFIA 5THQA 1PJBA 4BGUA 1ZKMA 4XEHA 3WDSA 3H5RA 3EMKA 2VTEA 3EHEA 2I99A 3FHLA 3MOIA 2DTXA 2P9CA 3JQFA 1DC3A 3VPGA 3HNPA 3LSYA 1HRDA 3BTUA 3D3EA 3WOHA 5IF3A 5TJ9A 5CHEA 2VNAA 3E8XA 3GF4A 3F47A 4JK3A 1HL3A 1I3NA 1XQ6A 3E6AA 4KTVE 4OO3A 2VHWA 3HFGA 1ADGA 4EEZA 1LC3A 5G0TA 4QFDA 2J3IA 2ZB3A 1P3DA 3PHGA 3NT2A 4B79A 1KIFA 2X5OA 2IODA 2D3TA 2GERA 3STHA 1GYQA 1E3IA 4D42A 3GNSA 1K2WA 1CDOA 2NTVA 3OJ0A 3QWBA 3OHSX 3AY3A 1R12A 4CM4B 4BNZA 4UUPA 3GNTA 5LC1A 4Q39A 2AQ8A 3F46A 1JU9A 3WGTA 2BRUA 1RM0A 4NBVA 1DSSG 5ILGA 2QYTA 2NM0A 3HSKA 1E3WA 1H94A 3V2GA 2AEJA 4OJNA 4BO1A 2EKLA 3OETA 3BTVA 2WSBA 4Y9DA 1M2WA 2B4RO 1UZMA 5C3MA 4HKTA 2QRJA 3PTZA 1D3AA 1PQWA 4BNVA 4KTTE 1W0CA 2Q49A 4RPGA 2PY6A 1HDYA 1O9BA 1XR3A 3ROPA 4DRYA 2Y1EA 2A92A 1U4OA 3WNQA 4YPOA 4J16A 1KC3A 3GRKA 4DL9A 5L51A 4ZHSA 5AXAA 3GA0A 5CFZA 3UHAA 1VL8A 3HDQA 1C0KA 2O3TA 3C8MA 2Z1NA 4IIUA 1E3WB 1NPDA 4JXKA 1HDOA 4DWVA 2YFQA 3HB5X 1GEGA 4A0SA 5EERA 4PLWA 3ETEA 4ZRNA 3F9IA 3EGOA 1DJNA 3EW7A 3ADOA 5BSEA 3CPSA 4NFSA 1TVEA 4BNXA 3TZCA 3H9EO 4OKIA 1O95A 1HE2A 5JYEA 4KDEA 4DBVO 4RPHA 2XPCA 4IXTA 3JQ8A 3ZWOA 4OXYA 4J2OA 2X22A 3IAHA 2VHXA 3JD3A 3TPCA 4YRBA 4PLCA 1QXSA 4M87A 3S8MA 3PFFA 2HO5A 1Y8RB 2G0TA 2VT3A 4XX0A 4PLFA 1BXGB 4HBGA 4RF5A 1A4UA 3DR3A 1MG5A 3JYQA 4FR5A 4FDAA 4EDFA 1HDCA 1N7HA 5L9AA 3V8BA 2CY0A 5H81A 4E5NA 3WJAA 3FNEA 1GPDG 4URFA 1GZ3A 1Z73A 4PLVA 4CV1A 4MP3A 3OA2A 3GDFA 3OSUA 2EKPA 4AJEA 2CDCA 3JYOA 5EINA 3TL3A 2OGUA 2FZWA 4QXMA 1RYEA 3UGKA 1IULA 1HDGO 1TI7A 2EP7A 3INTA 2RHCA 3QWAA 2V7PA 4UUMA 1FDVA 1YQGA 2GASA 2VZ9A 3S2FA 1E6WA 3I3OA 3PHJA 4I9HA 4CMAA 4YYZA 2ZATA 2CNBA 4ALMA 1ENZA 4TZKA 3DHYA 2VRCD 3ZWAA 4UEKA 4L4RA 4WKGA 1VC2A 2PGDA 4LSWA 1DBVO 1SCUA 1R0SA 1DB3A 2O3RA 3NAQA 5IZCA 1BW9A 2AXQA 4Q3AA 3ZNQA 3HB4X 4CLRB 3BIOA 3L9WA 4GX1A 4XRGA 3E03A 1ZXLA 4Z3KA 1PU2A 2WYVA 3TQHA 5FI5A 4BB6A 4LK3A 4J4BA 2DC1A 2O3UA 1XIVA 2CD9A 2VYVA 1XELA 3GUYA 3GK3A 2HMUA 5LDGA 4DYVA 1ARZA 3WSVA 4GH5A 4NNJA 2DPGA 3GDOA 4Q9NA 3FN4A 2YDXA 3LT0A 4IQ0A 4L76A 2A4KA 3D5QA 2GRAA 3L4BC 4R5MA 4BV8A 5COAA 4YT8A 2PFGA 4N5LA 4QEDA 4DXHA 3K8ZA 4E5KA 1E1KA 1QV6A 4TQGA 2VOEA 1R4MB 3LF2A 1EK6A 3KLPX 3TJRA 3ZCXA 4Q3BA 1MGOA 1I2BA 3VZSA 3CIFA 4GMFA 4B8ZA 5L4SA 4PGFA 1XKQA 1N92A 1AHIA 4D3FA 4XDZA 4E4YA 3DZKA 4U5QA 4F45A 4G81A 1AGNA 4CUKA 2VRCA 3D4OA 4B3JA 3FR7A 2PZJA 4GMGA 2X9GA 2JL1A 4RVDA 3WIDA 4A7PA 1KVRA 3INRA 1EUDA 1U3WA 4JBIA 3AU9A 3NTRA 1E6UA 4E2XA 2PD6A 1T1SA 4CUJA 3ENKA 3KYDB 1DFIA 2TMDA 3ASUA 4QECA 1O5IA 2TMGA 1QMGA 3GT0A 1C0IA 2OUIA 4FOOA 4GLLA 3Q1LA 3RKRA 1JW9B 1CRWG 1NM5A 3EVNA 4JJFA 4XYBA 1H0KA 1HTBA 4IZIA 4PIVA 3HFSA 1DC4A 1UDCA 4NFHA 5L4LA 1PZGA 3QVSA 1Y81A 1SMKA 4ESOA 1HE4A 1NQ5A 3BMQB 3WWZA 3ZGYA 1W8DA 1I30A 3H8VA 1OFGA 2OHXA 4B4OA 2BI7A 2OL4A 4QTZA 3TRIA 3H2ZA 2BHLA 3RSHA 1JVBA 4DREA 1K0UA 3GFBA 1UUFA 4XB1A 1H6DA 3MJVA 1IZ0A 1CQIA 2BD0A 4YJHB 5I8ZA 4D79A 3NJ8A 1T4BA 1T25A 3K9QO 3ZHBA 3ZW9A 5JW6A 2JAPA 4F46A 2ZTUA 4E5YA 4DLLA 3N74A 3T7EA 2BGMA 3K5PA 3RUDA 1CYDA 4FC6A 4I5GA 5G0SA 5DP1A 1LDNA 3H3JA 3B20A 3JTMA 5F3RA 1EQUA 2DQ4A 1GV0A 3HDYA 2X8LA 3CSDA 3ONEA 1YS4A 1K6XA 1Y7TA 3HJAA 4GGOA 2H9IA 4PLPA 3INGA 4CMEA 2Y1GA 3O9ZA 4Z0TA 3WSWA 4BMSA 5HS4A 4FCCA 4FOSA 4ZU3A 4I9UA 1P0FA 1Y6JA 3ZWPA 4R5HA 1ISIA 4XRRA 4CR8A 2X9VA 1IPEA 1XDWA 2XXBA 3FWZA 3OM9A 2VN8A 3DMYA 3O03A 4CQMB 4BNUA 2AQHA 3ZWVA 3KV3O 2VZ8A 1HF3A 5TLSA 1LQUA 5BSHA 3IC5A 3Q3CA 3TZKA 5L7TA 1TLTA 1U1IA 3KLMX 1E7MA 3NTOA 1XU7A 3M6IA 4UREA 5DCYA 1FDTA 2NU6A 4HV4A 1DHTA 4EJMA 4O5OA 4XQ9A 2QHXA 3CMCO 3DBHA 3AI3A 1F17A 3KRTA 4KDFA 4TVOA 3U09A 2Q1SA 1UP4A 1LDYA 4PLYA 5KKAA 2X86A 4LGVA 5ES3A 1A9ZA 3L77A 2NV6A 5JMPA 4W9NA 3LLVA 2OXIA 5JLAA 4BO8A 1AHHA 4H3VA 4ZN6A 5DP2A 4NQZA 2W4QA 1R6DA 4KUEA 5DOZA 3NJ4A 1BHSA 3H65A 1B8PA 1P1JA 1IUKA 2FOIA 1V6AA 3G79A 4XR9A 2X58A 3QW2A 1VL6A 1XHLA 4WPGA 3NDRA 1UXJA 2EIHA 1ID1A 5CEJA 4M54A 4E2WA 4YJDA 3WWYA 2YUTA 3AI1A 2LDBA 5CEEA 2O2YA 2EKQA 4LCJA 3SC6A 1ADFA 3I23A 5KNLA 4CODB 1HZJA 4RO0A 4MIYA 4RZHA 5G4KB 3LQFA 8ADHA 3HQ4O 1NAIA 4XD2A 3PIIA 3WGHA 4Q3DA 3LT1A 4JGBA 3ZH2A 5ICMA 3BMCA 3Q9NA 4GAEA 2PD3A 3WR5A 3MEQA 3KBOA 3F3SA 4I08A 3GVPA 1D1TA 3BMOB 1LC0A 3D7LA 3DEYX 3V5NA 5EN4A 5CG2A 3V1UA 3VDRA 1XWFA 3GEDA 4YVFA 1EVJA 1H5QA 3ZI0A 4XDYA 4ITUA 4YCAA 3ZV4A 4RORA 1C1XA 1E1LA 1HDZA 5IJZA 5ER6A 1W6UA 1UDAA 2R2GA 4S3MA 2JD1A 2O4UX 1J6UA 1Q2XA 3BHMA 3I9KA 4M49A 3I9NA 5DCWA 2B35A 3QWIA 5H83A 5AXBA 5AOVA 4BNTA 4RPJA 3WMXA 4RF2A 5CG1A 2FPGA 1M75A 3JQAB 3W6UA 5JCJD 1WAMA 4IUYA 4XYLA 1N1EA 4U0KA 1RYDA 2VCYA 1WZEA 1MXHA 2C0CA 3OIFA 1EVZA 4QO7A 1G0NA 1PL6A 3S1LA 3AOEC 3OQBA 4YT4A 2Y68A 3NX4A 4YT5A 4PZDA 1GCUA 3W8DA 1KERA 5F5LA 1PWZA 1JAXA 2V65A 3R1IA 3M2TA 3WLEA 2R6JA 3KHUA 4CR7A 2BKAA 1DPGA 5I8WA 2B4TO 3FCOA 2GR9A 2HK8A 4O0LA 3RBXA 4AJ4A 4BL5A 4DPLA 5JPIA 4OYRA 1BRMA 1OMOA 4CMIB 3PJGA 4GX2A 3TWOA 2GZ3A 1PGQA 2AG5A 4L74A 3O26A 4YJFA 1GUYA 3EZLA 4IM7A 3UKOA 