1N5DA

Crystal structure of porcine testicular carbonyl reductase/ 20beta-hydroxysteroid dehydrogenase
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
288
structure length
288
Chain Sequence
SSNTRVALVTGANKGIGFAIVRDLCRQFAGDVVLTARDVARGQAAVKQLQAEGLSPRFHQLDIIDLQSIRALCDFLRKEYGGLDVLVNNAAIAFQLDNPTPFHIQAELTMKTNFMGTRNVCTELLPLIKPQGRVVNVSSTEGVRALNECSPELQQKFKSETITEEELVGLMNKFVEDTKNGVHRKEGWSDSTYGVTKIGVSVLSRIYARKLREQRAGDKILLNACCPGWVRTDMGGPKAPKSPEVGAETPVYLALLPSDAEGPHGQFVTDKKVVEWGVPPESYPWVNA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CARBONYL REDUCTASE/20BETA-HYDROXYSTEROID DEHYDROGENASE
publication title Porcine Carbonyl Reductase: Structural Basis for a Functional Monomer in Short-Chain Dehydrogenases/Reductases
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 100
structure length 288
sequence length 288
ec nomenclature ec 1.1.1.184: Carbonyl reductase (NADPH).
pdb deposition date 2002-11-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00106 adh_short short chain dehydrogenase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n5dA00
3EY4A 4HFRA 5C7IO 1Q0HA 1HE3A 3JD2A 9LDTA 4HKTA 3U5TA 1OOEA 4EDFA 1E1LA 2ZB7A 1D3AA 3DAFA 4RLSA 4CQMD 2PFGA 5EQDA 4DGSA 4EJ6A 1DSSG 4QX6A 3ZHXA 4JJFA 4NK5A 5ICMA 1OI7A 4XWYA 1QSGA 5TJHA 1NAHA 5JYEA 3VH3A 1GD1O 4J1NA 4IDEA 4QECA 1PS8A 4R68A 5KVSA 2JCXA 1U7TA 1DB3A 3ZH2A 1D1SA 3KOUA 4UVEA 1RKXA 3DBLB 1QG6A 1AN9A 1C14A 1WZEA 1H9BA 1ONNA 1ZH8A 2EJWA 3IIEA 4Z3KA 3MEQA 3ZNOA 4RPJA 3HN7A 1CQJA 4AJOA 2EIHA 2O3SA 5EJ2A 1PWZA 2FR1A 3ZHZA 1EVZA 1O8CA 2DFDA 1EDZA 5DBIA 1LQUA 5ES3A 1WZIA 4QTZA 3VKVA 3ASVA 2PGLA 1E77A 3C1TA 3JQBC 3VPGA 1AXEA 2D4AA 4MKXA 4CQMB 4N54A 4W7HA 1ENZA 4UEKA 4BGEA 3H6KA 3L6EA 5L7TA 2O4UX 4ZN6A 3S55A 1WVGA 2Y1EA 2YJZA 4BO3A 1BXKA 3EZLA 1QYCA 4GI2A 1ZSVA 2DM6A 3BTVA 2ZK7A 1ISGA 1PSDA 3ADOA 3FTNA 3DO5A 5F1OA 5A5FA 3HHPA 1KIFA 4A0SA 1PU2A 5K6AC 1GEGA 7ADHA 4OMUA 4JIGA 2O50A 4HV4A 5CEEA 2Y0EA 2GR9A 4JNKA 4ZQBA 1MC5A 2ZIZA 3CPSA 3PRJA 3KV3O 2P5YA 4KMSA 4UUNA 3GEGA 3JQGA 3UXYA 4PIVA 4CMEA 1C1DB 1YE3A 2FSVA 3GMDA 3PVZA 2V6BA 1I2BA 3LLSA 1Z73A 4GAEA 4DC1A 2OUIA 2Z5LA 1R4MA 4Z0HO 4L4XA 4CMJA 3MWDB 5CDUA 5HM8A 2Q45A 3I23A 3SJ7A 3KZVA 1GTMA 4BB5A 1KETA 1DEHA 1LA2A 5EQFA 5T5QA 5JBIA 4YJGB 1DC4A 3OM9A 4M87A 1BDBA 2X8LA 3NV9A 3RU9A 1VJ0A 1JKFA 2XF8A 4FGSA 4PLFA 3GGOA 3G3EA 3DHEA 1NVGA 2NTNA 4W82A 1DIGA 5F1PA 4MKZA 1XSEA 1UR5A 1D8AA 4RQTA 3O38A 4AJJA 3AY6A 4MVJM 4ZICA 4L75A 4TSKA 4N18A 1KERA 1P1KA 4RV9A 5BNTA 3BTSA 5DCYA 1QLHA 1Y5MA 3DMTC 5THKA 1K6JA 2ZTMA 1C1DA 4OXKA 2O3JA 5DZSA 1YDWA 5TRTA 4DPKA 3L6DA 3K31A 4LMPA 3WYEA 4Z6KA 4HWKA 2NWQA 3GFBA 3WJ7A 1R4MB 1PGPA 3QE3A 3PZRA 3SEFA 1HF3A 2VYVD 3UAGA 3ZWOA 2ZB8A 3LVFO 4CM9A 1DXYA 1C0LA 2P4HX 1NPYA 2ZB4A 1HDGO 4HFNA 4ZHSA 1HEUA 3DOJA 3B1KA 5H81A 2WM3A 2Y67A 2G1UA 4Y67A 4J1TA 3AU8A 6LDHA 4CLXA 3S8MA 1X14A 1DLJA 4GL4A 4H3VA 4OKNA 3F5QA 4AJ4A 5TIIA 3HB4X 3GZ4A 4GVXA 4WLFA 4ZA2A 4I9HA 1H5QA 2CVZA 2YDYA 3EYWA 3BMOB 1PJTA 1GUYA 2D5CA 3HG7A 2AG8A 3WMWA 1YXMA 1GZ6A 3D1LA 5BT9A 4M86A 3BHIA 4KUEA 4RPLA 3U4DA 3V2UA 2X9GA 4E13A 5CPFA 3UHAA 2X4GA 4ID9A 2VYNA 3PWSA 3FF4A 3C3XA 4J7CA 2AQHA 2AEMA 2JFGA 5JAMA 1NWHA 4R41A 7MDHA 1VL0A 2Y1FA 1B8UA 3GK3A 4K28A 1U8FO 3HE3A 1F06A 3WOHA 2QRJA 1LRJA 1NASA 2JD1A 3EVNA 4L4SA 4XJSA 4HNHA 5TF4A 3GY0A 1LXCA 4CMIA 1AGNA 3UF0A 1E1NA 1LNQA 4AL4A 4AFNA 3GDOA 1I3NA 4K9DA 1UXJA 4I9NA 3BMOA 2CD9A 2JFFA 3D0OA 1KEUA 3GVHA 3PWZA 5HBRA 3ONDA 4XQ9A 3GAZA 5HA5A 4ALMA 2NU8A 4AJHA 4B7CA 4BNFA 1TLTA 3HDJA 1NBOA 4OSOA 2OBYA 2R00C 3CXRA 1R4NA 4WECA 3PYLA 1CETA 5KWEA 4KP7A 1TXGA 3PQFA 3H7AA 4J9UE 2Q49A 3DOCA 3NJ8A 3K6JA 1I3KA 3UW3A 3QJ5A 4YT4A 3TZQA 4OHUA 4R1NA 4IIUA 1KC1A 3OQ6A 3U62A 4YRAA 5HWSA 2ET6A 1LSJA 2ILTA 1N1GA 4ZQEA 4DLLA 1F12A 1E7RA 3SC4A 5TT1A 3AY3A 3U4IA 2JCYA 4NQZA 3EUWA 4XQGA 4QUKA 3EGOA 5CEJA 1T2FA 3DZIA 4PLCA 3NT2A 1S6YA 4P4NA 4XJTA 1MFPA 5I9NA 2IEDA 3COSA 4CL3A 4D0SA 3AM5A 4GLLA 1PZEA 3JYLA 1ARZA 5CAEA 1GUZA 1NQ5A 3TZHA 3CTMA 3IS3A 3NX4A 3ZWNA 4BNJA 2QW8A 5DBFA 4TZKA 4J91A 1XYGA 1ZCJA 2GPTA 4L76A 2IYOA 3ZV5A 1K5HA 3DZHA 3JV7A 4GKBA 5T57A 4W6ZA 2D8AA 3CUKA 4ROSA 3EAGA 3C8MA 3GNSA 4WPGA 1BXGA 3WLEA 4FJ1A 4KDFA 1ISIA 3JQAD 4CM8A 3QVTA 3KYBA 1U4SA 1VJTA 3MTGA 4L0QA 2WE8A 4DQXA 1LLUA 1O6ZA 5DULA 4BOYA 2XXBA 1P74A 3NRCA 2G82A 3GA0A 3OICA 4HFJA 3O4RA 1JW9B 1NAIA 2VT3A 4ZQGA 2OO5A 2Q4BA 4B3HA 5BSFA 1Q0LA 1V9LA 4M49A 1PGJA 3N74A 3H4VA 3NDRA 2I65A 3ZCXA 3ZWAA 1NYTA 2GASA 3VZSA 4TRMA 4WLOA 3TDKA 3OJOA 3RQSA 3RBZA 4OM8A 1NVMB 4WCFA 2VZ9A 1NPDA 3JQAB 4YA6A 3KVOA 3VZPA 2EKPA 4A27A 1QKIA 4KQWA 3OA0A 3QHAA 1XU9A 4IJUA 3RFVA 1LQTA 2YW9A 2X7HA 5I7EA 5JPIA 3LC1O 5B4VA 1UXHA 2HMWA 3I6IA 2YY7A 1Z82A 4RF2A 2C7GA 4CJXA 3Q1LA 3K8ZA 1ZSYA 1QORA 4GWGA 1V35A 1UAGA 2LDBA 1V6AA 1JQBA 3H5RA 2AQIA 1R37A 4O0LA 4MP3A 3V2HA 4OXNA 2EGHA 3JQEA 3E9NA 2PLAA 1F8FA 1JTVA 2FHSA 2OL4A 2X86A 3BXXA 1Z7EA 4FOOA 4OYRA 5IJZA 4IGEA 1LSSA 4ZJUA 2DLDA 3MJ4A 1DFIA 3F9IA 4B7XA 4DVJA 1G0OA 1P44A 2Q1TA 3H8VA 4ND3A 1BG6A 1ISFA 3QIVA 2P4QA 5ENDA 2GZ1A 3QV1A 4J16A 1N9GB 1T1SA 2JAHA 3PWKA 3R1IA 5KIAA 3AJRA 1Q1NA 3FBGA 1YJQA 2DKNA 4CLDA 3HDQA 4BO0A 