1N7HA

Crystal structure of gdp-mannose 4,6-dehydratase ternary complex with nadph and gdp
Total Genus 129
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
129
sequence length
339
structure length
331
Chain Sequence
RKIALITGITGQDGSYLTEFLLGKGYEVHGLIRRSSNFNTQRINHIYALMKLHYADLTDASSLRRWIDVIKPDEVYNLAAQSHVAVSFEIPDYTADVVATGALRLLEAVRSHTIDSGRTVKYYQAGSSEMFGSTPPPQSETTPFHPRSPYAASKCAAHWYTVNYREAYGLFACNGILFNHESPRRGENFVTRKITRALGRIKVGLQTKLFLGNLQASRDWGFAGDYVEAMWLMLQQEKPDDYVVATEEGHTVEEFLDVSFGYLGLNWKDYVEIDQRYFRPAEVDNLQGDASKAKEVLGWKPQVGFEKLVKMMVDEDLELAKREKVLVDAGY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GDP-D-mannose-4,6-dehydratase
publication title The structure of the MUR1 GDP-mannose 4,6-dehydratase from A. thaliana: Implications for ligand binding and specificity.
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Lyase
total genus 129
structure length 331
sequence length 339
chains with identical sequence B
ec nomenclature ec 4.2.1.47: GDP-mannose 4,6-dehydratase.
pdb deposition date 2002-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16363 GDP_Man_Dehyd GDP-mannose 4,6 dehydratase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 1n7hA02
3.90.25.10 Alpha Beta Alpha-Beta Complex UDP-galactose 4-epimerase; domain 1 UDP-galactose 4-epimerase, domain 1 1n7hA01
1HYHA 5L4NA 3AUTA 4NMHA 2PKRA 3A14A 4PG7A 1LTHR 4ZQHA 3F3SA 3IDSA 3VPHA 1ZK2A 1MLDA 5JPIA 4Z3KA 2DTXA 1SCUA 3IUPA 2EP7A 2OP0A 4ZGWA 1N1GA 4Z9FA 3ITKA 2DKNA 1JKFA 4E21A 4NHEA 5DBFA 1ISIA 4L4RA 2R2GA 2Q1TA 1NM5A 3L77A 3LF1A 4YQZA 4NQZA 2PZJA 3KSUA 1V0JA 2XOXA 4CMEC 1K3TA 3Q2KA 3QVWA 1P1IA 1WXDA 2O2YA 2YUTA 1M76A 5JO9A 1TT5B 4OGWA 4ZRNA 4ILKA 2P91A 4PVCA 1BRMA 1Y9AA 4YAJA 2HLPA 5F1PA 5A05A 2O3TA 3KYCA 1E6WA 1JQBA 3PJGA 1EUDA 3SLGA 3K92A 2QZZA 4N54A 3L4BC 4Z0PA 1KEUA 4XQ9A 1GUZA 3ROQA 1I36A 1NTOA 1S7CA 1UXJA 1XEAA 4QTZA 3AM5A 4K28A 1KVTA 4M8SA 3UN1A 5A9TA 5IXYA 2NVWA 3ONFA 3AU8A 1PQWA 2WYWA 2VWQA 4PLCA 4J4BA 4PG5A 1D7OA 1GUYA 4UREA 3OEWA 4Z0TA 