4RVUA 4OOFA 1WLYA 1SOWA 2G5CA 1NXQA 1O8CA 1AXGA 3HDJA 2JCXA 5ICSA 1C14A 3A9WA 4MVJM 3GN2A 2BMAA 3WFJA 1HE3A 1FK8A 1YB1A 1PZHA 1KS9A 5A03A 5BSGA 5EJ2A 4BVAA 1TA4A 3QWHA 3V2HA 3EYWA 1OAAA 1Z7EA 4OH1A 3GN1A 3SVTA 1YO6A 4G65A 4WJZA 5CP8A 2A94A 4J43A 4MP8A 4XGNA 1QYDA 4M55A 1P33A 5T67A 4FD3A 4CLDA 3ONFA 5KJ6A 1PL8A 5JO9A 3IUPA 2NUAA 3BMNA 3AU8A 4XWYA 3AFNA 4HP8A 5JFOA 4LCEA 1GTMA 1KVTA 3LZ6A 2W98A 1U7HA 1OOEA 2YHUA 4I5FA 4NBTA 3DHNA 4GKBA 1N5DA 1QYCA 2ZTMA 4IGFA 4PRLA 3ROMA 4BKUA 1DFGA 1X15A 4MINA 1GDHA 4D44A 1I36A 4OSOA 4MVJI 1HSZA 4GX5A 3FTNA 1ISFA 3Q11A 3GEGA 3RC7A 2NVWA 2FSSA 2PKQP 2ZCVA 2CVOA 5EQDA 3ZU4A 2C07A 3OP4A 1OBFO 2DU8A 4CR6A 1NX6A 2BFOA 1JA9A 3GAFA 1N8KA 4BNNA 4UAGA 1F8GA 3WBBA 5K6AC 1DLJA 1Y9AA 4NI5A 1A5ZA 4CV3A 4ZD6A 5GZ1A 4NPCA 4RV9A 3DMTA 4YBZA 3FRJA 1RWBA 3ZWCA 2Q46A 2X7HA 3LT2A 4L8VA 5CPFA 1NR7A 3RVDA 5HRUA 1EBUA 1SEVA 1V3TA 1LNQA 1VKNA 3F5QA 4J4TA 4J2HA 5BQFA 1B14A 3ANNA 4E13A 2ILTA 3ETDA 2ZYAA 4TZTA 5C7LO 1ZFNA 4U7WA 2W2KB 4IQ8A 2WWRA 3D5TA 4ZVVA 1R15A 2UDPA 5HA5A 5JCJA 3TZ6A 1Y5RA 2I3AA 4NR0A 5K6AA 4IJVA 2JFGA 3D1LA 4FN4A 4BO3A 4ZQEA 1NQTA 2I3GA 5A9SB 1GCOA 4U6QA 4CV2A 1YOVB 2J6IA 4DMMA 2Q4BA 3OEWA 1U3VA 4CM8B 4OQZA 4OXNA 1IYZA 3GG9A 2Y99A 1ZSVA 1NP3A 3AUUA 3DTYA 1X13A 4FFOA 3RKUA 4YR9A 4NH4A 1LLUA 1ZJYA 1TT5B 2VWGA 3DBLA 3ZWNA 1WZIA 2BH9A 2ZYGA 3JQ7B 3NDIA 4R41A 3FBTA 3KYCA 3E9NA 3PVZA 2NTJA 4AJNA 5I9NA 4KWIA 3GUCA 4BO4A 3H9GA 3K6JA 3WGIA 3AK4A 2DPHA 1KETA 3FF4A 4XGIA 3T4EA 4OMUA 3VPSA 2V6BA 4E2ZA 2EP5A 6ADHA 2GUGA 3IOYA 3QJ5A 1MUUA 3BYZA 2CSUA 3KEOA 1YL5A 4MPDA 4AFNA 2O23A 3ZHZA 5MDHA 1NFFA 4NMHA 5MGBA 3ZWWA 4CLXA 3CUKA 1IY8A 3GQVA 1JKFA 4D0SA 1B15A 2YQ5A 3PYXA 4J6FA 4L4SA 1DHRA 3BMNB 1DAPA 3OMLA 1AE1A 2HJRA 1PS9A 1A4IA 5F1PA 2O3SA 5IZCC 1P1HA 2H63A 4BGVA 5KKCA 1K6JA 1DAOA 4BKRA 1PGPA 2AW5A 4QFCA 2UUPA 4WCFC 4BO6A 3L4SO 3ENNA 4OIMA 2PZMA 4FFNA 4HFMA 4GGPA 1DC5A 1B16A 5JDCC 3GY0A 1X7DA 1R16A 3FNHA 4P4GA 3NT4A 3A06A 4DQXA 4ALNA 1A7KA 1Y5MA 2BF7A 3B1JA 4ALLA 1H9BA 1BW9B 4IIVA 5B4VA 1P9LA 4K28A 3GZNA 2O50A 4JCOA 4RF4A 4NU6A 3RJ9A 4J7UA 4PLHA 3DZFA 1M76A 2X0JA 2WDZA 4FSHA 4LRSB 2GGSA 4AJPA 3K31A 5A1TA 4QT0A 3NT5A 1WPQA 2R00A 3PDJA 1EVYA 4CMIA 1KEWA 2JJYA 4CJXA 1KBZA 2ZB4A 4IDDA 1B8VA 3QHAA 5EQFA 5J23A 3GAZA 2GN9A 1N7GA 1PQPA 2H1SA 3JD4A 1K3TA 4GSLA 3K30A 4OKNA 1SNYA 2WD8A 3GOHA 5FWNA 1NHWA 1RM4A 2W2LA 3ZU5A 2DFDA 3VHRA 4JBHA 2IYOA 4YDRA 4MKRA 3R3JA 5COQA 1BXGA 3W8FA 2QRKA 1ONPA 4GWGA 1MLDA 2GYYA 4XJTA 2HUNA 2E48A 5L4NA 1UAGA 2C29D 4BQRA 3OECA 3WB9A 3WNVA 2C2YA 3QP9A 1ZJZA 4R9SA 4RQUA 3T7CA 2JCVA 3I52A 4WOKA 1ISJA 2Q99A 1DIHA 9LDTA 7MDHA 1R4NA 3ZZNA 4YJGA 1I0ZA 2FPIA 3EC7A 1LQTA 1NFQA 1BSVA 1T24A 2PKQO 5BT9A 4HFRA 1E5QA 3UVEA 3F6YA 1IL0A 4CV0A 4TVBA 2JD2A 4OL9A 4D0RA 3GFGA 1VJTA 2WM3A 3OFSA 2J5RA 4MIEA 3KSDO 4MKXA 1HDXA 4BO9A 3SJUA 1ADCA 4Z0HO 1PX0A 4NBWA 4CM9D 3RJ5A 4K1LA 3JQ6A 4LRTB 3TN7A 1I8TA 2Q3EA 5AQ1A 4R69A 3K2BA 1FDWA 4NJOA 1TEHA 1VKOA 3BHJA 2HK9A 1P31A 2XF8A 4RLHA 2Y66A 1XYGA 2CDBA 1NQAO 3IKVA 3WQRA 1CQJA 1EEHA 4MJLA 4ONEA 1R0LA 5JMWA 3PJDA 3DBLB 4YA6A 3TNLA 3L6EA 2PNFA 1ZNQO 1P1KA 3UAGA 3KEQA 5A02A 2IE0A 4P4LA 2NTNA 4YRDA 2NVBA 1JN0A 3G49A 3T4XA 5DNAA 3U62A 3AFMA 4MVJH 5KTKA 1J49A 3GNQA 1T4DA 3OJOA 5I7SA 1QYXA 2OBNA 3ICCA 1XLTA 2RBEA 2YV3A 3CXRA 3EAGA 2PGLA 5K0ZA 1XG5A 4DA9A 1ZK2A 4RGBA 1JAYA 5HTOA 1LEHA 4Z9FA 3UF0A 3ROKA 1Q7BA 1VRWA 3QSGA 2FP4A 3CKYA 2ZTVA 3DL2A 4JQCA 4CUZA 5IXSA 3JQ9A 1WDKA 2FSVA 3IUSA 1DLIA 4BKOA 5TQVA 1LJ8A 3PYMA 3WS7A 1ZK4A 4XR4A 4CMGA 3QLJA 3RROA 3VPFA 1WMAA 3B70A 4BO2A 3PDUA 2DTEA 3FNFA 3QA9A 4DQVA 3FSRA 2GPTA 5DDIP 2B69A 2QG4A 2HJSA 3I4FA 3E9QA 4BGEA 5ILOA 1D4FA 3VH1A 4DIBA 4CLRA 1NAHA 1X1EA 3RWBA 4FFPA 1SC6A 5IXYA 4FBGA 1PQUA 5T5QA 2RCYA 5U9CA 4HFJA 5LDHA 1U3TA 4DIFA 2VWQA 3DHEA 3PGXA 1PJ4A 4WLUA 3P5SA 1DIAA 1NPYA 2X23A 3CEAA 3U49A 2Q1WA 4E2YA 1YJQA 3QIVA 2IYPA 1GAEO 4ZQFA 4BNMA 2CFCA 4R1SA 1B8UA 1E7YA 2I9PA 1VSVA 4C7JA 4GKVA 3CH6A 2Y1CA 1PJQA 1ZMTA 2ZK7A 1MB4A 1IOLA 3R0IA 3BTSA 1I3LA 4A10A 4IGEA 3A4VA 4IDFA 4NK5A 1MG0A 1MC5A 4HNGA 4YTEA 3Q9UA 4U0JA 8LDHA 3RAJA 1EBFA 1BDMA 1EK5A 1Y8RA 2D5CA 3MJEA 4LMPA 4R1NA 2OP0A 4ALKA 2F00A 2J3HA 4XJSA 1ONNA 4J0FA 1YGYA 1ZBQA 1PWXA 1DJQA 4J49A 1LRJA 4WNIA 3GVXA 2C5AA 3A1NA 7ADHA 3GMSA 3FPCA 4WCFB 4LVCA 3UN1A 5KJ1A 4FS3A 1NBOA 1KVSA 1E92A 1ISGA 1M66A 1N9GA 2O3JA 2Y0CA 3TZHA 1O94A 2FMUA 3GMDA 4M89A 4B3IA 1VM6A 3DFUA 4YQZA 3G17A 2X0IA 4FIZA 2Z5LA 2BGLA 4WOJA 1YWGO 2JKVA 1GQYA 2IXBA 1Q1NA 2OOSA 2NVUB 3GVCA 1EE2A 5L53A 5L95A 3EK2A 5KVQA 2GDZA 4Z0PA 4IBOA 2B4QA 1T2CA 2AQIA 2Y0DA 3VPXA 3X2EA 2GD1O 3KSUA 3RUEA 1P45A 2JCYA 3I9LA 5ITWA 1PJSA 4CM7A 1DRVA 2ZTLA 3JQ7A 3QE3A 3GEMA 2IZZA 3PFWO 4CM5A 2CMDA 1JWBB 1DIBA 3OQ1A 5JDCA 5G0WA 2VHZA 1ULUA 2VYNA 4UUOA 5T6BA 1PR3A 5JAQA 5L3ZA 1T2AA 4BO7A 2GZ2A 4QX6A 1BMDA 2EV9A 4MVJD 1VSUA 1CETA 4M1QA 1PS8A 2O7SA 5I9MA 3RFXA 3VTZA 2QRLA 1QG6A 