1YBVA 4YJFA 4BO2A 2VHWA 4EEZA 2W2KB 4WOJA 2B69A 3UUWA 4B3JA 1LC0A 2D2IA 3IP3A 4K6CA 4B4VA 5JDCC 2HJSA 5DCWA 1N8KA 3PK0A 1K3TA 2BRUA 4B4WA 2O3RA 3AOEA 4FFNA 4TRRA 2Y93A 3GDGA 3IP1A 4PFJA 3TOXA 1D1TA 1G1AA 1R6DA 4FBGA 5A9SA 5CG2A 3VC7A 4LSWA 1T4DA 1U28A 1HZJA 2I67A 1EZ4A 4BQRA 1DAPA 4D45A 4CL8A 1K0UA 1ONOA 4RF5A 5BNFA 1WDLA 1VLLA 2PKQP 1I2CA 3HDYA 1W4ZA 1WWKA 3NYWA 3IKVA 4CQMA 1HE2A 1BVRA 1L1FA 4OOFA 3ITDA 4TQGA 2JHFA 1P1FA 2DBZA 3QLJA 2J8ZA 1E92A 3ANLA 5DOVA 4D3DA 1B3BA 4I5FA 4RCVA 3I6QA 2CMDA 3IMFA 4E21A 1IUKA 4PVDA 1LRKA 5G0SA 4OH1A 2IODA 4R01A 3RCBA 4CMIB 5G0TA 4E2YA 1E6EA 1NFRA 4CLRB 3CE6A 1KVUA 2GRAA 3GGPA 4YRDA 1UP6A 2Y66A 3AU9A 3QW2A 2GNAA 2X9NA 5TJ9A 3JQGB 1CYDA 3IJRA 4BMNA 1NHGA 4CMEC 4B3IA 4B79A 2BI8A 2C0CA 3D4PA 1UDBA 3DZBA 1Q7BA 5IN5A 3JCZA 1PJCA 4Y9DA 3TRIA 3QRWA 1HWYA 1P0CA 4KWHA 3DBVO 1NWCA 2X23A 4PLWA 4NPCA 3L4SO 3C24A 2H63A 3RC1A 3MOGA 4NR0A 1VL6A 4U5QA 1M67A 3W8EA 2X5OA 2VYND 1XLTA 5AQ1A 2HCTA 3I4CA 3K2BA 1EFKA 1HDRA 3ETGA 3N7UA 2PD3A 3RJ5A 1DFGA 4GGOA 1CEQA 3PQEA 4UUMA 3TN7A 4R69A 4LW8A 5G4KA 4BNIA 2Y1OA 5JC8A 3KHUA 4YJHB 1U8XX 4JX8A 3OQ1A 3ZU3A 2NU7A 2GUGA 3F1KA 2E48A 4E2WA 3L6OO 1ZEJA 1H6DA 1GEEA 2DBQA 3R0IA 4CM7A 2VWGA 2HMUA 1DOHA 1U5AA 5A02A 2VYVA 4CM9D 5FYDA 4PG5A 2P9EA 5JS6A 3E6AA 1T2AA 1T2EA 2NV6A 2QG4A 2Z1MA 2DUWA 3Q11A 4I8XA 4BO8A 1K89A 3GN2A 4D3FA 3DAGA 1ZIDA 1M2WA 3CIFA 2NVWA 1YGYA 1BXGB 1DC5A 1ZNQO 1XQ6A 3NGXA 2CY0A 4XRRA 3UN1A 4R5MA 1IYZA 4IS3A 5EERA 1MXFA 3ICCA 5DT9A 3KM0A 4NFSA 4BGVA 1FF9A 1FK8A 3WLFA 2GZ2A 1MG5A 4JBHA 3VDQA 3VZQA 2I6TA 2HLPA 3H3FA 3ANMA 4BNXA 3SJUA 2D0IA 2PNFA 3C1OA 4Q3CA 4WNCA 2DTEA 3LSYA 2DC1A 2H6EA 2EW8A 1E6WA 4NNJA 1HT0A 2ZYDA 5C7LO 2IZZA 3V2GA 1ZK3A 4I5EA 1UZLA 4I5GA 3Q0EA 5CDTA 2Q2WA 2J5KA 3W8DA 2E49A 4XEHA 4GX2A 3PP8A 2X0IA 4E5NA 5JSFA 3WX0A 1XR3A 4UULA 1SOWA 2EW2A 2Y05A 2FSSA 3W6ZA 3QVWA 3VTZA 4LGVA 2O2YA 4MOWA 1U7HA 3MCVA 3WSVA 3EW7A 3I3OA 3QVSA 3T4EA 2IZ1A 3KSUA 4J9VA 4AJEA 3Q6IA 3TPCA 4EZBA 4LVCA 2NVBA 3PHJA 1V3UA 4F6CA 1TEHA 1U5CA 1PL8A 3Q3CA 1GY8A 2GN6A 4BL5A 5JDCA 1QV7A 3DB2A 4CMBA 3EHEA 3ZNNA 4YACA 1PS9A 1KYQA 5K6AA 1PL7A 4E3ZA 1GUFA 2C5AA 2XAAA 3JQDA 3GF4A 3PLNA 2UUOA 4IDGA 4YPOA 1UH5A 4BO1A 1Q0QA 3UICA 4LVUA 2OBNA 3DZKA 3K73O 1T2DA 3DZGA 5EIOA 1N9GA 4IPTA 3M1LA 1P77A 4I08A 1G6KA 1GYQA 3V8BA 3TL2A 2X0RA 3K9QO 3W1VA 4MO2A 4U6SA 3E48A 4ALNA 3JYNA 1ADGA 1MB4A 4N7RA 1F14A 4Q3AA 2W2KA 3K92A 3DFZA 1JLLA 3GAFA 3HQ4O 4J4BA 3C7AA 1EK6A 3L4BC 1I32A 1MG0A 4IUYA 4II2A 3A14A 2OORA 1BXZA 3OIGA 4Q3NA 1BMDA 3WICA 5TS3A 1EE9A 3NKLA 4NFHA 1JN0A 4MVJG 2YDXA 2UDPA 4BHTA 1Y8RA 2QX7A 2IYPA 3F4LA 3INTA 4DPLA 5IZCC 4IGFA 1ZO8A 1Z45A 1MC4A 2I5PO 4M89A 1DIBA 3PLRA 2X5JO 3JTMA 4PZDA 1XIVA 5I8ZA 3SLKA 3IDSA 3LT1A 3OIDA 1NM5A 4J7XA 3DMTA 2HDHA 4CM5A 5HRUA 5A3JA 5DP1A 2ZTLA 3I52A 4WNIA 5BQFA 3OECA 2Y1GA 1MGOA 4X54A 4A5OA 1GZ4A 2WWRA 5HS4A 2WDZA 1U3TA 3K96A 3OHSX 5GY7A 1L7DA 4E5MA 2G0TA 3FI9A 3VVBA 4I9UA 1TI7A 5B4UA 4PLTA 1IB6A 2X22A 1E5QA 1WP4A 5CDGA 3ZU5A 2BFOA 4Y6SA 1AXGA 1M66A 2VZ0A 2ZYAA 1NVTA 3GMSA 1TT5B 1O5IA 3JQAA 3RUCA 3V5NA 4A03A 1EQUA 3ZWXA 1UUFA 3LC2O 1EVIA 1PJ3A 1T4BA 1H0KA 4H16A 2HAEA 4XCVA 2BGLA 3HUDA 2I3AA 1XA0A 1Q7GA 4J1SA 4B4OA 1C0IA 3ZNPA 4NBRA 4BB6A 2EV9A 5DCUA 4Q9NA 2EXXA 2Q50A 3D4NA 4LCEA 1T2CA 3ZN2A 5AXCA 4E2ZA 1SB9A 1NQAO 3IOYA 2ZATA 3DZJA 1SO8A 4ND2A 3RROA 4RVHA 1ZVMA 3VH1A 4XB1A 5I8WA 3GFGA 4IMPA 1ISJA 2RBEA 4II3A 2NM0A 3JQ7B 1VRWA 3OH8A 1VKOA 3I5MA 5KKCA 3SVTA 3I9NA 1GFSA 3F1LA 5JW6A 5G4KB 2EERA 1PX0A 4RVGA 2AG5A 2Q2VA 2QRLA 3ZWYA 3HFSA 3OP4A 5G0WA 2NU6A 1BSVA 2NVUA 4R5HA 4O1MA 2FZEA 3F5SA 2BFMA 2DAPA 1C3VA 1P3DA 3WFJA 3TZKA 4QSMA 4CR7A 3A9WA 3RC9A 1WW8A 3BHMA 2WJPA 1XG5A 3FSRA 4YAKA 3G0OA 5ADHA 3FCOA 1EEHA 5DF1A 1YO6A 1PR9A 2DFVA 1OBFO 4XDZA 2RH4A 4UEOA 3Q9NA 4P22A 3GPDG 2PWZA 3WQQA 4D0RA 4DL9A 3I9KA 4IJWA 3AI3A 5LDGA 4CLHA 4WLVA 1Z6ZA 1B8VA 3LC7O 1AHIA 4MVJH 3ROKA 2AE2A 3OSUA 3AFNA 1B14A 3E18A 2RHCA 5JY6A 3NJ4A 2WEKA 4UEJA 5BR7A 5KVVA 2GYYA 3WB9A 5B37A 1A4IA 1T25A 3GZNA 3WIDA 1E3EA 1LBEA 1XKQA 2VUTA 3NEPX 1GL3A 1YONA 3HJAA 2YYYA 4E5KA 1KEVA 5L7WA 1OC4A 2VUSA 1JVBA 4KUGA 4NJMA 5EESA 5EL0A 3GEDA 1UDAA 4R16A 5AOVA 1U3WA 1BDMA 3HNPA 1B2LA 1QXSA 1H6BA 2AQ8A 2EHDA 3ITKA 1KY4A 2FPIA 4LRTB 4CLRA 1ISHA 3LDHA 3S2FA 1JWBB 3WR5A 3D3WB 3AW9A 3E8XA 2X6TA 1LDGA 3ZW8A 5KTKA 1HTBA 1HLDA 4J6FA 3KLMX 4E2XA 5ER9A 2PH5A 1ENOA 4FDAA 4NG5A 4U8GA 3OF2A 3WIEA 3PPIA 3IC5A 2AHRA 4OL9A 1O94A 4DBZA 4HP8A 4NDNE 3KEQA 3AUSA 3DHNA 5TX7A 2BKAA 4BV8A 3WJAA 1BW9A 1GADO 2WYUA 4L8VA 1A7KA 1RM4A 1H2BA 4EBFA 2ZCUA 3TF5A 5COBA 4TRNA 5JO9A 4YRBA 5A03A 4CMKA 5A04A 3U3XA 3O8QB 3L4BA 2J6IA 2W2LD 1S7CA 4PRLA 2OFPA 3NTRA 1LLDA 4RQUA 4FN4A 1MFZA 2BLLA 4G5HA 3PTZA 3PZBA 1M75A 2B0JA 3I9LA 4UVDA 4YJHA 4BMVA 1SEVA 1ONPA 5B12A 1ZFNA 1U9JA 1IOLA 2UVDA 5IDXA 1KEWA 1QMGA 1I0ZA 1LI4A 5F5NA 5U9CA 1KC3A 4FFOA 2FMUA 3PDUA 5TC4A 4WEOA 3FRJA 3KETA 3HN2A 3ORFA 1ZZEA 4M8SA 1X1TA 4FFMA 1BW9B 4FIZA 4KZPA 1Y8RB 4XDYA 4L73A 1HE4A 5JMWA 4AJKA 4J43A 1XGKA 3P7MA 1ZK0A 2JFHA 4HX5A 2BGMA 4WASA 1Q7CA 3SBOA 4R54A 1PGQA 1SMKA 1I24A 3QP9A 1DHTA 1PJ4A 3LLVA 3ZWCA 4E12A 2HU2A 4FFPA 1DC6A 2Q3EA 3RUHA 4BVAA 