2JHGA 1RM3A 5TT1A 2Z5LA 3DC2A 2EJVA 1ZK1A 4R1UA 3VDRA 3T7CA 4BNWA 1WPQA 1U1IA 1EFKA 2IE0A 2Y67A 1DFIA 4RPKA 3QE3A 4MVJP 2VNAA 3RROA 1PS0A 2TMGA 2HUNA 4E12A 2BD0A 2RH8A 2DFDA 1KVSA 3W6ZA 1JU9A 4M49A 3DFUA 3ST7A 4EJMA 4IINA 1LRJA 2CFCA 1WDLA 3NEPX 3C1AA 3M6IA 4BNMA 2PWZA 2P4HX 4L8VA 3RVDA 5FI5A 3C1TA 4PLWA 3AFMA 4OHUA 3ZU4A 2CDCA 2FMUA 4LSWA 3GAFA 4N5LA 3GGPA 4XR9A 4E2YA 4OKNA 3COSA 2VNSA 4R54A 1NFRA 4ZQBA 1SNYA 3F4BA 3GF4A 3L07A 3TZKA 3RKRA 4IY1A 3ZNQA 1KVRA 1JWAB 4MKRA 1J49A 3HQ4O 3D4OA 4PLHA 1C1DA 3AJRA 5A5FA 4CR6A 2Y66A 5DOVA 1XWFA 2NQTA 2VZ0A 4LSMA 2OP1A 3RASA 4MVJG 1K0UA 2Y1DA 1O89A 2HQ1A 1BVUA 2Y68A 3D3WB 3NJ4A 1QP8A 4YEDA 2GZ2A 3GA0A 3IJPA 1BVRA 4AJIA 4DC1A 3P5SA 2X5KO 2BF7A 4CV1A 1DIAA 2NLOA 5IXSA 2G0TA 3AUUA 5JMPA 3TL3A 3W4IA 1YO6A 3HB5X 4LRTB 4R68A 3CSDA 1DDOA 1L7DA 1PGPA 4JIGA 1ADFA 3LT4A 5AVOA 5AXBA 2DQ4A 3RFXA 4XQEA 5BR7A 4RVSA 4F3YA 3LSYA 4Q3EA 4LK3A 1G0NA 3VH3A 3NDRA 1QV6A 3ZU5A 4WEOA 2AE2A 1JAXA 3GVHA 4LRSB 2FRDA 4WLOA 3HJAA 4Z9XA 3GUYA 3U0BA 4O0LA 5CFZA 1P44A 2X22A 1EDZA 4CMIB 3W8DA 4CODB 1BMDA 5LDHA 1MXFA 4II2A 4E5NA 1LDYA 3ABIA 5IN4A 5JC8A 1M6HA 3GNSA 1E5LA 3BMCB 2JJYA 2W2KA 3OSUA 1Q1NA 5CPBA 2E6UX 3ZV3A 4MIYA 3NX4A 1DO8A 2EXXA 2O7QA 1QG6A 4B3HA 3BMOA 4FDAA 3RBVA 5C7OO 1UP7A 4W7IA 4U8GA 4RVGA 4RF3A 2D4AA 1XR3A 2YHIB 3EAGA 3ZZNA 3WOHA 4MOWA 1JN0A 1SAYA 3DL2A 1ZK3A 1P0FA 4J1QA 3PZBA 4NU6A 1QRRA 1RJWA 3MJVA 1CF2O 4GMGA 4JP3A 3W4KA 2NSDA 3JQFC 3VH1A 1YL5A 4AG3A 2BFPA 3P19A 3FNFA 4AFNA 4BQPA 1DB3A 2EF1A 5L40A 1UUFA 4I1IA 2AQHA 4G65A 4GLLA 4S1VA 2OHXA 1NPTO 2C2XA 2J5RA 4IIVA 4BKPA 3QA9A 2JD2A 1U9JA 1YDWA 2R00A 3E9MA 3OP4A 2C82A 3DMYA 4B4OA 5G0UA 3O38A 4XQCA 4HV4A 2O50A 3CUKA 4YB8A 3NGLA 4AJEA 3EUWA 3NT5A 3DZKA 1H6AA 2NM0A 4J7XA 3KV3O 1MP0A 2BGMA 4IDGA 2EP5A 1YJQA 2PA3A 4EUHA 2B69A 2O4CA 5DBIA 3GRPA 4Z6KA 5ICMA 1QKIA 4BKRA 1PZEA 3AOEC 1NBOA 4H3VA 1YRLA 4HY3A 4I8XA 5ICSA 1ADCA 4PLPA 1GZ3A 3HUDA 3IKTA 1I33A 3I52A 4IPTA 1I8TA 3U62A 3C3XA 3L6EA 3G1TA 1LEHA 4UVEA 1WAMA 2EKQA 5CP8A 4JXKA 3PJFA 