1DIRA 4BKQA 2HRBA 4BO0A 4CLOA 4ND3A 3AUSA 3I1JA 4GI2A 5FYDA 2PLAA 3H3FA 3VKUA 1I32A 4DUPA 1X1TA 3DZBA 2PKRA 2J5KA 3JQGB 1PJTA 2ZIZA 3JD1A 4Y67A 4E33A 4FJ2A 1UH5A 3P19A 3PZBA 1NYTA 4Z9YA 3LYLA 5ENVA 2IEBA 5KVSA 3HADA 3GPDG 1YDWA 4XQGA 3RIHA 4J91A 3BMQA 3FR8A 3ZHYA 2VYND 5L7WA 3KVOA 2B36A 1DEHA 1NTOA 1YBMA 1XCBA 4TRJA 4TRNA 3QV1A 2P68A 2VUSA 1S6YA 3QVWA 1U8FO 5IN4A 5DBFA 5JY1A 1T2DA 1T2FA 1CJCA 3OA0A 4DGSA 3KYCB 1NWCA 4I9NA 1EDZA 1YQXA 5T8KA 1EUZA 2EF1A 3JD0A 4B8WA 1E3EA 3IQDB 3P7MA 4Q3EA 1S7CA 4WE3A 1NR1A 1PJ2A 2GLXA 2QZZA 3MJ4A 3L9XA 1E7WA 1UAYA 3O38A 4CMJA 2D0IA 3ZW8A 1EDOA 3HN2A 3W6ZA 4IZHA 4DBZA 3SC4A 2IEDA 3I9OA 3R3SA 1UDBA 2OORA 3GVIA 3VKVA 2JFHA 3AJRA 1HXHA 4IDCA 2I65A 2YV2A 2H5LA 2V6FA 1JWAB 2O4CA 3WGYA 1D1SA 4TKMA 4YAKA 1BVRA 3S2IA 4KOAA 4P4NA 4NDNE 3ZHXA 1R4NB 4ZQBA 2BLLA 3D0OA 1HDRA 4J1SA 3GPIA 4BIIA 1T1RA 1ENPA 3KB6A 4J90A 5A9RA 2DBZA 4U6SA 4BHTA 4D45A 3FWNA 2PV7A 4RQTA 1BVUA 5TC4A 2YW9A 4FQ8A 4U8GA 5A5FA 1M6HA 5I9LA 1E1MA 3WQQA 3VPHA 4Z3DA 2BELA 3GHYA 2D59A 3NRCA 3G0OA 1HYEA 1PGNA 4DLAA 4BMVA 2QYSA 2EJVA 2YDYA 3NDJA 3NYWA 4KP7A 4IDEA 2PGJA 4YQYA 5KJEA 2NU9A 3VZQA 1UXKA 3ITDA 4HY3A 4GWKA 1ZK0A 5KCZA 1ISHA 4N18A 3I9JA 2F1KA 5COBA 5B4UA 5T57A 4PLGA 3HE3A 5CEFA 5THKA 3D3WB 2EERA 4PVDA 1ML3A 1EE9A 1DFHA 5KJCA 1EFLA 4UVEA 3EZYA 1GU7A 1LSSA 1JLLA 2RAFA 4I5EA 3RC2A 3HZZA 1GR0A 2Y1FA 3AM5A 2BGKA 3OIDA 3GDGA 2HMWA 2BI8A 3JQBA 4MIOA 1EVIA 5TT0A 1IZ9A 1C3VA 3C24A 2W90A 1X14A 1N9GB 2FR1A 2G17A 3CZRA 4BS9A 4X54A 3S55A 4XYEA 1LBEA 4R16A 1H6BA 4YRAA 3RCBA 2JD0A 3O4RA 1X0XA 3DC2A 3PZRA 4I1IA 3CZMA 1KEPA 5KIAA 2LDXA 3JSAA 1J0XO 4D3SA 2X5KO 4FB5A 3PHHA 2FPPA 1JKIA 3UW3A 1RM5A 2P9EA 4N5MA 2Q50A 5G0UA 4RPLA 4PG8A 1VPDA 4JP2A 2HQ1A 5T64A 4ND5A 2VUTA 5TRTA 3I6QA 5DBIA 5KWEA 3IL2A 1V8BA 4B4VA 4YAEA 1W73A 2C82A 3NTQA 1KEUA 4II2A 5A06A 3P2YA 4PG6A 4AJJA 3ZN2A 2FZEA 2PH5A 4WEOA 4IDBA 1H6CA 4DPMA 1YE3A 3KZVA 4DYDA 4FFMA 1E3LA 2YFHA 2ZB7A 4MDHA 2Q1TA 4BGIA 1QSGA 1KYQA 3PWKA 4OQYA 3AI2A 3WMWA 3WTCA 3I9MA 3GVHA 3QVTA 4WLEA 3FBGA 4LN1A 2GSDA 1U2GA 3F1LA 1ZEJA 2PK3A 3TOXA 1UXIA 3DBVO 2Z1MA 3NGLA 3U9LA 3DOCA 3OQ6A 1IHYA 4ZJUA 2DFVA 4IJUA 4MP6A 4RF3A 4D46A 3HHPA 4JP3A 1HLPA 2X4GA 3OJLA 1N1GA 3RQSA 3E5MA 4TSKA 3D4PA 1PGJA 1JTVA 5TSDA 1ZW1A 2UUOA 3C1AA 4WEQA 2EG9A 2RHRA 3IP1A 4XYGA 2NU8A 4W99A 4MVJG 4CQLB 4Q3NA 4E32A 3GG2A 1CERA 4M8SA 3RUHA 1HEUA 1YBAA 3U4IA 2Y1DA 3RUIA 1I10A 3CE6A 1MX3A 4XIJA 5AXCA 3VZRA 1B26A 1R4MA 2CVQA 2WJPA 4WLFA 1VLLA 4WLOA 4KUGA 4CM3A 1U5AA 3DQPA 4A2CA 2PA3A 4ALJA 2CVZA 4PN3A 1BDBA 1ZK3A 5JAMA 1EFKA 4E30A 3V1YA 4CLOB 5JBIA 4CQLA 1MFZA 1OC2A 1V9LA 1PEDA 2A9FA 1ZEMA 2HLPA 3BMOA 4HNHA 2OZPA 4L73A 3B1FA 3RASA 3PQFA 5ER9A 2X0RA 1PJ3A 2QQ5A 4Y6RA 4IMRA 4PG7A 3RFVA 4XIYA 5CDTA 1MP0A 2GZ1A 3TL2A 3JYNA 1GYRA 2AQKA 3RUFA 1SBYA 3ULKA 5C37A 4BMNA 2J3JA 2J3KA 1D8AA 2HK7A 3WGZA 5TT1A 2FR0A 3W8EA 3JCZA 1EQ2A 3QY9A 5KVCA 1P44A 4E12A 3HWRA 3ICPA 2IDZA 4JLWA 2I67A 3CTMA 3WTBA 3U3XA 1PZFA 2GN6A 2FY8A 4PRKA 4BV9A 1B0AA 1E77A 3AY7A 1H93A 4K6CA 1FDUA 1A9YA 3DMTC 3ZV6A 3VH3A 1QRRA 3C7CB 1GUZA 4TRRA 5A05A 3VVCA 1V35A 5BR7A 1UXGA 3FTPA 4XA8A 2XXJA 2EEZA 4W9NC 4BNFA 1LX6A 3GLQA 4ZICA 2YY7A 5KVVA 4MVJA 2IZ0A 4EZBA 4UULA 4Z9XA 1C1DA 2VWPA 4Y98A 1RM3A 3SX2A 3VVBA 2HKIA 2W2KA 1U2DA 3W4JA 3ZDFA 4PVCA 5IAAA 4B7XA 2IXAA 2PD4A 2EW2A 2WMDA 3H5NA 2E6UX 1LU9A 3AUTA 4MO2A 2DVMA 4Q3CA 2CF6A 2Q2VA 5JS6A 5CAEA 2VOJA 1WDMA 3JQAD 5FFFA 5U4QA 4L4XA 2YV1A 3Q0EA 2DLDA 3ZNOA 1I33A 5JNLA 2NU7A 3DZHA 1IHXA 4F3YA 1JQBA 4CMEC 4JROA 3UUWA 1KOLA 1YXMA 2NQTA 1PGOA 3QVOA 3C3XA 2DUWA 5EESA 5U1PA 1GL3A 3L07A 4A03A 1XSEA 1P74A 3I83A 4WNCA 3DAFA 1ORRA 3WLFA 1YB4A 1J4AA 3MOGA 1E0DA 1SB9A 2HSDA 3E48A 1P1FA 3I5MA 2DUUA 1GPJA 4J7CA 4JN6B 1SOVA 2WYWA 2X6TA 4UUNA 1NHGA 2A35A 5IFLA 4E31A 1Y9EA 5B4TA 4DQUA 2YHIA 3RC1A 3AWDA 2E4AA 2WE7A 1ZMOA 5IDYA 4PLTA 3ZWYA 1O0SA 4E5MA 4BB5A 2FN7A 1YB5A 1GYPA 2W2LD 1MFPA 1P1IA 3NEPX 4BNGA 3F4BA 3M1AA 4NBRA 2VTDA 4FFRA 2YZ7A 1O89A 1ZO8A 1FDSA 2NADA 5TF4A 4EUFA 4OSPA 4E0BA 5IDQA 4E21A 1F0YA 1ZXBA 3D4NA 1UP6A 2DBQA 1T26A 4WCDA 4BNLA 4UEJA 3DDNA 3MTJA 1YVEI 4XB2A 4CPDA 5A3VA 4K6FA 5BSFA 4WECA 1G0OA 4GBJA 1QKIA 4WK6A 1ZH8A 2PH3A 4N54A 5AVOA 1E7RA 4YJHA 3TFQA 1DC6A 3BA1A 4J0EA 3AOEA 5L7YA 1WMBA 4OHUA 2Q2QA 1RKXA 1TB4A 1X7HA 4BNHA 4AJHA 2DTDA 4H15A 4HUJA 1NQOA 3SLGA 1H2BA 4AICA 2YYYA 4NIMA 4BNWA 5FEUA 1GZ6A 1IPFA 1E1NA 1TT7A 3JD2A 3KSZO 2AEMA 3VOSA 2JHFA 2I5PO 4UVDA 1NWHA 2VWHA 3I4CA 3KXDA 5JAIA 1QP8A 3VZPA 1K89A 3K96A 1P0CA 4OOEA 3LC7O 4L0QA 3KYDA 1NVTA 2J8ZA 3NKLA 1R37A 1UZNA 1U4SA 2C2XA 4BNIA 4J9UE 5F1KA 1E6EA 1XQ1A 2W8ZA 5G4KA 3L0DA 5A4DA 1TT5A 4PZCA 2UVDA 2NQ8A 4XGKA 2WYUA 1U9JA 2Q2WA 3E9MA 3ST7A 3B1KA 4E3ZA 2GN4A 3U4DA 1MXFA 4R51A 1XGKA 1CWUA 4RJTA 3JQCA 4WASA 1UJMA 2VT2A 2GF2A 3PWSA 4BNKA 4C4OA 5HBRA 3IIEA 4YB8A 4IDAA 4N5NA 5A3JA 5DF1A 1Y8QB 1ZSNA 4P38A 4J7XA 2BFMA 2P4HX 3IJPA 5JDIA 