4J1QA 4N5MA 4A7PA 1NPTO 5ILOA 2Q4EA 1W73A 2QYSA 2EWMA 2HK8A 5COAA 4PN3A 1YH3A 2EEZA 3EDMA 4PLHA 3UGKA 3U09A 4RLHA 4D79A 2GD1O 3NGLA 1JAYA 3A1NA 3WYBA 3A28A 5TQVA 4N5NA 3WGQA 1PL6A 1PJ2A 1TT5A 2P9CA 4IM7A 1BHSA 5LC1A 5IAAA 1A4UA 3WG9A 4YWJA 3DDNA 2IXBA 3AFMA 5TNXA 3GH3A 1ZEMA 2VOJA 5TLSA 3BMQA 2BD0A 2AEFA 3X2EA 2JD2A 2C20A 2V6MA 2OXIA 5IDWA 2PKQO 1PGOA 3FNFA 4AICA 3S1LA 1DBVO 3LT0A 5L40A 3U4CA 4TVOA 3OJFA 4LISA 1PJSA 1E1KA 1TT7A 4DMMA 1AUPA 3C1AA 1QYWA 2VN8A 4YAIA 1N2SA 3TZ6A 1LEHA 3GHHA 1A5ZA 2VNSA 3INGA 2UYYA 4MPDA 1GCUA 3JQBA 4ALKA 5KOIA 2PH3A 1MUUA 4CM6A 5A5EA 2B35A 5IN4A 5L95A 5A9SB 1MLDA 1YB5A 4WEQA 1ZK1A 2VCYA 4RVUA 1ZJZA 5GZ1A 3FWZA 1PZHA 4JN6B 1QYXA 3BAZA 5JO0A 4GWKA 4R1UA 5ER6A 4ND1A 3UCFA 3BMQB 4CR8A 5L53A 4NBWA 5U1PA 1V3VA 1PZGA 1ZXLA 2HK9A 2ZYGA 1VC2A 2PGDA 1A27A 1ZJYA 2AW5A 3JD3A 3HZZA 5HS6A 4D42A 3PFWO 3H5NA 4MVJP 1I36A 1LUAA 3E5MA 3BZUA 1ZK2A 2HMTA 1YS4A 3MWEB 1T24A 3PI7A 3M2PA 2EP5A 4Z3DA 1X7HA 2NTJA 3CZRA 3KSDO 1DLIA 4R9SA 1CDOA 4EW6A 1EK5A 1U3VA 4K6FA 4O6VA 3WWYA 1L7EA 4MJLA 5CHEA 1N5DA 4F45A 1X1EA 3ETDA 3H9JA 4PRKA 4CMAA 2YQ5A 1SNYA 4GGPA 1E3WA 5G0VA 3RI3A 2VWQA 4E5YA 1P9LA 4IJKA 2XOXA 4IDAA 3KO8A 4BKOA 3EZYA 2DVMA 3HWRA 5CFZA 3FNGA 3ZZNA 4TVBA 3UCEA 2HRZA 3H3JA 3H5AA 2WD8A 3RIHA 1OC2A 4OO3A 3BMNB 1E3LA 3GRKA 1HE5A 3M2TA 4OXYA 4WE3A 3RWBA 4QEDA 3CEAA 2CF6A 4PZCA 3BMCA 4FPXA 1V8BA 3OJEA 4XR9A 3ONEA 3L9WA 1CQIA 4RF3A 5L51A 4IDFA 2A92A 3QA9A 2AMFA 4BMSA 2C59A 4URFA 1DRWA 4JP3A 2A9FA 4BKQA 3EC7A 1R0SA 2X5KO 4AJPA 1LLCA 4D44A 3WTCA 2GO1A 1XCBA 3PJGA 2HMVA 4EGFA 5ITWA 2DU8A 2HUNA 1P1IA 3OFSA 4IXWA 5EPOA 4FC7A 1OFGA 4IJVA 3ETEA 5AXDA 4C7KA 4S3MA 1Y9EA 3KXDA 2DTDA 1GQYA 4IXTA 4RPKA 2C2XA 3PYXA 5KKAA 1B7GO 5FF9A 1MP0A 3QWAA 4GSKA 1YJ8A 2GF2A 5BSEA 3K2EA 3BA1A 3NTQA 4WLNA 3R3SA 1OAAA 2YHUA 4EJ0A 1PQUA 3G1TA 3JQ7A 2NSDA 3ENNA 2WMDA 8ADHA 4FQ8A 1E7YA 5JFOA 3AUTA 4BKRA 5L45A 4NIMA 2B37A 5KJFA 4H15A 5A4DA 4ZRNA 2FPPA 4MIEA 5DP2A 2XPCA 5AVOA 1GPDG 1LRLA 4BNMA 3MTJA 3BIOA 2CFCA 4QFDA 4LSMA 4U0JA 4YDRA 1HDYA 1H6CA 1B16A 1R12A 2BELA 4G81A 1EVYA 2J3KA 4XYBA 5EMHA 2FP4A 2PZJA 3IUPA 4MP8A 4O63O 4PGFA 5FWNA 1KVTA 2Y0DA 3GVIA 3TFOA 5JCXA 4YJDA 1YQXA 1Z75A 2JL1A 4B7UA 1RYDA 1EDOA 3FR7A 5ILGA 3B1FA 4L9RA 4S1VA 1ZK4A 3GLQA 3ST7A 4R9RA 3KBOA 1ZW1A 2VUUA 3VTFA 1X15A 1YKFA 2YV3A 1O9BA 3WFIA 3WGOA 4YQZA 3S2IA 5JAZA 3NT4A 2POQX 2J3IA 2JJYA 3H65A 3SLGA 5JNLA 1NTOA 4YQYA 3MJCA 1HDZA 2H5LA 5I9MA 3DONA 3JQ8A 2HKIA 3G49A 3FBTA 4WGGA 1Y81A 2CDAA 2JAPA 1CJCA 3WBBA 4CUKA 3DTTA 4DXHA 4YAGA 2HMSA 3R3JA 2I9PA 1LLQA 2ZTVA 5I7SA 1LDMA 5JDIA 1SB8A 3ZWPA 4OGWA 1SAYA 1X13A 2Q2QA 3PFFA 1H9AA 4BO7A 4DRYA 4G2NA 1RPNA 3INRA 4EI2A 3TOZA 4N5LA 4BGIA 4BNUA 3ROPA 1B26A 5KNLA 1ZMOA 3PJDA 4XX0A 3ZI0A 4FFLA 1X7GA 3ZU4A 4RJTA 1ZBQA 4MP6A 3RU7A 1NFQA 2ZQZA 3FN4A 4PLVA 4U6QA 3OEWA 1RYEA 3Q2KA 5F1KA 3ZHBA 5JCJD 5I9LA 4HY3A 3KYDB 2X1HA 1ISMA 2V65A 5JAQA 5IG2A 2WYWA 1B15A 4RO0A 3E5RA 4UUPA 1PJQA 5JLAA 4DMLA 4P4LA 3V1TC 4Q3BA 3FNEA 1MX3A 1QRRA 1A71A 1ID1A 1JU9A 2C29D 2J3HA 3TWOA 2AE1A 4CR6A 4XIYA 3DBHB 4DIOA 1WPQA 2DBVO 4OQZA 4BNHA 3GNTA 4F46A 3O8QA 3HB5X 2G76A 1P33A 4J4HA 4YT2A 5AXAA 2VRCA 1J4AA 1X7DA 2DTXA 3TQHA 5U4QA 1LC3A 3VPSA 2DPGA 1PZFA 1UXGA 4NFYA 4CLOB 1P45A 1UP4A 1WAMA 2PK3A 4JBGA 4QXMA 2D1YA 3M6IA 4GQAA 4IDBA 3QVOA 4JLWA 1B0AA 4JP2A 1OZAA 2OHXA 5C3MA 4D3SA 3LK7A 4NBVA 1CERA 3JQFC 2I99A 2BFAA 2Q1UA 3FWNA 2BFPA 3GEMA 3G1UA 1HETA 1TVEA 3PJFA 4E30A 4XGKA 1PQPA 2PA3A 4BNYA 1P1JA 2ZTUA 2B4QA 4UAGA 4DBVO 3FR8A 3AI2A 4PLZA 4YT5A 3VPHA 3D5TA 2PZMA 1DIHA 3AM4A 3GPIA 5DBGA 3FHLA 3G79A 3WBFA 3WNVA 4GMFA 2E82A 3QWHA 1PQWA 2DQ4A 2PR2A 1E3WB 5DDIP 3C7CB 1V0JA 1MXHA 2ZJ1A 3HDHA 1GV1A 3E9QA 4J4TA 3WNQA 1F17A 4J2HA 2DPHA 4MVJF 3LYLA 4ND4A 1VJ1A 3QVXA 4XYLA 5J23A 3GQVA 1K6IA 2NU9A 4Q39A 2EKQA 2IDZA 5FI3A 3GG9A 3OJLA 3MJSA 2Y0CA 2W8ZA 3IQDB 4J0EA 3QSGA 2P68A 3PEFA 5GZ6A 4PG7A 4E31A 1RM0A 3PHGA 1O95A 4L74A 2V7PA 4D46A 1QLJA 1GYPA 1IULA 2QZZA 1VSVA 3H9QA 2NVUB 3PHIA 4LRSB 2NLOA 1YRLA 3BYZA 4MKRA 4TZTA 2PV7A 4BUCA 1UXIA 1U1IA 2HK7A 3VPFA 3WYCA 4DTIA 5B4TA 4GX5A 2OP1A 2CNBA 1NP3A 3QY9A 4GX0A 4ALIA 3C85A 1JA9A 3GUCA 5T6BA 4R3NA 3NUGA 2Z1NA 2C5EA 2IEBA 4XD2A 1IZ9A 4F6LA 3B1JA 1JKJA 4J90A 3STHA 4W9NC 3DOOA 4K1LA 2WE7A 4OSPA 1Y1PA 3P19A 1XDWA 4YR9A 1MV8A 4FCCA 5H83A 5JDIC 1B3RA 1DIAA 1DRVA 4IQ8A 3O9ZA 4ZVVA 3GZNB 1XELA 2Y1DA 1P1RA 1Y8QB 2NADA 5CDYA 2W98A 1R66A 4MVJE 3FPCA 2PZLA 3RUAA 4DYDA 3IL2A 4ND5A 4ZU3A 1E7MA 4IDCA 3H9UA 1E1MA 4PG8A 2O4CA 3UKOA 4PG4A 4NH4A 4NJMB 1XHLA 3VPXA 4DLAA 5IFLA 4NZ9A 2EG9A 1NR1A 4IZIA 1VE9A 1YB1A 3FTPA 4Z9XA 5TT0A 4YB8A 3VKUA 4FOSA 3U4HA 4MIYA 2C2YA 1JDJA 3QWBA 4MVJD 4CV2A 4M54A 3PGJA 5IF3A 1YL6A 2IXAA 4IY1A 5JAIA 4OAQA 4XQEA 2EGGA 3D3WA 2R2GA 2OOSA 2C07A 3KRTA 3W4JA 5CP8A 5JC1A 2RIRA 3OEYA 4INAA 4IINA 4B8WA 2CF5A 1IPFA 3HADA 2B36A 4BS9A 5A1TA 4XKJA 1IY8A 1HZZA 1O89A 3F46A 4ILKA 4C4OA 3ULKA 2VWHA 3DFUA 4O5OA 2PKRA 4PCVA 2YZ7A 3ICPA 4B4UA 3I4FA 2VOEA 3LT2A 5C5IA 5T64A 4ZGWA 2FR8A 4FC6A 3WMXA 4JK3A 3CMCO 5FFFA 3BMCB 2B5WA 4FD3A 4AG3A 1WNTA 4M55A 4RPGA 3ZU2A 1BTOA 1YQGA 2ZB3A 1HXHA 3WGGA 1DDOA 1UP7A 2VRBA 4BKPA 3WGIA 3KB6A 2QQ5A 2FZWA 