3BIOA 4R16A 5IAAA 2V7PA 3N58A 3GGGA 4DXHA 2OBYA 2XXJA 3JQFA 3U3XA 2OZPA 1U5CA 4OJNA 1DJNA 4K1LA 4XZ3A 1P1RA 4B8WA 1I3KA 3ZI0A 2FWMX 2ZYDA 4UVHA 2ZCUA 3MEQA 3RUAA 4BB6A 5C7LO 4BGUA 1FMCA 1H2HA 3WGTA 3BXXA 2W2LD 1ZMOA 3NTRA 3IL2A 4B8ZA 4I9UA 4MVJA 2WE8A 1CERA 5L53A 3ZHBA 2Y1CA 4YRBA 4BS9A 1ZUD1 1KC3A 1P74A 2JD1A 1KOLA 1X1EA 4JQCA 1MG0A 2O4UX 3X2EA 1E3SA 2HMWA 1ISGA 3P7MA 4XGIA 4BNZA 3OIFA 1B16A 5IDXA 5B4UA 4U0KA 3WYEA 4BMVA 1VJ0A 1MFZA 4IDFA 4AJ1A 3I9MA 4YBZA 5DBGA 1NPYA 4Y98A 3QHAA 4IXTA 3T4EA 5JY6A 2WYVA 4Z0HO 3OICA 3HFSA 5FF9A 4O63O 3H5RA 1G1AA 2FSVA 2PZLA 3F5SA 3BTUA 1R4NA 3I6QA 4YA6A 3LQFA 1ZEJA 2VWGA 3K2EA 1VLLA 4ZU3A 2RAFA 4FSHA 1ZXBA 3D1LA 4CMJA 4J43A 2B5WA 4PZDA 1I30A 4XX0A 5CAEA 3KB6A 1WP4A 4R9SA 2H9IA 5H81A 3TOZA 3ZHZA 2FPIA 4E5YA 2VTEA 2ZTMA 3SC4A 4CR7A 1A4UA 4J0EA 1B8UA 1H6CA 1QSGA 2Q4EA 4FR5A 4AJ2A 2IRWA 3ORFA 1GL3A 5DT9A 2X8LA 3G0OA 4QUKA 3G49A 4LMPA 4BNLA 4OOFA 3F4LA 2GN8A 3B1JA 3H3FA 1YOVA 2DPHA 1ZMTA 1YVEI 1BDBA 1IHYA 4FFMA 4A2CA 1C1DB 2HAEA 3KM0A 3GPDG 2Q45A 2VUTA 4BMNA 1EMDA 4FGWA 3GOHA 4CJXA 5F3RA 5GZ3A 2QYTA 3JQ9C 4PRKA 1EDOA 3OQBA 3OJFA 3WQRA 3ASVA 3H4VA 5JCXA 3TZQA 1HZJA 3HSKA 4BNGA 4EUFA 1T4DA 3TFQA 4WCFB 1Z75A 4B79A 4GBJA 1N7GA 4XYLA 3NRCA 1A5ZA 4XQGA 1Q2XA 4MKXA 4P22A 5A04A 2JFFA 5JXWA 1JDJA 4R3NA 2UVDA 4BNUA 2ZIZA 3RBZA 2VUUA 4PLYA 1PGQA 3V8BA 5EL0A 5BSHA 1JKJA 4MO2A 3VH2A 4WLEA 4C7JA 2HDHA 4NU5A 5B37A 3JQBC 4CM3A 3ASUA 5AOVA 4D42A 1MC4A 4BV8A 3CZRA 4CMGA 3INGA 3CMCO 4ALIA 4BNYA 1RPNA 3FNEA 4ND3A 4CUJA 3DAFA 1OOEA 4RF2A 2CVQA 5EMHA 2Y93A 4U7WA 1VL6A 3PI7A 4YJFA 3UCEA 3TDKA 3WB9A 1UH5A 3ZCXA 1U3WA 2EGHA 2DT5A 1NP3A 2ZB7A 4DPMA 2RCYA 1VPDA 5DULA 3DZBA 3RJ9A 4RF5A 4DL9A 1AHIA 4MVJI 3AFNA 4NR0A 3GZNA 2WTBA 4XYMA 2VUSA 3WLEA 2YHIA 5DP2A 3DXFA 1XQ1A 3GDFA 5IDYA 4XB2A 1YS4A 2JCXA 4L4SA 4D79A 1UJMA 4GVXA 3WIDA 3E03A 2BFOA 1H6DA 1KS9A 2X23A 3ZWBA 4Q39A 1E77A 3G79A 5A3JA 3I9KA 1PEDA 2JAHA 2BFMA 3FPLA 4XDZA 4P38A 5EQDA 3D5TA 1ZIDA 2O2SA 2X0NA 4J2OA 3S2FA 1NNUA 5L7TA 1E7YA 2PGDA 1YQXA 1V9LA 