1SEPA 1ZVMA 4J4HA 3JQAA 2O48X 4DPKA 4B3HA 4O6VA 3NV9A 2BFPA 1LUAA 1Q7CA 1UP7A 2EWMA 4PLZA 3IMFA 3DWFA 3LK7A 2CZCA 1CF2O 2G82A 1W4ZA 4YEDA 3OIGA 1C1XB 1Z6ZA 4QQRA 3EVTA 4AJKA 1VJ1A 4Y6SA 3G1TA 5K9ZA 5A04A 2O7QA 1GY8A 3IS3A 1Y8QA 2Y0EA 3RUCA 1PIWA 5KOIA 3DAGA 1E3JA 2QIOA 2QX7A 3H4VA 3L6DA 4YWJA 5GZ6A 4PG5A 4GX0A 1HYGA 1I2ZA 1UR5A 4KZPA 1ENOA 5HS6A 4J9VA 4D7AA 3SXPA 2VYVD 4ND1A 4RDHA 3WGGA 2O2SA 3DOOA 1XA0A 2OMEA 1B7GO 2VZ0A 3RI3A 5JY6A 2D2IA 3QQPA 3ZV5A 1X0VA 2FHSA 1BXZA 5B12A 3TOZA 1GADO 1LI4A 5JAZA 6LDHA 1DRUA 3RFTA 4YAGA 1K5HA 3DBRB 3ORFA 1F06A 4LISA 4RL6A 4GLOA 3WX0A 5EPOA 2E49A 4ND2A 1LSUA 1O6ZA 5L40A 3H9JA 3FPLA 4G5HA 4R68A 1PTJA 5GZ3A 2C59A 4TWRA 4FGWA 1VI2A 4ZA2A 4NBUA 2Y1OA 4ROSA 1GFSA 4R1TA 1OC4A 1EUCA 1ULSA 3BAZA 1Z7BA 1ZCJA 5G0VA 5TX7A 3UFXA 3ZWXA 2GN8A 4BNYA 3COSA 2XAAA 2JHGA 5EIOA 5F21A 3WG9A 4J3FA 1M6WA 1PS0A 1EMDA 3I6IA 1G1AA 3WICA 2GCGA 3MWEB 1LDEA 4MVJF 4MVJP 1LXCA 4GPD1 2HCTA 1M67A 3BTOA 4R54A 4IPTA 3IP3A 2DT5A 4ALIA 3NGXA 5DZSA 3DBHB 3U0BA 4AJLA 5AXDA 3PLNA 1MC4A 1DIGA 4ND4A 3MZ0A 2ZB8A 2AE2A 4UVHA 2WD7A 3CTVA 1I5RA 4R1UA 3KETA 4YAJA 1ZSYA 1U7TA 3EDMA 3U5TA 1NVMB 3ZNNA 2J5QA 1YL6A 3O8QA 3PXXA 3K92A 2PZKA 3D3WA 1WXDA 4R3NA 4RVHA 1L1FA 4DC0A 5IG2A 1K6IA 5JYDA 1HYHA 4EJ6A 4S1VA 2P91A 1TXGA 3Q2IA 1E3SA 3OEYA 1ZK1A 5B1YA 2AEFA 1GV1A 1LA2A 5G2OA 1BGVA 1NFRA 4GL4A 3DXFA 3GC6A 1IE3A 1WW8A 2DM6A 4DMLA 3OICA 3PHLA 4LVUA 4OM8A 3G3EA 2C7GA 2NWQA 3DB2A 2AE1A 4NFYA 1HLDA 5A9SA 2JAHA 3U4HA 1B2LA 3CINA 2EGHA 4J1NA 2OFPA 3U4CA 2ZYDA 1YDEA 1I3MA 4IJKA 4LW8A 1V3UA 1I24A 1DXYA 3PWZA 1AXEA 2I76A 4J1QA 1A71A 5JO0A 1DOHA 3ASVA 1YL7A 2UYYA 4R01A 3N58A 3QRWA 1PJLA 2CUKA 1U3UA 3H6KA 3UOGA 4B4UA 5CDUA 3UXYA 3FNGA 2UAGA 2C20A 3L4BA 4B7CA 1I3KA 3PEFA 4KMSA 2GNAA 5C5IA 2NACA 1E7SA 1CIVA 3AM4A 3X2FA 1WVGA 2PR2A 4RPKA 2BFAA 2D1YA 5KJFA 3UCXA 1WWKA 4O59O 3M1LA 2UV8A 3BMCB 1HETA 4RVSA 1GZ4A 2PTGA 2C5EA 4QO8A 3PJEA 1Q0QA 3SJ7A 2VRBA 4A26A 5I7EA 1JKJA 4CM6A 3ABIA 4P8RA 3WYEA 5FI3A 3LVFO 1Q0LA 4CL3A 4ZQHA 5DBGA 3PLRA 1R0KA 4INAA 5JSFA 4KQWA 2X0NA 4RDIA 4CM8A 2X1HA 1JVSA 1KY5A 3TZQA 3RUAA 3KTDA 3EUWA 1A7AA 4CM1A 1YH3A 4WGGA 4BO5A 3OJEA 4YXFA 2NVUA 1LLCA 4N7RA 1C0LA 1GEEA 3VH4A 2HAEA 4K26A 4W6ZA 1ENYA 2G76A 5IDWA 2WD7B 1PSDA 5JDIC 5JE8A 4GSKA 1GD1O 1Y1PA 3C7AA 1QV7A 1WDLA 4Y8VA 1UXHA 3WBFA 4DVJA 1LLQA 3JQGA 3RC9A 4YJGB 3TDKA 4NHEA 1ZIDA 2C7VA 4AG3A 5ENDA 3KO8A 4NJMA 3WYBA 2HMTA 1V3VA 4RLSA 4HX5A 1SB8A 1LSJA 2AHRA 2E37A 3A28A 4HFNA 5EL0A 5IZ4A 2NSDA 4YT2A 3IDSA 2HU2A 1DRWA 3PJFA 4IS2A 1NPTO 1HE5A 4R3WA 1NASA 5TS3A 1FXSA 3KUXA 1NNUA 4QUKA 1X7GA 2IRWA 1WP4A 2POQX 2E82A 2WTBA 3WJ7A 3K73O 4RCVA 1QLJA 4W7HA 2HMVA 1E7QA 3PHIA 3OF2A 3CMMA 4J1TA 4YJFB 3UCEA 3VC7A 1HWYA 2NLOA 1FJHA 5I7VA 3DBRA 5CPBA 4R4JA 4EUEA 4CL8A 4AJ2A 4PG4A 2OP1A 3O8QB 3PGJA 3TSCA 1ZUD1 4O63O 1LDMA 3JQBC 3ON5A 2P4QA 3ANMA 3LU1A 1KVQA 4EI2A 1MA0A 2EW8A 3E18A 4XKJA 2P5UA 5EMHA 5A5EA 2P2SA 1CEQA 4JJIA 3GZNB 3M2PA 3JYPA 5BNTA 4R9RA 3LT4A 1B3BA 1BG6A 3WXBA 4TROA 1XEAA 4DTIA 4CLEA 4FGSA 4EW6A 1DDOA 3S2EA 1B3RA 3C85A 3P2OA 4FPXA 4IXWA 1FF9A 4WCFA 2OO5A 1U8XX 1E5LA 3TFOA 4NG5A 1GQ2A 4B7UA 4RVFA 4XZ3A 1RPNA 2B83A 1YBVA 4LMRA 2NNLD 4M86A 1N2SA 2Z95A 3MCVA 3E82A 3MJSA 5L45A 1QYVA 3KYBA 2EHDA 1YRLA 3C1TA 3H2SA 4L9RA 3H9UA 4ZRMA 2P5YA 3FD8A 4WLNA 3OJFA 2DKNA 3HN7A 1OI7A 1IB6A 4PCVA 3JQFC 2R00C 1HSOA 3C1OA 3AOGA 4WUVA 4EYEA 3ANLA 1A27A 1H6AA 3TF5A 3PYLA 1H9AA 1U5CA 3LC1O 1YONA 3D64A 4UVIA 4AJIA 5I7FA 4A27A 3H7AA 2FWMX 3KOUA 2WEKA 2JFFA 5B37A 1I01A 1Z45A 4C7KA 1OZAA 1SPXA 1KVUA 2PZLA 4IS3A 3VDQA 4TKLA 1KEVA 2H6EA 2Q45A 2D5AA 4FFLA 3VAZA 3JYLA 2Q1UA 2G1UA 4D43A 3ONDA 4A73A 4CQMD 1H2HA 5GY7A 3H5AA 4IQGA 4CM4A 2B5WA 1UZLA 5H82A 4JJGA 1AUPA 3Q6IA 2VHYA 4NZ9A 3IKTA 2ZCUA 2Q4EA 3AM3A 1QORA 5TNXA 2ZQYA 4HWKA 1T2EA 3VTFA 4DIOA 4BQPA 3AUAA 4JX8A 3ZWMA 4E6PA 4K9DA 3ZU3A 5TJHA 3HG7A 4RZIA 1V0JA 4KQXA 4MKZA 4YAIA 3E5RA 3PK0A 3F1KA 1MV8A 3K2EA 1RJWA 4Z6KA 1LLDA 3MWDB 4MOWA 4XQEA 2EXXA 4CMCA 3PIDA 3SEFA 4FC7A 3OBBA 2D8AA 3RD5A 1BTOA 1PJCA 3F4LA 4AVYA 1I2CA 4O1MA 1D7OA 3QVXA 3WYCA 3GGGA 5BNIA 3DTTA 2GO1A 4H7PA 4E5PA 2QZ9A 5IN5A 3DOJA 1R66A 4OGWA 3UCFA 5TGDA 4BNJA 3F5SA 2V6MA 1A72A 4Y6PA 1ADBA 1JDJA 3L6OO 4QSMA 4F6CA 3GH3A 3AY6A 2VQ3A 1DO8A 2ZJ1A 4I8XA 2RH4A 4EJ0A 4ZQGA 1HKUA 3W4IA 1G6KA 5GMOA 1LRKA 3EY4A 4EGFA 4WLVA 1L7EA 3VH2A 5JXWA 5LCXA 3WGQA 2YHIB 4CM9A 4KUHA 4ID9A 4TRMA 4AJOA 1L7DA 2QW8A 1VE9A 2VNSA 3PP8A 2X9NA 2HMSA 3GHHA 3GRPA 5G4LA 4IY1A 4DLBA 4D3DA 4AJ1A 4IINA 4B4WA 4RVGA 2RH8A 3OH8A 5FF9A 3RBVA 4I5DA 4CMBA 1AN9A 2DAPA 3KM0A 4TMFA 1XU9A 3BXXA 2B37A 4IDGA 4XYMA 2VUUA 1C0PA 2O3QA 4GQAA 1ONOA 3Q2KA 3HDHA 4NU5A 5C7IO 1Z74A 4EEXA 4EITA 3SBOA 3ITKA 2EGGA 4OAQA 2YJZA 3GGOA 4GVXA 1BWSA 4D41A 3V1TC 3ROQA 1LDGA 3E1KA 4FW8A 2V6GA 3B6ZA 3PQDA 4DC1A 1HT0A 1VL0A 5DT9A 2FRDA 4A5OA 5DULA 2YQ4A 3JQ8B 3DZIA 1YJ8A 1BXKA 2ZJ0A 4W82A 9LDBA 1F14A 4NJMB 3WQSB 3LDHA 3SLKA 3MJCA 4IMPA 4YACA 5BNFA 4L75A 3DONA 1LTHR 4P22A 2IZ1A 1NVGA 2CDAA 5AYVA 5JC8A 3ZU2A 5HWSA 3UH1A 5C7OO 2ZKLA 1EZ4A 5CDSA 4EUHA 3ZV3A 3BHIA 4FJ0A 5HM8A 4JIGA 3DZGA 3DFZA 4XQCA 3ZWBA 4PFJA 2ZQZA 3ADPA 3UICA 5F1OA 1QYWA 4CQMA 1Q7GA 2Y93A 2HDHA 1PL7A 2AA3A 1PZEA 2X5JO 3JV7A 4UEOA 1Z75A 3ETGA