5JYDA 3RFTA 1U2GA 3AI1A 2CZCA 4E0BA 1HRDA 1SCUA 3U9LA 1PTJA 2FRDA 5TSDA 4RPHA 1QYDA 3RVDA 3I9JA 2CDCA 3CMMA 1HSOA 1WDKA 4TWRA 1ENYA 1O0SA 4ITUA 3A06A 3T7EA 4CV0A 4DQUA 2UAGA 1R0LA 2F1KA 2PTGA 2VRCD 3H2ZA 3WWZA 1YBAA 3PIIA 4W9NA 3MJEA 2J3JA 3F47A 1GPJA 3E9MA 1YBMA 3B70A 2R00A 5GMOA 4A73A 1I3MA 2TMGA 4Q3EA 4IZHA 4EJMA 3DQPA 5KVQA 1EBUA 4AJ1A 3RASA 2BI7A 3WGTA 4YXFA 5DOZA 3K30A 4CPDA 2ZQYA 3JQ9C 4BNKA 2E4AA 4J2OA 1CRWG 3DAPA 3TZCA 1RWBA 2HRBA 3AUUA 4NI5A 4XQCA 1DAOA 4I5DA 4U0KA 4DIFA 3VVCA 2YUTA 3GT0A 2FWMX 5T8KC 1KOLA 2O48X 1J6UA 3D7LA 4NMHA 1PJLA 4XGIA 2WTBA 3G17A 4RVDA 4D7AA 5B1YA 3OJ0A 4PG6A 2Y1CA 4ZD6A 2FOIA 2RCYA 4KUHA 4CM1A 1KS9A 3GRPA 1E7SA 4MVJA 1ZUD1 3PGXA 1N7GA 4TRJA 1BGVA 4DPMA 5L3ZA 1HKUA 4R1TA 4RZHA 1E3JA 2H9IA 1EMDA 4QT0A 2BGKA 4CLEA 4OQYA 2VTEA 1IE3A 5F5LA 4D43A 5KJ1A 4MINA 2I66A 3PJEA 4ZQHA 2B4TO 3HFGA 2P5UA 3ROQA 3RC7A 1PGNA 2RH8A 4M1QA 1G0NA 3WTBA 1GQQA 2UV8A 1EUZA 3LZ6A 2X9VA 1TB4A 2H1SA 3GDFA 2PY6A 5I7FA 3EMKA 3F6YA 1VL8A 4A10A 4AVYA 1LSOA 1XWFA 4NHEA 4NU5A 1IHXA 4LCJA 3RUIA 2QYTA 3UOGA 5A06A 2GSDA 4WJZA 2NNLD 1GYRA 1E5LA 3JD0A 3ZWVA 1SZJG 1R15A 1VI2A 2Y68A 5GZ3A 5KJCA 2W4QA 4RDHA 5IDYA 3VHRA 1I01A 1LDEA 3S2EA 1EUCA 3ONFA 4E33A 1QR6A 3ZWMA 2QRKA 5JE8A 1CIVA 2HJRA 3NDIA 4ONEA 4PLGA 4CMCA 4FSHA 5JY1A 5CDSA 3OMLA 1KVRA 4AJ2A 3RUEA 2TMDA 1ORRA 1KVSA 3ZNQA 3PQDA 3H2SA 2BH9A 2NQ8A 4WCFC 5L9AA 2QHXA 1TA4A 3RJ9A 1KEPA 2WSBA 3OQBA 4UREA 1P1HA 3AWDA 2OMEA 4QFCA 2YV1A 4E5PA 1WMBA 1ZMTA 2AEJA 3P2OA 4CQLB 2NQTA 5IZ4A 1QP8A 3VDRA 4PLYA 4DREA 1J5PA 2BF7A 2B83A 2A4KA 3JSAA 1RM5A 4C7JA 4DIBA 4CLOA 4NU6A 4YCAA 3KSZO 2P2SA 1YDEA 1FJHA 3WS7A 3UVEA 4MIOA 3BMNA 9LDBA 3DZFA 5TGDA 1ENPA 1Y5RA 3IAHA 2EKLA 5T67A 1GU7A 1EFLA 1RJWA 4E6PA 3RKRA 1HYGA 3CH6A 4Z0TA 1U3UA 2ZCVA 3PDJA 3WGHA 4KDEA 4CQLA 1I33A 1SOVA 3NT5A 3WQSB 2V6FA 1WXDA 2D59A 1I3LA 3NDJA 1M6HA 3F3SA 4R51A 2CSUA 4XYGA 1X0XA 3GVPA 2G17A 3PXXA 1NR7A 2GGSA 3AM3A 3JQCA 4RL6A 4ZQFA 1JAXA 3EK2A 3LF2A 2OZPA 2O2SA 1ADBA 2VHVA 2V6GA 4JQCA 4NBTA 2FN7A 4YYZA 1LDBA 4CV1A 1VM6A 1V3TA 3NAQA 4BO6A 4CV3A 2HSDA 3U49A 4YT8A 2E6UX 1DRUA 3L9XA 4RORA 2X0NA 2IZ0A 3FPLA 5G4LA 3EVTA 5LDHA 5CEFA 4R3WA 1YOVB 1DJNA 2O3UA 3QWIA 4BV9A 4ZRMA 4JJIA 3ZDFA 1J49A 2EJVA 4PVCA 4Y8VA 3GN1A 3MJVA 2VNAA 4CMGA 3PHLA 1BRMA 1E7QA 3DEYX 3RKUA 1B8PA 1HDOA 4FFRA 2C82A 5THQA 3W8FA 1Y9AA 4PLPA 1N7HA 4DYVA 4MVJI 2PGJA 4FJ2A 3MOIA 2W90A 1Y6JA 4IS2A 4EYEA 2FY8A 4CMHA 2C7VA 2O23A 3JQ8B 4YAJA 5T8KA 5L4SA 3GOHA 1NNUA 1UAYA 3KLPX 3ROMA 1QV6A 1R0KA 3CZMA 4IDDA 4TKMA 4HFMA 2HO5A 2WYVA 1X0VA 3U0BA 2F00A 3UH1A 1YOVA 1Y8QA 4L4RA 2ZJ0A 4G65A 1HYHA 4KTVE 3L0DA 3P5SA 3DR3A 3GGGA 3KEOA 3WXBA 5C37A 3F4BA 2O3TA 2WD7B 2GCGA 1ZXBA 1K6XA 2C54A 3JD4A 1NFFA 2XXJA 4BQPA 2P91A 1Z74A 5COQA 2VT2A 1J0XO 2FPGA 2Q1WA 3TSCA 3DXFA 2YQ4A 1NHWA 1NX6A 4R1SA 1WLYA 1GV0A 3V1UA 2FR0A 4RDIA 3CKYA 3FD8A 3PIDA 4DQVA 2QZ9A 1PR3A 1MA0A 1WMAA 3VAZA 3ZHYA 1EBFA 2Y99A 4XGNA 3RFXA 1ULSA 3H9EO 3PYMA 4YAEA 4GVLA 4UVHA 1SC6A 1JKIA 3IUSA 3K5PA 4QQRA 3E1KA 2NUAA 2Z95A 3MZ0A 4RVFA 5L4NA 4QO8A 3M1AA 3ZW9A 3LU1A 4A2CA 3KYDA 4CM3A 3TL3A 5KJEA 2JHGA 3I9MA 4JCOA 4HXYA 3BHJA 3DBLA 3X2FA 1HL3A 3UCXA 1ULUA 4W7IA 2D5AA 4GH5A 4IBOA 4BNZA 4FJ0A 5MGBA 2WD7A 2PD4A 3GHYA 4J49A 5FI5A 3WGYA 2UUPA 4BO4A 4EEXA 3WDSA 1LTHR 3RBXA 2Q46A 4XYMA 5AYVA 3DBHA 1C1XB 4RGBA 4DUPA 1W6UA 1RM3A 1E0DA 2BHLA 4E32A 1IL0A 1IZ0A 5CG1A 4J0FA 4EUFA 1HYEA 1T1RA 1UZNA 4R4JA 1GAEO 2GN8A 3JYPA 3CINA 3RUFA 2VHZA 5EN4A 5K9ZA 1EQ2A 1KY5A 4ESOA 1FDSA 4IIVA 4LMRA 4EITA 2YHIA 2JCVA 3B6ZA 1DPGA 2ZKLA 1DO8A 4FGWA 3JYOA 4K26A 3C7DB 4GLOA 4RF4A 1PWXA 1WDMA 4TROA 5JMPA 3GVCA 2X58A 2CVOA 4JJGA 5C7OO 1A9YA 3BTUA 3W4IA 5KJ6A 1UZMA 4YBZA 4BNVA 1P0FA 3L77A 2A94A 1C1XA 3VOSA 4YEDA 1BWSA 1JVSA 3AUAA 3ANNA 4NBUA 1HDXA 1JWAB 1H6AA 3MJTA 1I8TA 5A9TA 4U7WA 5BNIA 3KYCA 3ZV6A 1H94A 1E3IA 3RD5A 1GZ3A 1YQDA 4EUHA 4IQGA 4XA8A 3T4XA 1H2HA 3E82A 5DN9A 2LDXA 4YJGA 1Q2XA 4P38A 4Y6PA 4UUOA 4DWVA 3P2YA 5G0UA 3DC2A 4Q3DA 2E37A 5L7YA 1T26A 2P9GA 3RC2A 4Z0PA 1I30A 3GR6A 3Q9UA 4OIMA 3VH4A 3LF1A 3V1YA 2BMAA 1LDYA 2O7SA 3QQPA 4J7UA 1Z7BA 2VTDA 3WQRA 4DLBA 3DWFA 2AXQA 4O59O 4OKIA 1F8GA 4XYEA 3RAJA 2X0JA 5DNAA 5EINA 4A26A 1ZKMA 3GC6A 1FXSA 3D4OA 4WLUA 2GN9A 5IDQA 3ABIA 4HBGA 2VWPA 2CVQA 1PS0A 1E6UA 1GQ2A 2PZKA 2VQ3A 3I83A 3KYCB 4JXKA 1M6WA 3VH2A 4BIIA 4CUJA 1PIWA 5BSHA 5FEUA 4TMFA 4UVGA 2VHYA 4FW8A 2DUUA 4F3YA 1LDNA 1CWUA 2W2LA 3GUYA 5F3RA 4BNGA 1U2DA 1D4FA 3TJRA 4BNLA 1UDCA 3TFQA 1EE2A 4BNTA 1XEAA 5IXYA 1SBYA 3ZWWA 4XR4A 4YTEA 1EUDA 1N1EA 4HADA 4MDHA 5BSGA 2B5VA 4I1IA 4AJLA 3SX2A 4HUJA 4Z9FA 2PD6A 5I7VA 2AA3A 1W8DA 3DBRA 1FDTA 3SXPA 4ALLA 4BKUA 4RVSA 2GLXA 5K0ZA 2NACA 3AY7A 4W99A 2OP0A 1UJMA 1LU9A 4RZIA 1GDHA 4HNGA 3GVXA 5AXBA 1SPXA 2D3TA 4YJFB 1EVJA 1C0KA 1K2WA 3N58A 1NXQA 1KVQA 3OETA 3ON5A 4DC0A 3ZV4A 3DHYA 1LJ8A 4IMRA 2YFHA 1E3SA 4GPD1 1U4OA 4WLEA 3A4VA 5H82A 4QO7A 1DFHA 3LT4A 3W6UA 1PEDA 1VPDA 2I76A 1I2ZA 1ZSNA 1IPEA 3DL2A 2EP7A 4Z9YA 8LDHA 1H93A 3NTOA 3CSDA 3IJPA 1ADFA 4P8RA 5LCXA 3HSKA 3Q2IA 3DBRB 1F0YA 1ML3A 3JQ6A 1YL5A 4NJOA 4E4YA 3D3EA 2A35A 4XB2A 1R4NB 1XU7A 4DA9A 3B20A 5F21A 3VZRA 4UVIA 2J5RA 4KQXA 4B8ZA 2HQ1A 