2CD9A 4Y67A 5G0SA 1J5PA 1UP6A 1HE4A 1H2BA 3DBHA 5G2OA 4UVIA 5F5NA 2NV6A 2CMDA 1XIVA 2OL4A 3ZGYA 4D45A 4TWRA 4AJNA 1X7HA 2NACA 2O3UA 1B8PA 3FCOA 1HRDA 3LU1A 4I9HA 2YHUA 3DZFA 1W8DA 1QLHA 5I7FA 4FPXA 4ALJA 3ADOA 2GASA 4II3A 4NFHA 4BO1A 2W2LA 1JA9A 3OA0A 3NTQA 5KVQA 3PTZA 3K2BA 1HWYA 2X0IA 1TB4A 2CSUA 4RPJA 3WIEA 3ICCA 1LDBA 3UCFA 4HFMA 1B8VA 3FNHA 4BQRA 1VSUA 4GKVA 3PVZA 5U9CA 4HXYA 1G0OA 4YTEA 1WDKA 5JAQA 3GC6A 3R3SA 3DAGA 2VRBA 4RO0A 2IYPA 5TS3A 1UAYA 4FJ2A 2ZKLA 1HTBA 3ONDA 2Q3EA 3C1OA 4PRLA 1RM5A 4Q3NA 3NAQA 1PL6A 3BMCA 4RVDA 3ZDFA 3L6OO 1O0SA 1WMBA 5G0WA 3JD0A 5ENDA 4NIMA 4RL6A 2NTNA 3LT1A 1X0VA 2Q50A 4LCEA 4R01A 4WPGA 5EPOA 3TSCA 4MPDA 4CMHA 5ILOA 2EV9A 4WK6A 1J4AA 5CEJA 1R12A 1PJBA 4MP3A 4R1NA 4YVFA 5JO0A 1Z74A 2XXBA 4NBWA 3UICA 3K96A 2QX7A 5AXDA 2I76A 5TLSA 1U7TA 3LC2O 1UXGA 1I3LA 2P9GA 3I9NA 5BNTA 4CM4A 4KOAA 4P4GA 5DF1A 4J7UA 1LQUA 3FBTA 4YJFB 1ZFNA 1Q0HA 4R4JA 1NVMB 1XU7A 4E31A 5L51A 3JQ7B 1SZJG 4FN4A 1HDYA 3RC7A 4W7HA 2D5CA 3H9EO 1HE2A 5L4LA 1XGKA 4GX0A 3CH6A 2OO5A 1Q7BA 1N1EA 4WCFC 4ALMA 3GZNB 5G4KA 1ZJYA 1D8AA 3EYWA 1W4ZA 2GZ1A 4UUMA 4J4TA 3WXBA 2G17A 1OAAA 5HRUA 3ZWVA 3AUSA 3L4BA 3FWZA 4YJGB 1HKUA 1N92A 2ZQYA 1HEUA 4E5MA 2NUAA 3UKOA 1UZMA 4DQUA 4EYEA 3ROKA 4D7AA 2B36A 2I67A 2BH9A 3H9GA 3V2HA 1Z82A 2VN8A 1NFFA 4E13A 2YJZA 5JAIA 3PHLA 4HP8A 2W8ZA 3QVOA 4XRRA 1NQ5A 4KZPA 5L45A 4TRJA 3DB2A 3GY0A 3VKVA 4JN6B 3E48A 2ZJ1A 3EVTA 3CIFA 5JS6A 1SC6A 1Y6JA 4WCFA 2ZB3A 5DP1A 1HDCA 3AOGA 5A02A 2OUIA 3AU9A 4GPD1 2IXAA 2NQ8A 2EKPA 2DBQA 3CPSA 5I9MA 4O5OA 2ZYAA 2X5OA 4OO3A 4RVUA 3Q9NA 4C4OA 1PTJA 2DC1A 5K0ZA 3KETA 2HMUA 3EC7A 2B4RO 5I8ZA 2D3TA 1E1NA 2EW8A 4DVJA 2NWQA 3FF4A 4KMSA 3WFIA 1N9GB 9LDBA 1W0CA 4UVDA 3RUDA 1AE1A 3OJEA 4J3FA 3OJ0A 3ZWWA 1SO8A 1YGYA 4OOEA 1GCOA 4YT8A 3R1IA 3GG9A 3C85A 1JWBB 4JX8A 5ADHA 3Q1LA 4E30A 5JY1A 4ITUA 2J5KA 3LT2A 1H6BA 3R0IA 4PFJA 1GAEO 3QVSA 1O8CA 5CDTA 4EUEA 1Y1PA 4QECA 1R4MA 4DBVO 1NVGA 1FF9A 4IDAA 3SVTA 1XHLA 5MGBA 4U5QA 2X7HA 3C7AA 2SCUA 3KOUA 3U09A 1LDEA 3DOOA 1ZK0A 3PGJA 