chains in the Genus database with same CATH superfamily
4CF5A 1F8FA 1GGVA 3B53X 3PKJA 3TIVA 1JGTA 1JDZA 3ROEA 4DA7A 4EPWA 3GGPA 2OCIA 3ZJTA 3IT2A 3RU7A 4LYGA 2QI9F 1F12A 2ISCA 3LF1A 4OLHA 1M1NA 2C5LA 5JSQA 4L6CA 4PQGA 2DB3A 1U1GA 2BR5A 2RKBA 2AOUA 4WXEA 4YGXB 5DCUA 1RCUA 4M76B 4OKSA 3QPCA 4HDMA 5T8KC 4S2EA 4TXJA 1W30A 5C35A 2OHJA 4XCVA 3JQ9C 5T7BA 3EA0A 3FX2A 4JELA 1JB9A 1L7MA 4JNKA 1YQDA 3H17A 4JIMA 4N5HX 2I6TA 5EG5A 5GOZA 3QWFA 5ITVA 1Q0HA 4FJ1A 2DULA 4I9FA 4P1ZA 3OUZA 4F86A 1O4VA 1E60A 4KG7A 5ADUS 1IXRC 1SURA 4ZVMA 4R7TA 2ZUVA 3Q3GE 1FXWF 4XJVA 5FOSA 2NPOA 1VJ0A 2GCEA 4JI6B 4Q4DA 3C8UA 4GVLA 3BFJA 1G5RA 3L84A 4H6PA 3VHXB 3T5TA 1U6IA 3E7PA 3W3AH 4JQOA 2PQMA 4W9RA 3IMKA 1XYVA 1MPXA 4CLHA 1A77A 4MWOA 5A9TA 3LHDA 2EJWA 1MX5A 3N7UA 4HADA 2RGAA 1JNXX 2NGRA 2HA7A 1RD4A 3WGOA 4DDKA 4DAEA 5ADHA 3RSCA 4NCHA 3WIEA 4EL5A 1CJBA 4UOZA 1WHSB 4II3A 3DFMA 1C3LA 1Y6QA 3G1UA 3RHFA 1U3GA 2P9GA 3A2LA 3OFJA 4QBFA 1U2QA 4X44A 2I66A 2BN4A 3AESA 1QFMA 3DF7A 3ZQKA 3IAUA 1MEOA 4KIGA 1DI0A 5AOBA 4M1MA 3TNFA 3GH1A 3ZDEA 2FDCA 4HC4A 2RIRA 2WKSA 3H9QA 4QGHA 1BX1A 1EVLA 1QYRA 2R86A 3MTQA 4ZVOA 2UVQA 3H9BA 3UWKA 4X6LA 5C8XA 1EX7A 3LPDA 3GR6A 1IN5A 4KWHA 1Y6RA 2Q29A 5AJHA 2XZOA 2WAMA 4IEEA 1J7JA 2DBRA 4LXTA 4PZ9A 4OHZA 1KY4A 5FUVA 2IYAA 2WA2A 1ZH2A 3HA3A 3V2UA 4WK4B 3VU9A 1A1SA 3BKWA 4HEQA 5F5NA 1KI2A 5THQA 3UW1A 5ALUA 3KZCA 5F9MA 1ZGHA 2YWHA 4K1XA 4G0YA 1ZKMA 2ZWOA 3ECAA 1N8TA 4XEHA 3U31A 3WDSA 1P0IA 4C7OA 2VTEA 1AZLA 1QX4A 4AN0A 2HUPA 1Z62A 1XEWX 3EHEA 1W5EA 3N2LA 4KXLA 2BHSA 3CZQA 4MS1A 3MOIA 4QWWA 4R8RA 5AICA 1DC3A 1VSTA 4EPVA 4FHEA 4QIHA 1Z2CA 4M7WA 5JXJA 3LS2A 5TJ9A 4AMYA 2FXIA 5CHEA 2HRCA 2IVZA 2VNAA 2XKAA 3EXG2 3KKMA 4TUYB 3ZJYA 2QRVB 2EDAA 1HL3A 3NHPA 3HFGA 4ER5A 4IOLA 5G0TA 2QUJA 4M22A 2DETA 5EKDA 4GECA 3TBKA 2VDMB 2YVQA 4C76A 2MSLA 2B9EA 1L5WA 1KIFA 2X5OA 2IODA 4RJIA 4HGNA 1TZCA 1CULC 1EFUA 1DCMA 2HA3A 3E1SA 4H1VA 5IKXA 1NR5A 3STHA 3CC8A 4HUTA 2C3PA 2QRNA 2IYUA 1J5XA 3ADKA 5ALNA 4JODA 3MGCA 4QA9A 3VISA 2KW5A 4OYHA 1C5KA 1K2WA 2HNAA 1T6XA 1CDOA 4HG2A 2BSQA 1G9TA 2FMXA 1R18A 4CIYA 2QZ4A 2IYRA 3D8HA 3OLQA 3HDTA 1AB5A 3GJ4A 1KKUA 2QN3A 2H51A 2BUAA 4Y18A 4CM4B 4BN4A 5JSUA 3IOMA 1ZN9A 4B6RA 4Z4IA 3WLAA 4GUAA 1JU9A 4X00A 3HA7A 4LYJA 4NBVA 1ORVA 4DCPA 4Q4LA 2PIDA 1H8ED 2G06A 5ILGA 2NM0A 4PNEA 2AZMA 4TWZA 5E4FA 3HMKA 3OETA 3AFHA 3W5DA 4Y9DA 5BP7A 2B4RO 3OQNA 2CYCA 2VJAA 5K2OA 4EFNA 3BFVA 3H18A 1ECGA 1E8DA 4FWBA 4TMKA 4CBVA 5CB8A 4YRJA 3WNZA 2RK4A 1O9BA 4X1OA 3ROPA 4AX4A 3IBFA 3QF7A 1KDRA 4G0MA 4PTYA 5EZ5A 3WLJA 2DHRA 1Z88A 4E15A 3GA0A 4L0CA 1Z63A 1QMPA 3IAM1 3TAXA 4YFVA 1C0KA 2PRYA 2R96A 3UMRA 4HB0A 1BQ4A 2IY7A 4BZQA 4IIUA 1E3WB 4JXKA 2YYAA 3P96A 1JJVA 3G2LA 3A1FA 3P9CA 2YFQA 1S89A 4R2KA 4DWVA 5EERA 4PLWA 4G8DA 4GPZA 4IIJA 3BRQA 4KPUB 1MW9X 4YPFA 3ZOZA 1DAMA 2G72A 4J0GA 3RJZA 4JJ8A 5JANA 1E98A 2OKGA 3H9EO 4KITB 1CSEE 1O95A 4IG4A 1HE2A 2YFKA 3NBMA 2NU7B 3SR4A 2O2DA 4EGAA 3RT9A 4H77A 1G5QA 2R6R1 2ZS9A 2Z4SA 2ODBA 1NQWA 4ND8B 4OXYA 3VSDA 4QYTA 3GLHB 4EB0A 1TK3A 2X22A 3HWX1 3K0EA 2VHXA 3NIGB 2XTJA 4PLCA 1QXSA 4OQXA 3UMYA 2ZANA 5LKRA 2XR1A 5F23A 1G98A 2O54A 4XX0A 1EAMA 2P9QA 1MT0A 1SZDA 3DR3A 3FYDA 3JYQA 1G55A 4FDAA 2XDQB 1LPMA 1N7HA 4OHMA 4F5ZA 4QELA 2YYSA 4K86A 2B9VA 5L9AA 3WJAA 2EU8A 1GPDG 4G8JA 3E05A 4CV1A 4JBNA 1BEEA 1D09A 1NM5C 3F73A 1Q11A 1TF7A 1DUIA 3MS7A 3T9BA 2PQ0A 3B89A 1FMTA 2ATCA 3QYJA 4ANFA 1YK1A 4BTLA 1DDIA 4KRFA 4CKBA 4HYYA 1TAUA 3UGKA 1IULA 3Q3JB 1W49A 1MEEA 2V3WA 2VZ9A 1JDPA 2GASA 4CMAA 1I5EA 4JU8A 2QX9A 1EGQA 1QR2A 1NXTA 3PNQA 1FYVA 3R7DA 2C5SA 3BZWA 2WPDA 3ZWAA 3KQMA 3LGXA 1HEIA 3K9NA 3OFKA 4L4RA 1ZS9A 4IXMA 2YXLA 3F6CA 4L72A 1SCUA 5AUNB 1J20A 3CTPA 4PF1A 2EKDA 5BV2P 1FFXB 3HV0A 2JLWA 1CZUA 3GJRA 4C4TA 5IZCA 4Q3AA 3R76A 2Q41A 4B2PA 5KYYA 4CLRB 4D9HA 4ZV9A 1A96A 2P79A 4DNXA 4FVTA 4EHKA 2BZ1A 3AY0A 4LOLA 2ZIWB 5C8YF 3DDWA 2O0JA 4M1EA 5HZKA 1SBIA 1JDVA 2Q4OA 3AB8A 3JRNA 2INGX 3M5DA 1SIWA 4WESA 1WMEA 1B6SA 4LK3A 3O93A 4WMLA 1M8JA 2O3UA 2EZ8A 1ZH4A 2OSVA 3DMFA 5FBKA 4YIHA 4BQEA 1NN1A 2JNWA 3BWBA 4EGQA 5EXSA 1W4AA 5SZHB 3WSVA 4HAYA 4EYOA 4OMCA 3KHSA 4QDXA 5IUKC 3II6X 2C5GA 1JVNA 3EAQA 1SR8A 3KJIA 4C4YA 1QPGA 5JRDS 3AL3A 4G0WA 3D5QA 1SKAA 1NW5A 1UPFA 2RC6A 2VDLB 4YT8A 2IWHA 1XVUA 3AVOA 3AR9A 3ZXUB 1H8EA 2B1RA 2AG6A 3ZE2B 5FDFA 1F8UA 2HI0A 5DIFA 1JHAA 5HCUA 3LF2A 2FSFA 2H5JA 3ZCXA 2AR0A 4YRGA 2W2VA 3T7SA 1FXWA 2BDEA 4C7VA 2AFHE 3CJTA 4I6GA 1MGOA 3EODA 4R8VA 1I2BA 4ZVLA 3DM5A 1TD1A 3EGWA 3DSRA 1P8JA 4B6JA 3CVXA 4Q9LA 1IVYA 4D92A 3GJ3A 4F4UA 1X38A 2PUBA 3ND5A 4FOPA 1QBGA 4PZAA 