1C0PA 1AE1A 2J5QA 5IZCA 4H7PA 2IRWA 3DMYA 1P31A 1YB4A 3DTYA 3OA2A 4PZEA 2NTVA 3AK4A 4TKLA 2GDZA 3RUDA 2CDBA 4AJNA 1NQTA 4D41A 1FDUA 2IE0A 1I10A 4CODB 1GCOA 4WK6A 3D5QA 4ALJA 3GNQA 3H9GA 4XZ3A 3JQ9A 1HLPA 1YWGO 4GMGA 4J3FA 3BTOA 5ENVA 3ASUA 3O03A 1A9ZA 3ZV3A 1N92A 3GG2A 2OGUA 1FDWA 1FDVA 3JD1A 2DT5A 1R16A 3WSWA 1XQ1A 5CPBA 2RAFA 2VZ8A 3SC6A 2O7QA 4WKGA 4CM4A 4IQ0A 4Y6RA 3OBBA 1LX6A 1YVEI 4XRGA 3IKTA 1PJBA 3KUXA 4JROA 2QIOA 4EUEA 4GBJA 4FS3A 3RSHA 2CUKA 2GN4A 4KTTE 2GZ3A 5MDHA 5G2OA 5ICSA 5HTOA 2I3GA 4GX1A 1IHYA 2B4RO 4CM8B 5KVCA 4KWIA 1I5RA 3T7CA 5A3VA 3ENKA 2SCUA 4KOAA 3ZGYA 3R6DA 4WCDA 1W0CA 3ADPA 3I1JA 4YVFA 1Y7TA 1YL7A 5KCZA 6ADHA 3I9OA 2AQKA 3RBVA 4NK4A 3WGZA 4AJIA 4FR5A 1DIRA 1SEPA 2O3QA 4FB5A 2VHXA 1ADCA 4BO9A 5A05A 2YHIB 3W4KA 4W4TA 4LN1A 3ZWBA 1VKNA 3OIFA 4BGUA 1CF2O 1M76A 1NQOA 5ITVA 1UXKA 5L4LA 2R6JA 4LK3A 4CM4B 2G5CA 1KBZA 1FMCA 1GR0A 3AOEC 4JGBA 4Y98A 1HDCA 4WCFB 4WUVA 1DJQA 3FNHA 2YV2A 1D7OA 2EF1A 3TNLA 3E03A 1BVUA 3JYQA 4OOEA 1DHRA 4BO5A 3O26A 3JQFA 4P4GA 2DBRA 2Q99A 1OMOA 1QYVA 5A9RA 4GKVA 4JBIA 1AHHA 1A7AA 5IXSA 3QWFA 1VSUA 2JD0A 2YFQA 1LSUA 4XIJA 1HSZA 2GERA 3L07A 4OJNA 3S2GA 3LQFA 4BNNA 2Q1SA 3D64A 2JKVA 4BNWA 2RHRA 3KTDA 3AOGA 4CUZA 4GSLA 5JCJA 5JXWA 4WOKA 1E7WA 3PHHA 1A72A 3UFXA 1DC3A
chains in the Genus database with same CATH superfamily
3EY4A 2FR8C 4HFRA 3CHYA 3TO5A 1Q0HA 3S68A 1XNRB 4F3TA 5AD1A 1POWA 3WQBA 3WY9A 3VU8A 4YX9A 2BAGA 3U5TA 3F0TA 3DNFA 1J39A 4JT2A 1MJFA 1D3AA 3SR0A 1FUYB 1MV5A 4P31A 4M0KA 1JDTA 2Q5OA 1ODCA 4QX6A 2IWHA 1RWXA 2O14A 1G19A 4JJFA 1OI7A 1CUBA 3OHPA 1JBKA 1NAHA 1Z35A 5DT2A 1W4RA 2L0XA 1H4VB 1RE0A 2IYSA 3IPXA 3VPAA 2VJMA 4CIVA 4QECA 4V2UA 1F4LA 2BJWA 4UDNA 2AIRA 4D81A 1U7TA 5KQRA 2WG1A 1DMSA 1XAGA 2YMPA 2AZDA 1N5KA 3NP9A 3KOUA 1YZNA 4IEEA 3DBLB 4CBVA 1XKXA 3OEEA 4IH1A 1UAAA 5GVSA 4JP5A 3NMUF 1QU3A 3ZK8A 3OY2A 1A2OA 4OQEA 3GRUA 3FETA 1MTOA 3C14C 3IIEA 1YIOA 2CKDA 2UXDB 3HN7A 4MJ7A 1TMYA 1HC7A 4UTOA 2W8BB 4ARZB 1OT5A 3L18A 3DR5A 3IALA 3HBNA 3LO8A 1WY5A 1RIIA 1KP2A 4MI3A 1NVBA 1HKHA 1WZIA 3ESXA 4QTZA 3VKVA 4R0MA 4X44A 2FVXA 2OORC 2PGLA 1URPA 4D57A 1GTL1 2FEWB 1J22A 4NVRA 3EA5A 4DYHA 3MGKA 1OXKB 1SKQA 4N54A 3GGJA 4TUYA 2B94A 1SVIA 2XMRA 4YRQA 4ERXA 1PSWA 3JATB 5F78A 3H6KA 3PEUA 1R8SA 3RYCB 4ZN6A 1QK4A 4PEVA 1TPYA 2JGJA 4AZ3A 2V3CC 2YJZA 4BVGA 1B0PA 3MCTA 2ZWVA 4HNTA 4XIFA 2LUOA 4EA8A 1ZSVA 2RK3A 2WKSA 3MIZA 3LYHA 4ZU6X 3V46A 4P36A 1PSDA 2FKAA 3ADOA 3SY8A 2HY7A 1DBWA 1U02A 3FTNA 4HLQB 4X1OA 5A5FA 1KIFA 3F3MA 3RIYA 1R18A 3MJFA 4YUZA 1EFPA 3TDMA 1GEGA 2PXXA 3MRXA 4B40A 3NKFA 4DIKA 7ADHA 2O50A 1ZJ4A 5FWAA 2C4HA 4CTKA 1EKXA 4BMXA 3L4KA 1UC4B 4ZQBA 1YR6A 5A4KA 1CD5A 3ED5A 3MWFA 4I1OA 2Z98A 3GEGA 4YHHB 1ZGAA 2P9TA 3WLHA 4PIVA 2FSVA 1NN3A 3HM9A 1DQRA 2V6BA 3MWJA 3LLSA 4Z99A 1RI1A 1YZKA 1MRZA 2ZRBA 4KK3A 1R4MA 4U6NA 4L4XA 5CDUA 4ND8A 4KI0A 2BBOA 4O4HB 2Z56A 1L8AA 2Q45A 4LAFA 2A4MA 3MAJA 1N6OA 1GTMA 3PC8A 1F6BA 1KETA 2QUIA 3C6ZA 5EQFA 1L2TA 1RAFA 3RHFA 3WLSA 5HK9A 4WN3A 4IF4A 5AVUA 2Y76A 4YJGB 3W3ZB 4F4DA 3Q72A 5JNSA 2JPDA 1BDBA 3MCWA 4UHBA 1VJ0A 2WAYA 2XF8A 1J09A 4K6MA 4DRXB 3GGOA 4N5DA 3DHEA 3GLTA 4FE4A 3KOZA 1H23A 1XSEA 1V16B 3KFLA 1SRQA 3O38A 4RQTA 4QSHA 1QWOA 5AM1A 4REQB 4EQ6A 1ULBA 4RTJA 4ZICA 4LY3A 5ESRA 4A9AA 1KH2A 1V8PA 2RGWA 3JVVA 2ZJOA 4NDZA 2ZOSA 3P0IA 4X7RA 4YJ3F 5CR9A 3TLBA 3QZUA 5ERYA 4POOA 5BNTA 2O8FB 3PGVA 4L5CA 5K0BA 1I7QB 4OHZA 4HGRA 2FMXA 4WZAA 2ZTMA 5EIHA 3LPAA 4D3ZA 4OXKA 1KAHA 1YI0A 3PUXA 4HDRA 1YDWA 2ZRMA 3PKJA 4N0PA 4R05A 3T06B 4DPKA 4CXMA 2EFEB 3KYIB 5T6MA 3T1QA 5D8DA 1T9GS 4JLBA 1U7OA 1PGPA 5EMMA 5IAEA 3R8CA 4E7PA 4LJ4A 1XQXA 2AYZA 3QE3A 3PZRA 2JHPA 1L8LA 4CM9A 2FN9A 4WK2B 4ZYWA 1DXYA 1C0LA 3M6FA 2IITA 1ESMA 2C92A 3BDAA 2ZB4A 4JBWA 1HDGO 3GH1A 3V8PA 3VOTA 4ZHSA 4P3YA 2CGEA 1U4NA 1YS9A 4TXLA 3U44A 3FY4A 5HQTA 2IS4A 1UBUS 1HURA 4H3VA 1XRJA 1C2TA 3N28A 3BGSA 3EIQA 3CUTA 4ZT6A 1O57A 4B2IA 1IXZA 4JV5B 2ZVPX 1YCFA 3F71A 1PI3A 2CVZA 1WE2A 3O8DA 4FN5A 1CJUC 4JJEA 2X19A 3HG7A 5FD8A 3NUZA 5JXHA 1L4EA 2OKCA 4F2HA 2GCIA 1WTCA 3T9AA 3D6JA 4RPLA 3HRHA 3U4DA 4BMCA 5CPFA 2QL9A 1NBME 5CFQA 3PWSA 3EXHA 1UKCA 3HCNA 5T3YA 3VM6A 2JFGA 4P5DA 1VCHA 2WT4A 2Y1FA 2Z4TA 2VAWA 3FCUB 4M2LA 3LH5A 1O9HA 3KPYA 3B60A 4QARA 4L4SA 4XJSA 5A3RA 2QVZX 4QAJA 3DOUA 3GY0A 5EMLA 1NBEA 3M34A 2CWDA 4IQ4A 1CY4A 1YVRA 4JWTA 3PGKA 5EEHA 2XHEA 3KAPA 4R7TA 2YZKA 4P4TA 1Z6XA 3CH7A 4KQ6A 1XTIA 3RANA 4AWAA 4QRIA 2CWWA 4WESB 4HGOA 3UBTA 1PD0A 3PUJA 5ECWA 4I9NA 3R6GA 1WEKA 2WPDA 2AF4C 3GAZA 4ALMA 4EPRA 1FBTA 2A14A 2DQYA 3GCGA 1OQAA 3GEEA 5SY9A 3T7AA 5JECA 3HWX1 4QTYA 1G3UA 1JQAA 4WECA 2NTYC 1IEXA 4Q21A 3PYLA 3C45A 1DWQA 1C30A 2BOVA 4EYGA 4N0QA 1UT8A 3U7QA 3H7AA 3OF3A 5BMVB 1MQ9A 2QL7A 1I4EB 3AR3A 2COUA 2YJTD 3HR4A 3NJ8A 4J9UE 3VNQA 3UW3A 3QJ5A 1N75A 3G2KA 1AQUA 3BX1A 3LC0A 5JSKA 1KC1A 3ZY3A 1MRNA 4BLVA 3TJZA 4UQOA 2IP1A 1LB1B 1YNSA 2CT8A 5SZHB 4NE2A 2RE8A 2ILTA 3V4RA 1N1GA 1OXVA 3ADKA 3IBTA 5T4EA 2ZANA 5FDFA 1P6UA 3A9CA 3CF4A 3QKSA 3SC4A 1JDBB 1M8KA 3DV0B 1X8XA 5SY6A 5BVGB 5TT1A 1N3YA 1FS4A 2DCUA 2VK2A 2XRFA 3EUWA 3ZLUA 1M1YE 5KNCA 1T6XA 3CY6A 3NT2A 1S6YA 4PLCA 5EJ7A 5KPJA 1N7JA 4XJTA 