5TX7A 1ZKMA 4NBTA 4BO2A 1NR7A 4OXNA 1OBFO 3N7UA 1E1KA 1UXHA 2R6JA 3BHMA 2VZ9A 3OA2A 1NAIA 2PGLA 1M6WA 1T26A 3O8QA 4ZHSA 3GNQA 3ROPA 1RM0A 4ALNA 4ZQEA 1E3WA 1PJTA 5KKAA 2CNBA 1X13A 1PJLA 4NG5A 4ESOA 3RU9A 3DR3A 9LDTA 1DC6A 3AY3A 4ID9A 2NU6A 1GQYA 4CM1A 3O26A 1HETA 3UXYA 1LRKA 1CRWG 2GSDA 3VPSA 5AXCA 1DXYA 3ZWNA 1SMKA 1BW9A 3AI3A 3NT4A 3FPCA 4FFNA 4N5NA 1AXEA 1I10A 5KCZA 3BHIA 3VTZA 1ARZA 1EVYA 3B1FA 3BMQA 4FCCA 2HKIA 2R00C 2X1HA 5KVVA 4CL3A 1GYQA 4WUVA 4MDHA 1LLCA 1PJ3A 4B3JA 3CTMA 4XWYA 2VHVA 2E4AA 1U3TA 1MX3A 1B14A 1AGNA 2C07A 1EEHA 2Y99A 4CQMA 5TC4A 4BHTA 2J5QA 4WJZA 3IUSA 5HWSA 2HU2A 1DSSG 2W90A 5B4VA 2GF2A 3H6KA 8LDHA 4K26A 4IIUA 1WMAA 5DN9A 2J3KA 4E2WA 2EIHA 1I5RA 2VHWA 4MJLA 2P68A 1K6IA 4W9NA 3WSVA 1GD1O 4ZICA 2Q2QA 3EY4A 1C1XA 3P2OA 1K6JA 3JYPA 1HDOA 3AW9A 1QYXA 2POQX 3PFWO 4IJUA 4E3ZA 3E9NA 1N2SA 1KETA 1O6ZA 2NTJA 4RLHA 1B26A 2Q46A 2JHFA 3DZJA 2PD4A 1BW9B 3HZZA 4M55A 3L9XA 3FRJA 3ZV4A 1U7HA 4BV9A 5TRTA 3AWDA 2GD1O 3GVIA 4MIEA 4DGSA 5A9SA 4QSMA 3CINA 4IDDA 1ZZEA 5IJZA 1ZO8A 3WWYA 4W82A 4XYBA 3LLVA 3GEDA 3KSZO 1JLLA 5L95A 2GZ3A 4RPHA 1DHTA 3DOJA 3IIEA 3MJEA 3G1UA 2B37A 4DIFA 2D5AA 3LC7O 5TIIA 2BLLA 2X58A 2PR2A 1LBEA 4Z9YA 5HS6A 3PYMA 4YT5A 1TA4A 3SC6A 2C0CA 2RBEA 5BT9A 5K6AA 1D4FA 1PS9A 2DU8A 4J91A 4FOOA 1I01A 1BXKA 1VM6A 1LSSA 3DMTA 3K5PA 3QY9A 4MKZA 2AG8A 5ER6A 4BNIA 5CG2A 2HK7A 3QSGA 3L4SO 4G2NA 5IZCC 4RGBA 2J3JA 2WM3A 5JFOA 2DAPA 2JL1A 4DPKA 2B4QA 3DHEA 3KO8A 3RUEA 3WGZA 3WJ7A 4B7UA 4BO9A 1X1TA 4K9DA 3OF2A 3N74A 1PWXA 1G6KA 4DMMA 3UF0A 2Y1FA 5FFFA 5JYDA 5THKA 4XA8A 2ZJ0A 1LSOA 1SOWA 1P45A 2V6MA 5BNFA 3WFJA 4XIYA 1FXSA 1QYVA 3PHHA 3ONEA 2HSDA 4FD3A 3GR6A 3UHAA 1T24A 4FFLA 3RQSA 2Y1OA 1HT0A 2VZ8A 3L6DA 4PIVA 3NV9A 4DIOA 3OEYA 1YQDA 4DBZA 4RZIA 2J3HA 4BO0A 2UAGA 1QYDA 2BMAA 4FQ8A 1DLIA 2DUUA 4R41A 3GMSA 5ENVA 3QW2A 1XDWA 3JQAB 1UZLA 3OFSA 1V8BA 1PZFA 3VZPA 2BGLA 4B7XA 4NFSA 5B1YA 4ZD6A 4EITA 2Q4BA 2A94A 1UDBA 4I5EA 1EQ2A 2GYYA 3LT0A 5TSDA 5B4TA 3OJOA 1Z73A 1Y8RA 4WLNA 3UH1A 4NZ9A 4HWKA 5L3ZA 