3CZ5A 5FO0A 1YUNA 2GZDA 3FR7A 4LHWA 4RVDA 1YCGA 2JL1A 4A7PA 3THWA 3OCYA 4EAAA 3T8YA 4TOIA 4G97A 4KE6A 3GJXC 4LFAB 3FAZA 1IEVA 1COZA 2HV9A 2ODQA 2XBLA 3BWYA 3C2QA 4XD7D 3LG2A 3PDHA 1UBRS 3IDOA 4C4AA 3OM1A 1ORTA 3KB2A 2H4ZA 4H6VA 5EIBC 3K72B 1U2GC 4XYBA 1TIBA 2CN1A 1NDHA 4X8LA 2D4HA 1HTBA 4EYKA 3Q8MA 1DC4A 1UDCA 1PRYA 1SMKA 1UBNA 1H2AS 4MGZR 4Z7QB 4B83A 4I4LA 3BS4A 3WWZA 4C6HA 1VLJA 4CE6A 1ODLA 3O31A 3H8VA 1OFGA 3HS3A 4ZCSA 2H11A 1KRWA 4QTZA 3TRIA 3BDAA 4K0RA 3SICE 2YS7A 1ZIOA 3UMSA 4DREA 3GFBA 4ESHA 5TS2A 1DE0A 2RHOA 4RHYA 1YCDA 3A8TA 4WXMA 4OEHA 3CA8A 1CQIA 4FZ3A 4BLUA 4BRZA 3NYRA 4YDQA 1ZD8A 3NI2A 3WLNA 4L7QA 3DNPA 5JW6A 4KR3A 4TT3A 1IXSB 5IP5A 3N74A 2VUIB 3OT1B 5FTKA 3T7EA 2ADOA 4EY4A 3FHCB 3KX2A 1CYDA 2IPOA 5HK8A 1CQPA 1YB7A 1Z7YA 1BKDR 2B3TA 4MK4A 4Q4CA 3V48A 3V8PA 3X44A 4CIDA 4U63A 4QPZA 3RV3A 1QDEA 1NULA 1B74A 2D6FA 1XVTA 1QHFA 4JP1A 4PIPA 4X61A 4QNMA 4PYMA 1OLSB 2HGZA 2X8LA 1IN4A 3CSDA 2WWIA 4HO1X 5BWNA 1FX1A 3DF9A 5A6VA 3B51X 4B3GA 1RFGE 4GGOA 3R5HA 1NC3A 2OZLA 1XLUA 2I7TA 1DKQA 2WJAA 1FPQA 3JASB 3WSWA 1UM8A 4MX8A 2JKYA 1SUDA 3CUSA 4W8HA 1P0FA 1VIYA 1EGAA 1WJGA 1YDMA 2I78A 2AOVA 2R6ZA 1I13A 2FEKA 4M9ZA 4R5HA 3K0CA 3NIFB 3T1NA 4EOGA 2RGCA 1Z8DA 2BDUA 3OM9A 2QZSA 2VN8A 3C16C 5LUAA 1ZZGA 3NEYA 4JOBA 4Q9HA 1ZICA 3ZHRA 1E32A 3LT5A 3FYUB 2VZ8A 1CF4A 5EXEA 1HF3A 3QLUA 3JQQA 3LOUA 4G5QA 5D8DA 2EHJA 3ANXA 3Q3CA 4JYPA 5DBOA 3TDNA 5L7TA 3ERCA 2NP6A 1LS1A 1E7MA 3NTOA 4BRWA 1KFBB 1XU7A 1MPTA 5CNMA 5A6SB 4BATA 3T9DA 3O1IC 1TF5A 2F43B 2HMAA 2LCIA 4UW9A 3NASA 1JSLA 2PUTA 4CL0A 3WRWA 2JGKA 4H7KA 3GLTA 2W6JA 2UZ0A 2Z2KA 5IVDA 3T3HA 4EJMA 4BZXA 4ZDKA 2P4EA 4MYRA 3LQ2A 1PFWA 4XQ9A 2J33A 2F8TA 1DRJA 4ES6A 3KRTA 3OFNA 1XVVA 2GAFA 5CVEA 3I32A 4A8TA 5AM2A 4PLYA 2Y9PB 3LLCA 5IJWA 2NO4A 3K9FC 3DVAB 1JQEA 3DLAA 4W9NA 1PNVA 3LLVA 1G20B 4BO8A 3BF8A 1A9OA 4LE0A 4XVRA 2J9FA 2X3FA 1L3CA 4OK6A 1USVA 2RK3A 4ZN6A 2WSLA 4NQZA 4AW9A 4P4SB 1ZI6A 1RW4A 1UKZA 3UQZA 3EPRA 3MD9A 1JR3D 1M8PA 3JW8A 4HZIA 4F4HA 1Y5IA 1HNNA 4G5YA 1MIOB 3AIMA 5DTIA 3VNRA 1B8PA 1P1JA 1UEXC 2YWDA 3U19A 2GZMA 4MUAA 5JD6A 3GCDA 5K0BA 5B7PA 3L0IB 1DBPA 3CLSC 4MYSA 3TW0A 3VHQA 1N34B 2X58A 3QW2A 4TTQA 1VL6A 3KELA 4LZLA 2XVYA 4C0WA 4DS3A 4JA2A 5KQRA 2RBKA 3AP1A 4DMUB 1ID1A 1QPZA 5CEJA 4M54A 3S2UA 2P7IA 3WWYA 4H4CA 1G21B 2A3RA 2LDBA 3AI1A 4Q3OA 3WO1A 2EKQA 1TJ4A 3QBDA 1YQWA 4F8JA 1E2JA 3TQFA 4CODB 2W00A 3HBJA 4FNMA 4MIYA 4PSVA 3VM6A 1ZQ1A 3H5LA 1C81A 2C2OA 1JU3A 5EKTA 2CEAA 3TX2A 3ESXA 4HQOA 4IKPA 4XD2A 4LOJA 2YMQA 1T43A 4BC1A 2XD4A 3D8RA 5AVQA 1X7WA 1Z39A 3LT1A 4Q3DA 1HLFA 3UT5A 5EP1A 3BXGA 4L0MA 3BMCA 4U39A 3Q9NA 4R3UC 5ICMA 2CT8A 1TVMA 3VO2A 1KOJA 3WR5A 1QVRA 2FW7A 3IPCA 3K20A 5REQA 1DWUA 4I08A 3S3TA 4LUCA 4BJ1A 3TIXB 3ZXSA 3BMOB 1WDWB 3NG1A 1TYAE 4CF7A 2LIVA 1TEXA 1XWFA 1H5QA 1VDZA 3IMCA 1QAMA 4HLUA 2GAAA 2Y71A 4RORA 5IJZA 1J2RA 4RTNA 2XCSB 3OWHA 4S3MA 5DNEA 1J6UA 1O96A 3BHMA 4FT2A 2NTEA 4OU4A 3GJ5A 2EP8A 4RPJA 1ZCAA 3FFXA 2W4IA 3WMXA 2VJPA 5CG1A 2FPGA 1QK5A 1BMFD 3W6UA 2VDJA 1B41A 4NV1A 1G3RA 4QYIA 4ZAVA 5TMPA 4YJ3A 3RARA 4YJ2F 2QG9A 4IUYA 3T0GA 2JATA 1N1EA 1LWNA 5F1YA 1EVZA 3FGPA 2W2OA 4MLZA 1LH0A 4QOGA 1G0NA 3ZDXB 5JQGA 1CZLA 3EEOA 5K0SA 1PL6A 3KOXA 1ZNYA 3QENA 3S1LA 3OQBA 2Z3WA 4PO3X 2Y68A 3H0KA 5JXGA 5AJWA 2PT9A 1I3OA 1KF0A 1K7EB 4FP9A 4YT5A 5IAOA 3EBLA 4F0JA 3SYNA 3Q98A 4RFVA 5F5LA 1JAXA 1WVIA 2QORA 2ZITA 4DCUA 5LZ5A 1MQSA 5JYBA 3R1IA 2X42A 2EF0A 2FCAA 1WOMA 3M2TA 5IJXA 3UMBA 3WLEA 4GM4A 4CR7A 2WJVA 5CBPB 2B4TO 2AJDA 2GR9A 2HK8A 4BL5A 4AJ4A 1T1JA 2QUZA 2VJYA 1B0PA 5DM1A 1N78A 4UJ3A 1EA5A 2D5IA 4AUEA 4OHRA 3N2GA 5JPIA 3W2TA 5ARBA 2NSLA 2WJ6A 1RIIA 5KQLA 1VSQA 1MOQA 1WKCA 3D02A 5CGQB 1ZNWA 3UWOA 3TWOA 5EJ6A 5C1OA 2P4UA 2GZ3A 3AG5A 2X9LA 2X2EA 1PGQA 1KI1A 1QPBA 2OCPA 5SYMA 1SA0B 1NZDA 4YJFA 1GUYA 4C3VA 4DXAA 1CY0A 1E99A 2FE4A 1U28C 3D1VA 3ZWQA 4OX9B 1B8NA 1T34A 4OOFA 3IIJA 1G5HA 2AB0A 2G5CA 2IKSA 5AKZA 3PQ3A 4RM3A 4B7AA 4F9FA 1FW6A 3ZKWA 3ZR4B 2P9YA 7GPBA 1FYXA 2BMAA 2R5FA 4M0CA 1EJ0A 1PZHA 5BRJA 1SHLA 4JJAA 4BVAA 3NIDB 4G41A 3E5HA 2G7MC 3PCRB 4D26A 1WB6A 1JE1A 3DTVD 5F2NA 3EWSA 3CW2A 4HWGA 4JFRA 3SZMA 3GN1A 5LIRA 2PJZA 3G2JA 4G65A 5GIOE 3FM9A 1MR3F 2A94A 3T0FA 4J43A 5AI0A 4M3NA 2ZDGA 1Z5GA 2NV0A 2YV4A 1CUSA 1I1HA 4M1ZA 4M55A 2B7LA 4N3AA 1SJ9A 4E94A 1CUVA 2V7UA 1RHQA 3CVJA 3PNBA 3GCZA 3GAAA 4JKOA 9ATCA 4CLDA 2CWWA 4ZAGA 4R31A 1PL8A 2BF4A 2WWFA 4JUDX 4X8HA 1II0A 3AI7A 3O47A 2NUAA 3BMNA 3OIWA 2VBIA 1YI1A 2ZSDA 3TVDA 4LECA 5ITZB 4IW3B 3NHLA 1KVTA 4ARZA 2DLNA 1D2RA 4L16A 3ZCTA 3AJEA 2JH8A 2N75A 2OAP1 1EHIA 1AQUA 2YWGA 1COWA 1X1DA 1FB5A 3ML1A 5DYIA 4DCJA 4GKBA 5TF0A 2C04A 1QYCA 4EG3A 4IGFA 4C43A 1Q21A 3RTBA 1Y1KE 5HIIA 1CDDA 1XTRA 1II8B 2GT1A 4FXPA 2Y2UA 4TMWA 3QI2A 4U2DA 3JATA 3TOSA 2RI1A 1I36A 4OSOA 4D44A 3K1AB 2AT1A 4MVJI 1D2NA 3PE6A 3FTNA 4FDUA 2BBTA 2YRWA 3QW4B 3PX3A 3HJHA 5LMCA 2V74B 1GG9A 2R6DA 2FSSA 4KAAA 