4R71A 3EX7C 3A3KA 4DSTA 2AH5A 3L92A 1HQDA 1MC8A 1ZM3A 3TNJA 4AIRA 3JYLA 4WZ6A 1ARZA 2K4MA 4OSEA 4W9MC 1ECLA 1NUQA 3CTMA 3ZC3A 2ZSKA 2ID8A 2YOHA 2BFBA 4UM9D 1DKNA 3M3DA 1T5HX 2GPTA 3R0ZA 4QDZA 2IYOA 5IK2D 3BK2A 2I8LA 1FU8A 4OJKA 3JV7A 4YI3A 3ZQ4A 3P0FA 1AB6A 1A97A 1RWMA 1Z39A 3EQ2A 4FCVA 4AMBA 2H1CA 3PXDA 5T57A 4XVCA 1PBTA 1KAEA 2WABA 4RV4A 1NT2A 3R3XA 3F6PA 4W6ZA 3TOVA 4ROSA 2HREA 2P1DA 4Q00A 2FCAA 3GNSA 2FX5A 1ZVKA 2FGJA 3WLEA 2X0EA 4JI3B 1LK7A 1U0JA 1Q44A 4CM8A 1Z08A 3CZ4A 3GPLA 5I6DA 2WWVD 1W6RA 4EB3A 3MTGA 3PHBE 3HKBB 3REFA 4BYMA 4EJSC 1I2AA 4FMCB 3OZVA 4L0QA 2WE8A 4QJBA 1SZCA 1LLUA 2HJWA 1O6ZA 3N70A 3TUZC 4BOYA 2Q3MA 1F2UA 1P74A 2XXBA 1W4BA 1FJ2A 1JW9B 5FPPA 4R8MA 4B3HA 5BSFA 1MJ5A 3SVZA 3RB8A 5AUQA 1JYFA 2H8KA 5DLQC 5SYAA 4QU0A 4DWJA 5J4YA 4I36A 2I65A 1ZCZA 2FGKA 2I1VB 4OP1A 3ZCXA 3EDYA 2GASA 3GLKA 1FVFA 4TRMA 5HMLA 5BWOA 4X45A 3AUJB 1O97C 1VB3A 1H9CA 3RQSA 2VSYA 1KDYA 3FOWA 4WCFA 3E05A 3T3HA 421PA 2YFKA 4A27A 3OA0A 1NBAA 2CLOB 5K05A 3RFVA 1LQTA 1W49A 2ZIXB 4OHPA 3GLHE 1E1YA 1QZUA 5KTMA 3ECSA 1IRXA 1OU4A 4KRYA 3I6IA 3O1HB 4DCSA 1C3OA 2Z2YA 3DP7A 4Q18A 1L5NA 4DCUA 2FQWA 2REOA 2WJ6A 1RCTE 4GWGA 1EA5A 2Q4OA 4LJ6A 1K9SA 3K6SB 3C7KA 2DKOA 1Y1KE 3O21A 1GTRA 3F7OA 1JQ5A 3FUWA 3Q10A 3WKAA 3LP5A 4MTLA 1NUPA 1W2HA 1NN5A 2YZGA 1KDVA 2B21A 3GAAA 3JQEA 4HC4A 5E0OA 3LXUX 3NPMA 3WL8A 2VQEB 5JJKA 1JTVA 3BXXA 4OYRA 2WWFA 3P4UA 1JAZA 2H06A 4HWTA 1MB3A 1NMQA 2H3HA 4ZJUA 1B93A 3ZYZA 4MV4A 3A2KA 1VJDA 1XMSA 3FUUA 4B7XA 1CDEA 4M1MA 4P0PB 3HXLA 4MMYB 5ESWA 1SZDA 2GFIA 3DLTA 5DEIA 3AIIA 4KFUA 4KR6A 1P44A 2Q1TA 5KU7A 1FMLA 2BMDA 4LC0A 1ISFA 3DMRA 5J5CA 5IBCA 5KB3A 1WG8A 3U3DA 2P4QA 4DG5A 1M2JA 1RU3A 2A30A 2GZ1A 2PLRA 2RHLA 3L8CA 1Q6ZA 4J16A 4JR0A 4QQFA 1E9EA 4TN1A 1C8LA 5A71A 5LWHA 2W2XA 1H8HA 3S27A 4CLDA 1G42A 4BO0A 2E4UA 1TMGE 5CMLA 5HUHA 4RL4A 4EEZA 2QRUA 1UC9A 3FPBA 3UXHA 3UUWA 3EMBA 1NN0A 3WRXC 3QPDA 1CJSA 3QYPA 4KAAA 2WTUA 4K6CA 3IP3A 3ND7A 2FXVA 2HJSA 1N8KA 5LYJA 3MMSA 4Q02A 4XJXA 2QVGA 3QPUA 3OAAA 5C8VA 3X43A 2O3RA 3L7OA 4FFNA 5K01A 3M8KA 2XGJA 3GDGA 4QYSA 3ZHUA 1OXXK 1D1TA 1G1AA 4F8JA 2WYOA 4ZOAA 3VC7A 3ZHSA 1U28A 1YR1A 2QPTA 1SU6A 2XKJE 1EZ4A 4BQRA 1K8XB 4NBLA 1XRPA 1YRWA 3K9WA 2OCGA 2PMDA 2ASEA 1M2OA 3NONA 4E07A 5K3EA 1THTA 1P3Y1 4UHJA 2HJ9A 3BEOA 5LQAA 3NYWA 4HNVA 2QB5A 1CUYA 1KQ3A 2VP4A 1QNFA 1VMEA 3ESYA 3RQIA 3PE4A 4U2CA 3ZHRA 3MT9A 2JHFA 1JFLA 1RC8A 2FW7A 4HAWA 1TC2A 3BREA 1G6HA 3T0IA 4F2PA 4ZOQI 1FA9A 1B3BA 1FXUA 4GBGA 4I5FA 1DAIA 4M7RA 4TMXA 3SR3A 1OASA 2XMZA 3RK0A 2Y3IA 1Y1QA 3D6MA 1Y3CE 2CFOA 4OH1A 4R01A 4R6WA 2YOGA 1H85A 1NE2A 4M0DA 3RCBA 3QE4A 1HTWA 5JROA 2FJ0A 3HRKA 4C76A 4CLRB 3JAKB 2GRAA 1SBZA 1B41A 5HF9A 1HA3A 3GGPA 4FFDA 1ZJWA 1NKVA 2C4KA 3USZA 2YJ5A 1WSAA 5JZ9A 3BK7A 4PO9A 3QW2A 2NYVA 4RETA 1SVWA 3KQQA 4QXAA 2QTFA 4YQEA 3TJMA 3DL7A 3IEPA 1U5BA 2BM1A 2Q4DA 3O8BA 1CRPA 1L0BA 1CYDA 4RANA 4ZZ3A 1US8A 3W8RA 3D4PA 1UDBA 1ZINA 3Q2OA 4DY4A 3PXAA 2A9KA 5IN5A 3U4QA 1HV8A 1PJCA 4Y9DA 4COKA 4ND8B 4BCBA 1HWYA 1P0CA 3BF7A 5AI4A 1I2MA 4JQZA 3ZBUA 4PX3A 2RHHA 3ISTA 4PLWA 4EKNB 3L4SO 4YNBA 1SUCA 3RC1A 2ZWMA 3MOGA 4NR0A 3GJ0A 3T0GA 1C7RA 3W8EA 2I3ZA 2X5OA 1GTVA 1VRCA 3I4CA 3Q8XB 3QE9Y 3K2BA 2YVUA 1RXVA 1X94A 5FV4A 3ETGA 4RK1A 1PDVA 1WBJB 1UBKS 1DQYA 4Q24A 4UUMA 3SG0A 3C5WP 2MSWA 4LHYA 2GLUA 4YONB 4C29A 1U2SA 4MGEA 5JTTA 4P4SB 3ZOZA 3D8NA 3VJKA 1QKKA 5JC8A 2PXCA 4U7JA 1G8JA 1JR2A 5KMGB 1SRRA 1VLQA 3O2SB 4LFCB 4RK5A 2G9VA 3U4GA 3OSZA 4BJ5A 2IJGX 3DPSA 1A4XA 1SFRA 3L6OO 4E2WA 1EVQA 3A0RB 1VHDA 3E3NA 4WDRA 2W4MA 4XM1A 2VH1A 3E7FA 3EIOA 4P33A 5K4AA 4MWBA 3EXEB 2PJRA 1U5AA 3OTHA 4Z4CA 5AMXA 1XMXA 5FYDA 1T6YA 1WW2A 1NW7A 2P9EA 2Z3VA 3IQEA 1QHIA 4FOLA 2DUNA 3OIWA 2CC2A 2RIPA 1IXKA 2QE7A 4I8XA 1JQJC 1K89A 1MEOA 2Q5EA 3FNIA 3GN2A 4MQLA 1JMKC 4MR8A 3SS7X 1N8NA 1M2WA 3VYRB 2B1QA 1YGYA 3U6KA 1DC5A 5JS2A 1FNDA 3ONNA 5D1NA 4D99A 3L8GA 4DR1B 3FCYA 2WM9B 2CY0A 4NCHA 1ST3A 1ZUNA 1UBSB 2CL5A 3GJSA 3HKBA 3ISVA 1IZYA 4XUCA 5DFAA 2JK0A 2JG3A 5A0TA 2ZWOA 1MXFA 4AYWA 5LOVF 3D0QA 1F6DA 2B1RA 1FOEB 4DV4B 4GHWA 4MUEA 4DLYA 2I6TA 4KYTA 4NAUA 4E03A 3QKRA 1OD6A 2BKXA 5BSMA 5C2JB 1A5BB 1EFCA 2P3LA 2D0IA 3QOXA 4OK3A 1LVUA 3K4QA 3SNKA 2R1TA 4HH0A 2DTEA 1A7JA 3O8CA 2DC1A 5CVTA 1T0JB 4KV9A 1YC2A 4OQPA 4NNJA 1ECBA 4K6OA 1UF9A 1ZJ5A 1ZK3A 5DTEA 3GT3A 3AWIA 4I5EA 1F9EA 5IMSA 1VBKA 4HH4A 4A8PA 4GX2A 2O8EA 5SV2A 4E5NA 5ISMA 3UWSA 2JGAA 3ONVA 4EEKA 2XXAB 5AUOB 2WW8A 1QFSA 4OJQA 3OJWA 5E8JA 1DMRA 5KS2A 2H59A 3COYA 1BGWA 3QEJA 1BX0A 1H69A 5HP4A 2EW2A 1SOWA 2Y05A 1KMCA 3YASA 4TUYF 3RS4A 5K0SA 5KVCA 1UBOS 3C6BA 3VDNB 2J4DA 2ZWPA 4BQIA 1R74A 3I3OA 3WADA 5KYXA 4U2DA 3Q5EA 3EBPA 3KSUA 4TLLB 3HJFA 3WA7A 5FL3A 4AJEA 3TLGA 2ISQA 3EXFB 3H9BA 4ZOLB 1AV7A 1G66A 3PHJA 3H0EA 5J2UF 2FSIA 5IAJA 3FPHA 3E9EA 2YWCA 1U5CA 1PL8A 3CE9A 3Q3CA 4BL5A 3H5LA 4R0NA 4P7JA 3PUZA 2BFDB 4GO1A 1M2EA 2ZT6A 5CA1F 4HXGA 5LNK6 2OHVA 1CR0A 1PL7A 1CYEA 1QZ3A 4Y2RA 3GF4A 2LCIA 2WAMA 3CX3A 4IDGA 5ITSA 3AV0B 3DHWC 1IM8A 2IHTA 4F9TA 1ODJA 4BO1A 5LB4A 3EPHA 4MQFB 3RTAA 1T2DA 1RTTA 3UWOA 5K0CA 5JQGF 2ZRDA 3E81A 3M1LA 2QTGA 1JEEA 4PCLA 3OCZA 3L8HA 3L6UA 3NBAA 2B4AA 4GXNA 3NHPA 4Q1DA 4QLAA 3K9QO 