4TRNA 2G5CA 4BL5A 2JCVA 1PGOA 2DVMA 5T57A 4EEXA 5CDGA 3WYCA 2C7VA 3S55A 4CV2A 2AQIA 4EDFA 1ISJA 2Z1NA 3S2IA 3KTDA 5EERA 4DQVA 2H5LA 1JAYA 3KUXA 3I4FA 3GUCA 4XJTA 4J1NA 1E3LA 3JQ9A 4BGEA 1EUZA 3E5MA 5JDIA 5DDIP 2IEBA 1HYEA 3IMFA 3RD5A 4EEZA 4U0JA 2O3JA 4XYEA 3V1TC 1F14A 5DCWA 4J1SA 4JCOA 4YAKA 5JAZA 1GUFA 1DOHA 2XPCA 3JQAA 1Y8QB 2NU8A 1NXQA 1QORA 4OIMA 4XGNA 5A3VA 3HADA 1PZGA 1XSEA 5HTOA 3TWOA 3FHLA 3ZNOA 1GEGA 4TKMA 3WNVA 3GT0A 4A27A 4HADA 1LRLA 1VKOA 1E1MA 1XQ6A 3VDQA 1Z7EA 3GK3A 2EWMA 3BHJA 3AM3A 3ZV6A 3DBRA 5JYEA 4CQLB 1YB4A 5FWNA 3GHYA 2E49A 4R9RA 4AJKA 2ZB4A 1CIVA 3PWSA 3WLFA 3ZW9A 4YT4A 1YB1A 3HWRA 4P8RA 3GVCA 3BZUA 1R6DA 3ZWYA 3PGXA 3TZCA 2E48A 2Y0DA 3JYLA 1O9BA 4BNTA 2LDBA 3S1LA 4DTIA 3ETGA 3F5QA 4FS3A 2TMDA 1BXGA 4XCVA 5T5QA 1EVZA 1GY8A 2D59A 3HG7A 2JKVA 4KP7A 4XYGA 4UAGA 1PL8A 4WE3A 4WKGA 3A1NA 1YONA 4D0SA 2YQ5A 4CM9D 4KWIA 3K73O 3UOGA 5J23A 2BRUA 3HDQA 4UEKA 5CHEA 3VPXA 2I99A 3RSHA 1LLDA 1MUUA 3MWDB 5KTKA 5IFLA 2EHDA 4L4XA 1Q7CA 2Y1EA 3INRA 4J16A 1PIWA 2QRJA 4D3SA 3VZQA 2AEFA 5TJHA 3GHHA 2IDZA 5DCUA 5G4LA 5HA5A 2Y0CA 4L0QA 3O9ZA 3V1YA 1E92A 2JCYA 5JAMA 3K9QO 4DA9A 1AXGA 1GYPA 1PJSA 2NU7A 2ZTUA 4DLBA 2C7GA 1I2CA 2ZATA 3E5RA 4DMLA 3RC9A 2W2KB 3ZNNA 1NASA 4YACA 1ENYA 2X5JO 3LLSA 3ZNPA 5I9LA 4XJSA 4LGVA 4JROA 4CMBA 2W4QA 1BXGB 3WQSB 1CDOA 2CZCA 1U2GA 1R15A 1E7RA 4R69A 3WGGA 5IG2A 3GPIA 1VL0A 3H9QA 3E18A 4FBGA 8ADHA 4HKTA 3QJ5A 3JQGB 4CLEA 3PQEA 2D2IA 1NWHA 2GDZA 1DPGA 3AUAA 4HUJA 1BGVA 5LCXA 4B4UA 4QT0A 3NYWA 5C37A 2BI8A 3ETDA 1ID1A 3GLQA 2F1KA 3BA1A 3DQPA 3A06A 4CM7A 4J9VA 1VE9A 1ZSVA 4IQGA 4TVBA 5CPFA 3RUHA 2IXBA 1GQ2A 1I0ZA 3A4VA 3PFFA 3QVTA 4XB1A 4H7PA 3H9UA 2QW8A 3JYNA 4CMKA 1ULSA 1MGOA 4JBIA 1SPXA 2CDBA 1RYDA 3IQDB 3DBLB 3QLJA 4OQZA 5TNXA 3R6DA 2VHYA 1T2EA 3KYDB 3U4IA 5K9ZA 3IC5A 4KUHA 1H9BA 2V6BA 1FJHA 3LYLA 1HDGO 2IZ0A 2NNLD 2WEKA 2IYOA 4ZQGA 1KERA 1ZVMA 4CMCA 5H83A 2QRKA 3JQGA 2J6IA 4HFJA 3BMQB 3H7AA 3NKLA 5HS4A 5T8KC 2D8AA 2RHCA 3AOEA 4HNGA 1FDVA 1AN9A 3VVCA 3PDUA 4NFYA 2C29D 3WX0A 2JFGA 