3WLIA 5KWIA 2ABWA 4I9GA 2AC7A 3ABSB 2C07A 2HX1A 3DVSX 3FZQA 3OP4A 3C48A 4QSHA 4I36A 1EUDB 2VUHB 2WUGA 4PYKA 3W8NA 1KYVA 1LW7A 3BRWA 1NMZA 4UAGA 4K5QA 1V5WA 3WBBA 1DLJA 5AVTA 3TLGA 1YDGA 1ACLA 2QD3A 5HCNA 1XCLA 5EJEA 5GZ1A 3H8WA 2NNWB 4NPCA 3WZ2A 4EF4A 2AOXA 4RV9A 3I9FA 4JP5A 3MIZA 4YBZA 4EPTA 2QF7A 1RWBA 2MYPA 3ZWCA 1U9ZA 5DHAA 4A8JB 3ZDBA 2FVYA 5CPFA 3RVDA 5IJ0B 1M1ZA 4F91B 1K8ZB 2BH2A 1VKNA 2QA5A 1N6LA 2FPRA 1KY3A 2GUWA 2QJWA 3LBHA 3CLRC 2AN5A 2OPHA 2ZYAA 3GDHA 1LPSA 2RGDA 4LA4A 2PM8A 1ID8A 1NV9A 2EFCB 2IFTA 5EYPA 2EBWA 2WWRA 3D5TA 3TYXA 1SXHA 1J99A 2CLCX 5JOQA 3GLGB 1QFZA 1X9IA 2EZTA 5JCJA 5TMEA 3RC3A 4C78A 2A7XA 3GFOA 2QTVA 3ANYB 4ZXFA 3PQ4A 2C42A 3M5WA 2QIPA 5K6AA 2PLNA 2NSHA 3C15C 3IB3A 3PS9A 3IEUA 4G01B 1OYYA 2BMJA 3JWPA 2VRWA 4RQBA 4I6EA 2IEZA 1UL1X 1YOVB 4ZCIA 5IBCA 3EGVA 1M83A 2VNHA 1EFVB 4B6FA 3OEWA 2ZBUA 1TFRA 1VJDA 2ERYA 4CM8B 3F67A 5KPJA 5C81A 2NN3C 1IYZA 4MEBA 3TLGB 2Y99A 5D6NA 1G8FA 2G9RA 4YR9A 3BQ9A 3W6NA 3VO9A 4NH4A 2G8LA 3IO5A 2ZUWA 2VWGA 4LSZA 4RNCA 1P29A 1RAEA 1DAHA 4N0EA 1K5GA 2ZYGA 4PPQA 3UHPA 1JILA 3P9ZA 5LP6A 3PVZA 2NTJA 2JGRA 4H1HA 5ERYA 5KQPA 1Z5ZA 2H2WA 4TYNA 1E4EB 3A2MA 3H1TA 4BO4A 1FP2A 2CFRA 2G71A 2ZSJA 1H85A 5BUCA 3K6JA 1OVGA 1RADA 1XX6A 1KQFA 3C39A 3FF4A 4XGIA 1Y9DA 4FILA 3T4EA 2IQ5A 2V6BA 4E2ZA 3A36A 1NVKA 3RYIA 2Q5QA 3RWOA 2GUGA 3IOYA 1CNFA 2AL7A 1AKNA 1YL5A 6PFKA 5ALZA 4GR9A 4Q5IA 1JFFA 1XVIA 3KLBA 2QTVB 1HG1A 4CLXA 2Q6KA 1NZFA 4ZAFA 2BFFA 3C43A 4D0SA 2G1PA 4UZFA 1B15A 2YQ5A 3HLKA 2QV0A 3CY6A 3FVQA 4HBZA 4MA4A 1IBCA 2DKFA 4J6FA 1DHRA 4L4SA 1QGZA 2WB2A 3BMNB 2NUAB 4O2AF 4E46A 5A0TA 3DMPA 4Q4JB 4CZ2A 4NS4A 4JVMA 1A4IA 3UT0A 2HU5A 4DQ0A 1WV0A 2O3SA 3THYA 1YVRA 2E4XA 4BGVA 4TS1A 1DAOA 1I6KA 3HI4A 1STOA 4QFCA 4BKRA 4MWZA 4ER7A 2WTAA 2ECKA 5BN3A 3NCHA 5CX4A 2O19A 3S29A 4EUKA 3PDIA 4B6SA 3AF6A 4FFNA 2JBWA 1BZYA 2Z98A 4URYR 1DC5A 3K9BA 1B16A 3FCUB 1NXWA 1G17A 1R16A 5IJAA 3T1VA 1KI3A 1QCZA 3KOZA 2FMFA 3WL8A 4O4LA 4ALNA 3QLVA 2BF7A 2HLDD 2OHGA 1L5FA 1O7JA 1Y1LA 5JMWA 4GRIA 2XMBA 4GSYA 4BX3A 2FUKA 1D04A 1B76A 2JFOA 1G3MA 3BBLA 2PX6A 2O50A 1KJ8A 2RGUA 2O1EA 4JCOA 4J7UA 2Q6TA 2L17A 4PLHA 1B0ZA 3S8EA 3UANA 2E4WA 4PXYA 1D6SA 1T4GA 2LPMA 2LRHA 2UZ3A 3CKMA 1AQNA 4Z4EA 2ZZNA 4G1UC 1YS1X 1RJGA 2JJYA 1KBZA 3KYIB 4IDDA 4IOJA 3QHAA 4BX8A 3GAZA 2OCAA 1PQPA 2H1SA 3JD4A 3MF4A 1UBFA 4EBBA 4W8OA 2ZZKA 3R8XA 3TLAA 2J3DA 4FLFA 3Q15C 4ZVQA 2VQFB 1SNYA 4ZU1X 5DHQA 1REQA 1ECFA 1RTKA 2WSYB 3AMVA 3P2IA 3Q4GA 4YP5A 3WGVA 5BVGB 5C8VA 3MLBA 3IKJA 2DFDA 2ORWA 3K0CC 2OLJA 2XDQA 5BSVA 4MKRA 1ZG3A 5COQA 1BXGA 1VMEA 4BV3A 4FGKA 4IYRA 3VNVA 4PNPA 3L6BA 1MLDA 2GYYA 3EXG1 2XUIA 2FRVA 3V7UA 1Q7EA 4ENUA 1Y6ZA 2E48A 3IHTA 5GONF 1C3OA 2CMKA 1P7WA 1ZJ4A 2IP1A 3RK1A 1DWQA 2C29D 2XMRA 3DM9B 2GD6A 1OXKB 3F9CA 3NBKA 1AMUA 2C2YA 3M9XA 3EFOB 5FWYA 4X7MA 2CCKA 4B3TB 4RQUA 5IK2D 2R5WA 2Q99A 1DIHA 2NZVG 2GKSA 4N47A 1OH8A 4RCYA 2ENUA 2I4RA 4IOMA 1T4CB 1PT9A 1T36A 3EC7A 4YJGA 1FQWA 2QVYX 5KYWA 3OI7A 2RBGA 1CU1A 2MR6A 4NJEB 4TVBA 3BGSA 3T7IA 4W8GA 5KNBD 1YC2A 4S1WA 4LYDA 3IP7A 4QQKA 3LP6A 1U0JA 4MIEA 3OCCA 4MKXA 3A4LA 1NZJA 1EFCA 5G1OA 4AYTA 2GSWA 3RS4A 3UV3A 1PX0A 4KV9A 4CKWA 4JEUA 3ZGVA 1SHJA 1GUAA 5IT4A 4HYTA 4K1LA 3WLRA 2HOQA 4K9QA 3W0LB 2YJGA 3PLAE 3WL6A 1FDWA 4BVFA 4WNYA 3PITA 4Z3OA 1ZHFA 1DJOA 4I81A 4Z2AA 1TO2E 2BDTA 3O4GA 3OOWA 4AXBA 1KAHA 3BCHA 2CDBA 2QS9A 2XQKA 3OU6A 1SK9A 4INOA 5C51B 5HPYB 1GDDA 621PA 2TS1A 3SSNA 4HUQB 1L5KA 5P8WA 1LY1A 3WLMA 1YTLA 2OXEA 3PJDA 1NUPA 4E7PA 3K5HA 1E20A 4PIMA 2I2DA 3L6EA 1NXPA 4R1MA 4IIBA 3ZVNA 1SXPA 3RIGA 4MUIA 1C1YA 5EVJA 4ZI2A 3KEQA 3C3AA 2AMYA 2WHRA 5EZYB 2UXCB 1VHQA 4YRDA 2NVBA 2W6JD 3BREA 1JN0A 1V95A 1RNLA 3G49A 5IW8A 2BSXA 1OT5A 1V11B 3K9HA 3T4XA 4YIKA 1KMIY 1RABA 1WBJB 5KNBA 1T4DA 3RK0A 3CSUA 3OJOA 2E9SA 5FWXA 1QYXA 2NO6A 4LXUA 2YWEA 3FFBA 3T3MB 2YJ3A 2RBEA 4UQLA 1CUAA 3PEVA 3CXUA 2PGLA 4V2IA 2XRFA 1CEXA 4YUXA 3TK1A 3AVUA 1ZM4A 1LJLA 5A1JA 3AFIA 3R9IA 5DVZA 2WHYA 1JAYA 1NBIA 5BURA 4OVKA 2RC5A 4AZVA 5BUQA 3UA3A 1KARA 1U0OC 2FQ1A 2ZVPX 3DR5A 3NBXX 4P6VF 4Z9FA 2BE7A 2J5BA 3RPEA 4AP9A 2D7JA 4EY7A 1J39A 5HRCA 1HE1C 3DL2A 3CKYA 2ZTVA 1U98A 4UD6A 3IP8A 3NOXA 1WDKA 1BC5A 1SUPA 3E3MA 3IUSA 3OQIA 1DLIA 5E7QA 1C4KA 1LJ8A 2BKUA 2FEPA 2VBFA 4AS1A 4OGLA 1RZRD 2G9QA 2DWUA 3UH0A 1CDZA 1T3GA 5DLYA 4V1CB 2IXFA 3QLJA 3RROA 3SHTA 4Q6WA 1FX0B 3CJQA 4BO2A 1HA3A 1JX6A 1WZUA 2VAWA 5JH7F 5KHLB 2MCFA 2B69A 4YV7A 3H04A 2GPAA 4P3NA 2HJSA 1CVRA 5ALEA 3O6VA 2GJKA 5EJAA 1JBQA 4X65B 3N2YA 4JVOA 3RWBA 4U2CA 4FFPA 5H3CA 4H35A 2LD4A 4IJQA 1XROA 2F43A 2QPLA 2EG5A 1U3TA 1YR6A 2AFIB 2H2GA 3NO4A 2VTBB 2QW0X 3QHQA 1GWNA 1PJ4A 1FNNA 2X23A 2CLDX 2ZRQA 5DLDA 4PC2A 4QUJA 1R3UA 2FW0A 3HABA 2G25A 1GAEO 4DWWA 1L1RA 4M0LA 4BNMA 2CFCA 1FYFA 4WKOA 1MZPA 1A04A 1TM7E 1E7YA 4PSDA 3UB3A 1VSVA 2WC1A 1E4VA 3CH6A 4C7XA 2I1QA 3G68A 3QNWA 1UBLS 1WMDA 3Q1KA 5FJIA 2F1HA 4INZA 4RTOA 4IGEA 