5AKXA 3W1VA 1NW3A 1OJLA 4U6SA 5LM3A 3OPYA 1KMIY 2EDCA 3SIPA 1STOA 1UM9A 1XD2B 3A3NA 3I2YX 4KHZA 4N3AA 2ZUFA 1I32A 1NE7A 4YRGA 4GBMA 1P8JA 3SR4A 1WQ1R 3VC2A 2OORA 2IUYA 2WIDA 1DOZA 3OIGA 5KTYA 3LUDA 1DARA 4AXXA 1N33B 1WHSB 4NFHA 3KD3A 4BTVA 3D8RA 3CRMA 2ISSD 1DO0A 2D1SA 2PX4A 4H1VA 5GP1A 5LJIA 4IGFA 1Z45A 5IMBA 2I4LA 3TIXB 2I5PO 3ETCA 1DG1G 3I6MA 2YIVX 4OXRA 2J4CA 3BFXA 3CZCA 4XWGA 2X5JO 1CVIA 2EBUA 3JTMA 2YIJA 3A6KA 2QD1A 3IDSA 4YGYA 1A69A 4RQBA 3OIDA 2C9OA 2YWRA 3DMTA 5HRUA 4WH0A 5A3JA 4D98A 3NNSA 6AT1A 3HY6A 3Q40A 3QXXA 4WNIA 1EGVB 5HE9A 3K0CA 4X54A 1VHWA 1GZ4A 3I2HA 3HA7A 5K6RA 4A3SA 4BDTA 1Q1GA 4KRFA 1JYEA 3GXBA 3IBCA 3IYLW 2RHWA 4Y9SA 3VVBA 2C8VA 5CB4B 2I87A 2QE7D 5B4UA 3ZDAA 3I9V1 1NNI1 3RVKA 4PLTA 4G0NA 4QUHA 1SKMA 3H8SA 3IDFA 1JRLA 1JHYA 2QA5A 3EDRA 3LHDA 2OWEA 1NVTA 2VT7A 1TT5B 2YX1A 3GFFA 4JUCA 3V5NA 3BL8A 4G37A 4KQ2A 1L1RA 3ZWXA 4RD2A 1JQ3A 3OE5A 5T7BA 1SXJE 1PJ3A 2C5LA 4US2R 4OGLA 4WGFA 3DE1X 7AT1A 2C96A 2HAEA 1KJ8A 2NZ2A 1JIUA 2Y77A 1PEKE 1M1NA 2AF3C 3TL6A 4H7KA 3NIWA 2I3AA 2PJZA 1PZXA 2X1MA 1FSZA 2EX1A 3GAMA 4ARSA 4KK4A 4B4OA 3ZNPA 1UBHS 1OE0A 2R87A 2WK1A 1JF8A 3NANA 4X65B 3N76A 1W36B 4Q9NA 2DEUA 3FW1A 3TW8A 4XD7D 5KSWB 3P4XA 1FU4A 4E2ZA 3ZN2A 1NKTA 4EMBA 1SB9A 5LU9A 1XYVA 1OBOA 2ZATA 2XZDA 4JL8A 2NU9B 3ZI7A 1QP7A 4KBGA 1MMFB 4GYYA 3QMPA 2VTBA 3CT4A 4I4LA 4PSDA 4UBIA 5I8WA 3HJHA 1QHEA 3RTEA 2B78A 2D5BA 4GR4A 1IATA 5JOQA 1L4FA 1EK1A 1TM4E 1VRWA 3KJGA 1VKOA 3OH8A 3I5MA 4JUFA 4OXXA 4Q12A 4Q6BA 1GM5A 3WWDA 1GFSA 2EERA 1SKAA 2AG5A 5FPHA 2RCNA 1MB0A 3UV7A 3PA8A 1BSVA 2FHPA 3LUKA 5AHRA 1KPGA 3COVA 3OU2A 1JZTA 3P20A 2J87A 4MKFA 1TYEB 5J43A 3AC0A 5AK3A 1P1BA 3BQMB 3ER9A 3G9UA 2ZIEA 1ODIA 4CR7A 3ADDA 1W36C 1ZGGA 3TTWA 2XT9A 3THYB 1N77A 1ZOOA 3D2BA 2BHRA 3B7WA 4BQSA 1U0OC 2SECE 3GLGA 1GZSA 1CTQA 5ADHA 4DFDA 4UQLA 1A9PA 5HRAA 4XUGB 4EW3A 1N0WA 3L01A 5ALSA 2WSMA 4PQRA 5LYJB 1DKMA 1MQAA 4XDZA 4MDYA 2RH4A 1M5RA 5AI8A 1K0FA 1TM1E 2QRNA 4PC1A 2W00A 4UEOA 4UHFA 1V48A 4DL9A 1ZGJA 2WIBA 1Z6ZA 2OQ2A 3LC7O 4JLKA 4KFTA 1YCGA 5ALKA 1XTTA 2HNAA 1BMTA 3HB1A 4M0EA 1Y3HA 4DA7A 3BD9A 2AE2A 4DA0A 4ZYUA 3AFNA 3E18A 3NOXA 2C99A 4FR0A 9GPBA 3LA8A 1CZRA 3OTWA 2WEKA 1VHJA 3NYQA 4ZMSA 2UZ4A 1A4IA 2O8VA 2QQFA 1LGYA 1E3EA 1E2EA 4NATA 4BQQA 4BVHA 4DANA 2WU8A 1FTWA 1U1FA 4BN5A 3B9QA 1YONA 2VJLA 3LQ1A 5REQA 4ATNA 4E5KA 5A06A 2HSWA 4EFLA 1DAFA 3FNBA 3C8ZA 1OC4A 1H66A 4L8YA 1HLGA 1RJ9B 4I46A 5EESA 1E0KA 3D6HA 3OHMA 5EL0A 5FBWB 3UENA 1YVPA 3VYUB 1H05A 2ZR0A 2FAXA 4DM7A 1U3WA 1EX6A 1Y63A 2KBFA 1B2LA 3HNPA 1H6BA 3PD1A 3CLKA 4Y9TA 2QGZA 4C7MA 2OY0A 2Z9BA 2KSQA 3NBKA 4C4TA 1BD4A 4CLRA 4AZ0B 1GNTA 2OV8A 1DJLA 1SQFA 1CUHA 3ZVNA 1FFSA 4TL7A 5ETJA 4BMDA 5KOHA 3FZQA 3S7TA 3VDMA 4ML3A 5IRCD 1E2NA 2QVLA 2X6TA 1AH2A 2UUBB 2ZPTX 3ZW8A 4J6FA 2Z8ZA 1AHNA 1UANA 4RH1A 4YLYA 3PGA1 1XCPA 2QAIA 5JJCA 2JGRA 1RNLA 1O9GA 1FTGA 1QAMA 2DWPA 2H2DA 4FDAA 4NG5A 4U8GA 3ZIAA 2H7VA 1INLA 4MW0A 3Q0IA 1WETA 2QN2A 3D3NA 1K6MA 4TKVA 3MXOA 4M21A 3ICEA 2H0AA 1S4MA 4YRMA 1VIAA 4DMUB 2QAGB 1LX7A 1QU2A 4XI9A 5JV5A 3JRXA 4RNCA 1DT3A 4BV8A 4IGIA 2G25A 4JYCA 2WYUA 5IUJC 4P4UA 3IMCA 4ZCQA 3SF8B 3T54A 2EYUA 1A7KA 1DVRA 2QENA 1RM4A 1OH8A 2XNDA 5CFOA 1EESA 4MS3B 3AZQA 2FKNA 5JO9A 2OO5C 5FTKA 4CMKA 5A04A 2QOEA 4HDSA 3REGA 3L4BA 3D6UA 2W2LD 4GYJA 4RQUA 3PXCX 3O4HA 3GJQA 4G5HA 3KVYA 4DSZA 4P4SA 3R6LA 2ZEJA 2OG2A 1FRFS 2BMWA 2BR4A 4JP1A 4UVDA 5B1HA 2DR0A 2PKYX 1WX1A 3L7JA 3L4EA 1ZFNA 4PYNA 4RY9A 1RC0A 3SM9A 3X1JA 4ARUA 3PC2A 1MIOA 3LY9A 4DLNA 2UVDA 4KO8A 5A6SA 3OE4A 3MTDA 3HXMA 3R0JA 1I0ZA 4CE6A 1DJOA 3HKDB 2AV6A 2FMUA 3KXKA 1A2QA 2R25B 3MFQA 3MGCA 4BMPB 1U0GA 2WVHA 3NS7A 3ABQB 3AF5A 1JVNA 3MWGA 2MWMA 4D82A 4EG6A 2XRYA 1AKRA 4Q4AB 4JOQA 2Q6KA 1XXHA 4WV3A 2ZSUA 1C9YA 2XWBF 4J43A 3P7MA 1W76A 4M60A 2NZXA 4TL6A 4BAGA 1S9DA 7GPBA 1FFCA 4OVKA 2QLTA 3MUEA 2VJNA 2I91A 3SBOA 3S40A 4OP2A 1SMKA 4H1UA 3QP9A 1BQ4A 1G9TA 5EOVA 4F21A 1PJ4A 1XPJA 2H2FA 3LLVA 1A9XA 3I92A 2WZQA 5DI3B 4QUIA 3RUHA 1VB5A 5DX1A 2OZLA 3BWCA 1N9ZA 4F3NA 1JDSA 2W2QA 1PR2A 1U7DA 5ILOA 3H4TA 4QPNA 2IOFK 5JJIA 1RQ2A 3BXFA 2JFXA 2FWAA 3EDMA 2DFLA 1YK0A 4DNFA 1TTPB 3Q41A 5D3MA 2GD1O 4OM7A 3VNBA 4RQAA 1XTSA 5ERGB 1XZJA 4EKDA 3WGQA 1QIEA 2OVFA 1PJ2A 1TT5A 2P9CA 4AIIA 4YRIA 3M6AA 2OESA 5LC1A 1I3CA 4WVLA 4YWJA 5JSUA 1TU4A 2J0VA 3LS2A 3DB1A 2DX7A 2IXBA 3HP7A 2E85A 3GH3A 1Z5OA 2VOJA 1Z0IA 2ABWA 1P73A 3FXAA 3BMQA 1M6EX 1XZAA 4QYMA 3WMRA 2JFQA 3HM2A 4Y0NA 5M3BA 5CCEA 1CRQA 5AI9A 2A78A 4TS4A 4AICA 3ZLJA 5L40A 3B78A 2ZJ5A 3UK1A 1ADJA 4LISA 1PJSA 4D92A 5KYXB 2XRZA 3I2GA 2P62A 3CVUA 4HXEB 1AUPA 5JBQA 1IXSB 2WM2A 1QYWA 2VN8A 1CUXA 3MT7A 4UD6A 2DSTA 4YAIA 1IXYA 1LEHA 2XX3A 4L6CA 3EULA 3GHHA 3K16A 5IYZB 3HO6A 3INGA 3I2KA 1H0SA 1WXIA 5H70A 1IFXA 3JQBA 4CIDA 3CGWA 1JE0A 1NV8A 5IN4A 1QFXA 1CULC 2B35A 2XVMA 1O7JA 1ZI9A 2GPNA 2QMHA 5A9SB 5AVQA 5L95A 1U3GA 3G6KA 5EXDA 2E5LB 1UOPA 3HJNA 1P9WA 3EF3A 4FKMA 1YE8A 1ZK1A 4MUIA 3IMKA 3V7UA 4EG7A 4PF1A 2XQFA 1U0RA 4QZVA 1QYXA 3BAZA 2PQ6A 4D8VA 2BN4A 2Z2JA 5D5PA 4GWKA 1M33A 2PKWA 2JK1A 1XP8A 2B20A 3H9CA 5AM0A 1FXWA 3TTVA 1LPMA 2P0YA 4ND1A 4CKEB 2V58A 4NBWA 5JTUA 1V3VA 2HK9A 3LP6A 1EUCB 3NUQA 4I1SA 