4OSOA 3KVOA 1SEPA 4H16A 1I2ZA 3NJ8A 1UP4A 5G0TA 2DFVA 1A71A 4EW6A 4KTTE 1E3EA 3FI9A 3VZSA 3S2GA 3U5TA 2BELA 2GRAA 1HYGA 3ZWPA 1E1LA 4CV0A 1AHHA 2AHRA 2QIOA 4ND5A 4AL4A 2PTGA 3F1KA 1H9AA 1BTOA 3E8XA 5F1OA 1HE5A 1XG5A 4MIOA 2H1SA 4CQMD 4RDHA 3BMOB 4OXKA 1F17A 3C8MA 2HRBA 4OL9A 1DC5A 1E7WA 1PQPA 1ZBQA 2JD0A 1LJ8A 3WWZA 4LW8A 4M89A 2IZZA 3UFXA 2OFPA 3PDJA 5KWEA 3B1KA 3O03A 1MXHA 2GPTA 3PHJA 4BNVA 1WW8A 3X2FA 2C20A 2HJSA 3WTCA 4XEHA 4IGFA 3SJ7A 1QV7A 2B0JA 1GYRA 2AQKA 4YJHA 1JVSA 4BNXA 4BO5A 3RBXA 2V6FA 1QLJA 3DZGA 4PCVA 5FEUA 1PGNA 3ZW8A 1KVQA 2VQ3A 5DOZA 4OQYA 1DFGA 1LC0A 3ZWMA 4WASA 3MOIA 5EJ2A 2AMFA 1HXHA 1E6EA 3OECA 4IMPA 1YKFA 3QWHA 5G0VA 3I6IA 5LDGA 3WQQA 4BO3A 4HBGA 2NTVA 2JFHA 3V2GA 4XGKA 3NDJA 1PJ4A 1U5AA 4WGGA 5IDQA 3EZLA 1GTMA 1LDNA 5KJCA 3JD2A 5K6AC 1OI7A 1I24A 1T2CA 4YDRA 3TRIA 4ZQFA 1BWSA 3M1LA 4X54A 1ONPA 3D64A 1X15A 2EJWA 4GVLA 4W99A 2W98A 3B20A 2VYND 4YRAA 5I7VA 1DAPA 1WLYA 1IULA 2OBNA 3DBRB 4M54A 5AXAA 2E37A 2Y05A 3MCVA 2FZEA 2WMDA 3H8VA 3GN1A 1LLQA 3I1JA 4PG8A 4YPOA 5JBIA 3JD3A 3JQEA 1X14A 5TJ9A 3B70A 2WD8A 4NJMA 2VHXA 1NHGA 3IS3A 4E5KA 2VOEA 1JVBA 3SLKA 4N18A 1M2WA 3RFVA 2I66A 4PG6A 2GR9A 1I2BA 1XCBA 1T1RA 3C24A 4KQXA 4O59O 5JNLA 4BOYA 1C0IA 2VHZA 1OC4A 1UXKA 1V3UA 3KYDA 4QFCA 3KBOA 3RKUA 2X9NA 3DDNA 2HO5A 3WS7A 1Q7GA 4TVOA 1E7MA 2FPGA 5F5LA 1IZ0A 3EHEA 1BHSA 5AYVA 1SB9A 1M66A 4OMUA 2GN9A 4P4NA 3JV7A 3A28A 4Q3AA 5IN5A 4PLTA 1KVUA 3DTYA 1CQJA 4MVJH 1IL0A 1ONOA 4TRRA 3D4NA 4BB5A 3MZ0A 3Q6IA 3TOXA 2VRCD 1ORRA 4YRDA 1BSVA 3U4HA 4AJ4A 2BFAA 4YXFA 1J6UA 3JYOA 2GUGA 3JQCA 2DBVO 3RC1A 4JGBA 3WYBA 2E82A 3BYZA 1U8XX 4D41A 4OH1A 2NADA 3U4CA 2PKQO 4LCJA 2GCGA 3QV1A 1NQAO 4YAIA 1VRWA 2ILTA 1TXGA 4J0FA 1GCUA 4IJKA 1IZ9A 4K6FA 1GADO 4CPDA 1PWZA 2DTDA 3LC1O 4Y6PA 1QYCA 4CR8A 4CM5A 4ALLA 1H93A 1Y81A 3KZVA 4TRMA 4AJHA 2VT3A 2AE1A 1C0PA 4CUZA 4L75A 1HZZA 1T2DA 2PKQP 3W8FA 4YCAA 4RORA 2Q1WA 4YJHB 2B4TO 2FSSA 2RH4A 2G76A 4Z3DA 4CLXA 4QFDA 3LDHA 3PIDA 2PZMA 3FN4A 1DIBA 1NPDA 4RPGA 1JTVA 1P9LA 2IZ1A 1D3AA 4MVJD 