4G07A 4FZRA 3GLFE 1FRFS 1OBHA 3LYAA 4YTEA 3WHLA 3LLUA 1LK7A 1KZGB 5HKOA 1EBFA 1EH5A 2FZVA 1EK5A 2D5CA 2I80A 2W6QA 5H3LA 1I4LD 1H0RA 4JBXA 3HJCA 3AV3A 3MMXA 2GPYA 5LWQA 2F00A 2J3HA 3K09A 4LK2A 4MRAA 3SS7X 1G1MA 5AK3A 1BMFA 1DJQA 3N0VA 4WKPA 5I7RA 2H4HA 1ZD1A 2Y27A 1EUQA 1JTEA 2QL6A 3N8NA 2AH5A 2RHJA 1NJ2A 4IOKA 4D98A 1EESA 3QJYA 3HU3A 4O2BB 1ECJA 2YJTD 3NBUA 4LVCA 4XI9A 3UN1A 4B87A 1IIBA 4FS3A 4M8LA 4BQIA 1NBOA 3J81A 3F90A 1KVSA 4IIJB 4KPUA 4YI3A 1V47A 1M66A 1Z0JA 3AERB 3K9LA 4RMJA 5FV4A 2Y0CA 1F2TA 1O94A 1KWGA 1GPKA 3RVRA 4M89A 3QY0A 4LRQA 3ZJVA 3S1AA 2H7CA 2EOAA 1MHPA 1IPHA 1T8RA 3AEXA 1PO7A 5KNCD 1R8YA 4HQ6A 1CR2A 2X40A 2H1HA 3I72A 1DWPA 1GSIA 3LCRA 2Y6VA 4OFZA 3O4IA 3QX7A 4G67A 4GZ6A 1H4SA 5CVJA 4RMIA 3GGSA 5L53A 1OYVA 4ZEMA 2BGNA 4M0EA 1E3TA 2GDZA 1NQXA 3QVJA 1U0SY 3J7TA 1QV9A 4HTAA 2ZJBA 4AKGA 1T2CA 3IQEA 2AQIA 3W2GA 4AU1A 1L5HB 5CXUA 3C1UA 1QUEA 3PICA 3RVLA 3VR0A 3I9LA 1SCIA 1PJSA 1VIDA 1VXOA 2HF8A 4CM7A 1JEYB 4S05A 3KEFA 2HSEA 4DCMA 3FYTA 3GEMA 2IZZA 1L7QA 3RRJA 3PFWO 4CM5A 3HBNA 3OQ1A 3ZHQA 1U7DA 2VHZA 1ULUA 2B4AA 1FP1D 1UODA 4LF4B 4B9EA 10MHA 4PTZA 2P27A 4BO7A 4CKEA 5I7AA 1FFDA 2RHLA 2WF8A 1VSUA 3MB8A 4M1QA 2UUCB 1PS8A 4ILEA 3CN7A 2OC9A 3RFXA 3C3CA 4YUZA 4O2AB 1SXJD 2QRLA 1QG6A 2PIAA 4M4SA 4DF3A 2F9MA 4TSRA 4ZT4A 2YBDA 4B46A 3EX7C 1UAAA 2W6ID 4F5YA 1Z26A 4BO0A 3FUTA 4GIBA 4CLOA 3A1DA 3AUSA 1IUOA 3DNMA 2H1WA 3THYB 5JPDA 1C8BA 3H3FA 1D7AA 4DUPA 1X1TA 1TTPB 2JA1A 1FU7A 3OLVA 1Y4ZA 2AR7A 2J5KA 3HKDA 4RWZA 3SZ3A 3VXKA 4FJ2A 2WINI 1UH5A 2D0DA 3PZBA 1E2EA 1FRNA 1SBTA 4Z9YA 3R7AA 3O8LA 4IVNA 1Q15A 4JL5A 3L8ZA 3EGCA 4OD0A 3C8HA 3ZHYA 1O5TA 1ES9A 1BXRB 4N0PA 1DWOA 5L7WA 1W7AA 3IBGA 4P92A 2BGJA 1NTOA 2P0AA 3MOSA 1YBMA 2WJWA 3RYIB 2JI9A 4TRJA 4GPIB 3VNBA 5IWCA 1NVBA 2UU9B 2WUEA 1WIWA 2H31A 2P68A 3F96A 2VUSA 1COWD 1KMHA 1VKJA 1S6YA 1Y80A 1ZMBA 1I4TD 2XCLA 3QVWA 4MUEA 3V6MA 5DRTA 5DBFA 4ZZIA 5K8VA 3EA5A 4WZBA 4IZ6A 1PHPA 4ISCA 2L42A 4MJ7A 4BY9E 3CX7A 4TXHA 4IKEA 4JUAA 4MA0A 4D8XA 1YQXA 2YXPX 3BG5A 1UMDB 1IWBB 2BEVB 3JD0A 5E9AA 3UICA 3ILVA 3CVVA 4Q3EA 2JLZA 4RWEA 1WU8A 4WE3A 1KEEA 4JL6A 3HI6A 2G9VA 4CMJA 5IXJA 1Y89A 4LBZA 4MW5A 4YXWA 4AY2A 1FXUA 1QHNA 4MQBA 5BPHA 3BIJA 1FCJA 3N6VA 5CA0A 4DBZA 1PNRA 2CNDA 1SUWA 1L4FA 2IEDA 2WHPB 3I9OA 3VC2A 3R3SA 3IB6A 4LYEA 1UDBA 5JZOA 2BEWA 3V46A 3HCBA 2QRQA 1RKUA 4YECA 2C3MA 1E3MA 2V6FA 2O4CA 2IF2A 4AF6A 4TKMA 4M0UA 3GO4A 4YAKA 4QFBA 4X95A 5HIAA 3EVZA 4NDNE 1R4NB 4ZQBA 3A9TA 3D0OA 3N8DA 4JC5A 4F4DA 4NOLA 1QOQB 2C83A 1VG1A 2XV1A 3DDZX 1GKUB 1FUUA 2RHTA 1OWPA 2VEDA 3QOXA 4UATA 3QUAA 5A9RA 3CEHA 1XZPA 1IHDA 4D45A 2PV7A 2OV1A 1T3TA 3HGQA 2PWBA 3ITNA 3GD7A 2QX6A 4JI0B 1M6HA 1YCFA 5I9LA 1E1MA 2ECOA 4RSGA 3VPHA 1DINA 2KBEA 5CM8B 5CNJA 3K8OE 5K3FA 2HA0A 3W5IA 4RIHA 5AJTA 3STXA 4OQMA 2PXAA 2V7QA 5IAKA 4C3ZA 3OPYA 4X7PA 4BU0A 3WP1B 4KQMA 1CT9A 3VZQA 1R9MA 4GDMA 1UC9A 3FETA 4C2BA 4IHKA 1QF6A 4PGHA 3DXZA 3T34A 1ISHA 3DWEX 2F1KA 5COBA 2ORVA 3HSSA 2P2DA 4LSGA 5B4UA 3WKDA 3C6KA 5THKA 5KYNA 3AFGA 4PC3A 2EERA 3TH5A 1Q20A 1SVWA 1T5BA 4PVDA 4QOEA 1FTYA 1DFHA 3HJTA 4G4JA 4XIFA 3SI7A 1SXJA 1U0NA 2NZUG 3HCPA 2XF2A 4PBTA 8OHMA 1U0HC 5LD2B 3GFFA 3OOYA 2O0MA 5D85A 2YNMA 3AKZA 5B3JC 1GR0A 2HWYA 5EXXA 2WBLC 1TM3E 1XDUA 3JQBA 4NJEA 1AKTA 1YKGA 4XLZA 3GIDA 5AK5A 2I4MA 4ZI3A 1E63A 2EQAA 3CZRA 4BS9A 1RYFA 2D13A 2W7TA 1X7XA 4X54A 4JFAA 3OQPA 4LGYA 3S55A 2JHPA 4XYEA 1SVUA 1GTG1 1XDSA 2GF9A 1B1CA 1H6BA 3AETA 1KI8A 1SUIA 4YRAA 3O4RA 4N39A 3DC2A 1UM9A 3SEQA 4X41A 5TPWA 2OD2A 4FS8A 4K6MA 4YMWA 1J0XO 1UM9B 5FR1A 3PA6A 2AKEA 4R81A 2QVXX 3DO6A 4AF8A 1MAVA 4LZWA 3W5SA 2Q50A 3T4UA 4RPLA 3QMPA 3REOA 4D4MA 2OYRA 3OEEA 1YVPA 1MNQA 2AYYA 2C78A 4ISBA 4ND5A 1NN3A 2VUTA 4N8EA 1XRJA 3GA7A 4S24A 3TLJA 1O96B 3G59A 3K15A 4MRMA 4B4VA 1W73A 3NTQA 1N5IA 4LJ6A 4M9UA 1VJGA 5BV1A 2H1IA 4F2GA 4PG6A 4AJJA 4FHDA 4MQFB 1C4OA 2PUVA 4EB3A 4MMXB 2WHXA 4C22A 4IDBA 1GTZA 3H2KA 5DTRA 4EHFA 2C4HA 1E3LA 1XDDA 1TYDE 2F17A 2VF5X 2ZT5A 4B85A 4DNQA 5KX5F 1SC3A 2OA0A 3WQQA 2IZ5A 3AI2A 2A9QA 3IBTA 4LY9A 4QTUB 3K53A 4QICA 5FUYA 2QVZX 1VJRA 3HJNA 1P0PA 3QVTA 4HQNA 5JV5A 3GEHA 3HU5A 5F52A 2IXEA 2X8BA 4RHXA 3TOXA 2QTHA 1HQCA 2JLQA 3OQ6A 4GMXA 4H1UA 2QT9A 3PC4A 4J0HA 3U44B 2GTHA 2YZNA 4RF3A 4DR6B 1DOAA 1GL9B 2LTAA 1BAPA 1HLPA 3LDUA 4HAVA 1IM8A 2I1LA 2I2FA 1P91A 1OXVA 2CNOA 1N32B 1B00A 3D4PA 1PGJA 4PFSA 4H3KB 3DS8A 2UUOA 1EFVA 2AZDA 1SCBA 4EP1A 5AVWA 1E4YA 2EG9A 3SNHA 4BPRA 3L4EA 4Y1FA 3MXOA 4BXOA 1MABB 3TQSA 3A3OA 2IOYA 5DHFA 5J5AA 2QPAA 1QTRA 3QEMA 4M8SA 3GROA 3T15A 2QN9A 1BWRA 2Q9CA 3VYTB 5C8ZA 2NZ8A 2ZBEA 3B52X 3QZUA 2NG1A 3FFAA 1R4MA 1U1CA 2CSXA 3TCKA 4XWGA 1T8UA 2WJPA 4MI6A 4DZZA 3LUGA 1GRVA 2A1UB 4KUGA 2YJ5A 3DCJA 3DQPA 5AMXA 2DHDA 4FT4A 3PFCA 2PRSA 4GPBA 3NU1A 3VJMA 1ZK3A 4YHBA 2F55A 4C3UA 1SHZA 2NAFA 3EOBI 1KGSA 4INJA 3V1YA 4E30A 2HSGA 5JBIA 4CQLA 1V9LA 4E2YA 1J21A 1PEDA 2A9FA 1ZEMA 2WTEA 3BMOA