4MI9A 1FFBA 4ZP1A 3E58A 5KTSA 1NC1A 4EKIA 5IU6A 3FVTA 1XVTA 1J90A 1FSSA 1DQNA 2X42A 3GCXA 4MRVA 4UZEA 1C8KA 5EIXA 4RELA 1I36A 3MN1A 1YD7A 4QGFA 1VP3A 3CZ5A 2CL6X 2Z2ZA 1QHXA 2CLDX 1ZK2A 2HMTA 1W96A 3D8UA 2ZI5A 3MWEB 3P9ZA 3R3UA 1SY7A 3T9DA 3M2PA 1R3DA 2GD6A 3DVQX 1G41A 1MX5A 2IIBA 2PT6A 3LD9A 4LV6A 4YP1A 1GSOA 4Z3DA 5T41A 1ZM7A 3SYRA 2IIPA 3LRPA 4Z1MD 2NTJA 3CZRA 3PG5A 4HNRA 5GADl 4G07A 1CDOA 1RHRA 1U3VA 3R3ZA 3WWYA 2IYZA 5IAOA 2F3SA 2BTQA 4B31A 4E5VA 2F8SA 1TTTA 3H9JA 3U16A 3HH8A 1UT5A 2LE0A 3MINA 4PRKA 1PJRA 5FNZA 2X13A 3ZDQA 1FPMA 3ETLA 5G0VA 2ZIGA 5EP4A 4A8JA 3AR7A 4FYVA 3NBQA 2XOXA 2PUVA 3EQZA 4YMSA 4ZV4A 2V7TA 2QVCA 1D4AA 3EZYA 2E7ZA 4G5YA 3RYHA 4H59A 2Q6OA 2VC2B 3WFZA 2WSLA 1X87A 4TTSA 1XT6A 3H3JA 3H5AA 2WD8A 3PQ4A 4WXEA 1OC2A 1QIFA 2UUAB 2ASVA 1CP2A 2QV0A 4MS4A 4MRNA 3GRKA 4OXYA 3M2TA 4UUQA 1MO6A 1V2HE 4BUZA 5CHYA 1JFTA 4DNQA 4LNHA 4JBLA 2JIOA 5FA6A 4XR9A 4H7IA 4B9EA 3EZ6A 3W5HA 3FHCB 3VO8A 5CVJA 4LJYA 4IYJA 3N5KA 4AO8A 5KOHB 3FFAA 3SHFA 3QVMA 4G4SP 3OOSA 4IFBA 5L51A 3L84A 4GG1A 4IDFA 4JVOA 3QA9A 4INZA 1DRWA 4KIGA 2BEWA 2BP7A 1VLMA 1WHTA 3KBBA 2GAFA 1R0SA 2VPIA 1LLCA 2YOFA 3IJEB 3PUYA 1XCBA 2P3OA 1L4GA 4IXWA 2V7UA 5CG2A 1OFGA 3IQFA 3ETEA 4BE7B 2JB9A 1KIAA 2OHGA 4HHEA 1IZ7A 9MHTA 5KKAA 5CBPA 1Q19A 1MP0A 5KNDH 3U80A 2GF2A 3ELDA 2R6HA 2YQZA 2QK4A 3H1GA 1R50A 5HIIA 1JE1A 1OAAA 1G5FA 2YHUA 3R3SA 2EIXA 4RU1A 3E3LA 1F3OA 2OD2A 2PS9A 5KDLA 1FP7A 2NSDA 8ADHA 3DT9A 4IVQA 1E7YA 4W8OA 5FI0B 5B3LA 4MGYR 2FFQA 2JCBA 2NAFA 2FDCA 2B37A 2PCJA 2XWQA 6ABPA 4H15A 2D00A 2XCUA 4HGNA 3UTDA 4YR7A 2AW3A 4JLMA 2VDWA 4G0OA 5DP2A 2I1WA 3EGDA 4HGPA 2HMYB 2XCLA 3IBGA 4G4GA 4K6KA 3NTXA 3BIOA 2CFCA 3IELA 1Q14A 3PNPA 4ON9A 4QFDA 3WYFA 1AA6A 4YDRA 3EC2A 1H6CA 1SH7A 4GSYA 4LGYA 1EVYA 4LXTA 5LZ7A 4LJ9A 4XSGA 1U90A 4R2XA 3LBYA 3G2HA 3WLTA 2DFNA 2O1EA 4C0LA 4KHPB 2CKMA 5BRJA 1EQAA 2PMFA 3UJ6A 4UNPA 1PR0A 1SIWA 2JL1A 1RYDA 1W0JA 2W2PA 4BCDA 5IXJA 1EDOA 4A0QA 3PDWA 2IKQA 4LDQA 1IPHA 3T3MB 4LZNA 1NMSA 4C0BA 2I78A 1TJNA 1SCDA 2YV3A 1FFDA 4X3CA 3WGOA 1RR6A 5BQ5A 2P9YA 1KJYA 2IU3A 2J3IA 2JJYA 2POQX 4KYIB 4AJ9A 4AS2A 3D31A 3CTPA 3MJCA 5KDDA 1DEKA 4R81A 5FADA 5I9MA 2F3RA 5E7JA 5I9SA 4QHSA 4ABYA 3FBTA 1NYRA 2FPXA 4GXQA 3A6PC 5FUVA 1J2YA 3KT3A 1G20A 4AUEA 1M34E 1TF5A 4M22A 3PPWA 1O54A 5BN1A 2XTZA 4BTEA 2ZUEA 4F71A 1KZ7B 4YAGA 3DE4X 1XAIA 1BEUB 3A1TA 2OXFA 4PO1A 5KYWA 1DKUA 2FFHA 5I7SA 1ABFA 3SQWA 1UWKA 3IEUA 1SB8A 4I6GA 5DYGA 1MQSA 1X13A 2Q2QA 3COWA 1ODFA 3AP3A 3HCAA 4IDNA 1T0BA 4JR2A 2A0XA 2GF9A 4LNUA 4PONA 3ZE1B 4A15A 2ZCJA 2VKTA 4EGQA 3TR6A 4V0MA 4EI2A 5TQ2A 3VSBA 1NYQA 1P81A 2H29A 3PNBA 3TEJA 1RAEA 2FPIB 4MRPA 2QJTA 4BNUA 3ROPA 5K3SA 1B26A 4Z9AA 3WMGA 3EVZA 1SHUX 4FFVA 4XX0A 1IEVA 3KCNA 5KNDD 3VI4B 1X7GA 4MX8A 3D02A 4U2KA 3EIXA 3RU7A 4AUMA 4PLVA 2ZQZA 5H3LA 4U7FA 3ZDZB 5CIYA 2O0LA 3VKGA 3Q2KA 1X80B 4KODA 3P8ZA 4LXXA 1JLLB 3SLRA 4OP3A 4KI7A 1GGEA 1S01A 5JAQA 2BBWA 4XWKA 4TGLA 4TKVB 3ZBQA 1VE1A 2GN2A 1TO6A 4IGKA 4UFOA 3V4LA 2IWRA 3V8VA 1SN7A 4GI3A 1JH9A 1K06A 3H5VA 1QZXA 5IVPA 2VUHB 4DMLA 2Y4OA 1QIHA 4P4LA 4PS0A 3CRW1 3TLMA 3I1FA 4I1VA 4CRWB 4D96A 5EUCA 4FHFA 1WD7A 4JJKA 3ZEIA 1C4OA 2CMGA 2C29D 2I9KA 1Y48E 2PCLA 4BWFB 1M7GA 4BQOA 2G76A 1MZPA 2RHBA 3FLMA 2GEVA 2WSSA 1X7DA 4X3OA 5DHUA 2DPGA 1X8LA 2O8DA 2ODQA 1QE3A 1JG6A 2QXYA 2HXSA 2XQGA 3EZGA 3F5MA 1P45A 1UP4A 1M1YA 1WAMA 4NFYA 4Y6GB 2PK3A 5B3JC 3DEZA 1CUZA 4G8BA 1EA7A 3M6IA 4GQAA 1JL3A 4IDBA 2OXTA 3RSLA 3UIEA 3W6OA 2P2GA 1B0AA 3KD2A 5C3MA 3AHDA 4Q7JB 2F1IA 1OVMA 3K5HA 1GNSA 3KOYA 3JQFC 5LZ8A 2I99A 2BFAA 3ECCA 3FWNA 1IM2A 3DBIA 3GEMA 5JVDA 3HB7A 2G77B 1J99A 3IESA 4H0CA 4DIMA 2YMLA 4F1WA 3DMHA 4Y1RA 4J8PA 3ZE7A 3FTFA 3K8YA 4RVNA 3TLJA 2G0NA 4W5JA 1ZRNA 3BJIC 4DBVO 5ADUS 5JNRA 3R7BA 2IL1A 2XTMA 3AM4A 4LDAA 3FHLA 1TQDA 2E4ZA 2XB9A 4ZO9A 5T3UA 2GETA 1UWCA 3TS1A 3TGLA 1ZU5A 5F9FA 2E82A 2ZTSA 2QJOA 3WK4A 2WYIA 4G6ZA 4RHTA 4WZAE 3UJAA 3C7CB 2HDWA 3WL3A 2ZJ1A 5AI0A 4ISBA 3HDHA 5G1NA 1GV1A 1Q74A 1Y4AE 4GC5A 1DWUA 3L93A 3AHEA 3A2NA 4IEFB 1KY3A 3WNQA 5F7OA 1PFQA 4N3NA 5FAXA 4J2HA 4MVJF 3UGTA 1SELA 3L2OB 4LBVA 1K6IA 5FI3A 7YASA 4G1BA 2XB6A 4EY5A 4MW5A 2W8ZA 4I55A 2RAUA 2OPBA 5CJJA 3K6KA 3QJYA 4BEBA 2H85A 4X3PA 1AF7A 2WVJA 1C4WA 4WBNA 5JG7A 1FDIA 2WNHA 4FFSA 2AYYA 1OGJA 1RM0A 3OI7A 3UT5B 2XCSB 5JS1A 1P4GA 3HYNA 3ZGXA 1JFFB 4BPBA 2Z09A 4EY3A 3EGEA 5D3KA 1VSVA 4DUYB 1J06A 2IUUA 1SXHA 3DMGA 2OENG 3O82A 3REOA 4L0DA 1KFKB 5LQNA 4OATA 4NFLA 5SZJA 2CMHA 4Q3LA 3E9YA 4TZTA 3D7SA 3INNA 3NVMB 1U1IA 3SC2A 1ISSA 2HK7A 1SD1A 4HS9A 3UW1A 3VPFA 1S2MA 1I7LA 1WV0A 4GX5A 2KHZA 1UMDB 1V5GA 3DE0X 3SDSA 1JQKA 5KYNA 4C20A 2IOFA 4GOKA 1JA9A 1W85B 3GUCA 2XGOA 3TEFA 4Y0VA 3E84A 4LQLA 4MUFA 4ZAGA 3U17A 3UT6A 4XD2A 4F6LA 4NAVA 1IK6A 1JKJA 4XFKA 1GCGA 5LZ9A 5JQWA 5EHNA 2YWEA 5KHOC 4RM3A 3VGJA 2WG2A 1X1BA 4KXMA 1BU8A 1XDWA 4BVKA 4QTXA 2AFIB 2UVQA 4FCCA 1XTRA 3GIDA 4X7BA 5JDIC 1B3RA 3EGDB 4FHDA 4XB6B 1E1RA 1ZI8A 2X8AA 3QXGA 3L7AA 1YT5A 3KU1A 1RZRA 4F5YA 3GZNB 5E3JA 4E5DA 5EJ4A 4PYMA 4PC3A 1MZVA 3NG1A 4DYDA 2WWWA 2DWQA 1E1MA 3N0WA 4M0UA 4LRQA 1VYVA 2IS1A 2O4CA 1HMYA 1NP6A 4ZZ1A 5IFLA 1N3IA 5HM6A 2OTCA 4NZ9A 5CT5A 2EG9A 4IZIA