2AEMA 1FDWA 4E5PA 1VSVA 1ZEMA 4B3IA 5JMWA 3DBLA 3KLPX 3MTJA 1LXCA 4XR4A 3SJUA 1UAGA 4OAQA 2UYYA 4LVCA 1H0KA 3GFBA 2XAAA 4JP2A 3D4PA 1GV1A 4NBUA 3IP3A 1E3IA 2X4GA 1W73A 3BMNA 4K6CA 1UDAA 4YWJA 3RWBA 1WVGA 4GGOA 3AI1A 1EZ4A 4G5HA 2PY6A 4WECA 1E7QA 1Z6ZA 2QQ5A 4IS2A 5THQA 2VWHA 3M1AA 3WMXA 1F0YA 1HSOA 5EINA 4IQ0A 3D3WA 1A9YA 2EG9A 2PFGA 2VCYA 3RC2A 5GZ1A 3ZWXA 1EQUA 1C3VA 1R4NB 2HMVA 4ZRMA 1H94A 4I08A 5T6BA 1ISMA 3QQPA 4NJMB 3Q9UA 3S8MA 3TZHA 4BGIA 3GZ4A 4I5FA 3FTPA 3SXPA 3L0DA 3NGXA 3DONA 3U49A 2FR8A 2Q2VA 3HDYA 4URFA 3IKVA 4YYZA 2GN4A 4B4WA 2C54A 3CXRA 1B7GO 1FK8A 4JK3A 3UGKA 2OXIA 2GGSA 1IHXA 4FC6A 3BMNB 4KUEA 1NHWA 3LZ6A 2BI7A 1OFGA 2P2SA 4FOSA 1XELA 3M2TA 3G3EA 3TF5A 5TQVA 4FW8A 1U3VA 1PR9A 1Z7BA 2QYSA 4MINA 4KDFA 3AI2A 3PYXA 4EJ6A 1X7GA 2YFHA 2ZYGA 5CEFA 1I32A 1NQTA 1TLTA 1DLJA 1SBYA 2C5EA 4KDEA 2O23A 2YV1A 4FFRA 3PLNA 1R16A 2C2YA 4KTVE 4PLFA 3WGOA 5HBRA 3KRTA 4QQRA 5I9NA 1N8KA 3HDJA 4OSPA 1R0SA 1DEHA 4W9NC 2QHXA 2WD7B 1M67A 5KJ6A 3GAZA 3E82A 4JBGA 2Z95A 4B4VA 4EZBA 4R5MA 5CDSA 3LK7A 1E0DA 1DC3A 2AQ8A 3TZ6A 4PN3A 3EMKA 3VOSA 3FNGA 3RI3A 1UR5A 3OH8A 4FC7A 2HCTA 5BSEA 3JQAD 5DNAA 2FHSA 1K2WA 1ENPA 5I7SA 1O95A 3DFZA 2DPGA 3EGOA 4P4LA 1V3TA 1LI4A 1C14A 1OMOA 4A03A 4BGVA 3UCXA 1PZHA 1YBMA 2YDXA 1PS8A 4BNJA 3FR8A 3DBVO 4NBRA 3KYCB 3QP9A 3V1UA 3ZHXA 3TQHA 2O3QA 1YBAA 2YFQA 4KWHA 3WGYA 4YJDA 4DIBA 5U1PA 3WBBA 3PHGA 3ON5A 3PIIA 1U3UA 1ML3A 1VC2A 1O94A 2Z1MA 1DHRA 3LF2A 1A72A 1K5HA 1MV8A 1GR0A 2WD7A 4GMFA 3WG9A 4RV9A 3I3OA 2RHRA 4NDNE 2V6GA 3HFGA 4GWKA 5TGDA 2A92A 3RFTA 4ZJUA 3I4CA 4UVGA 1P1FA 4DPLA 1O5IA 2QZ9A 5ITWA 3MOGA 2WJPA 4DUPA 2ZCVA 4A26A 5A9RA 1PQUA 4ND4A 4O6VA 4RCVA 4ONEA 1R0LA 4D46A 1UDCA 4H15A 3GFGA 4YT2A 3UVEA 1CETA 4PLVA 4CUKA 3RAJA 4LVUA 3PZRA 2WE7A 1KYQA 1KY4A 1EVJA 3RCBA 1GFSA 2AG5A 1J0XO 2P5YA 4J2HA 2WSBA 3AY6A 1R66A 4PLZA 2J8ZA 5BSFA 4BVAA 5JW6A 5KJFA 1ADGA 5B12A 1RWBA 4L9RA 1P0CA 1HSZA 4GX2A 1FDUA 3WJAA 1PU2A 3GDGA 3DWFA 2FY8A 4FJ1A 1NX6A 4GKBA 4RPLA 4AVYA 4BNNA 4HNHA 1F06A 1RM4A 3ANMA 3ITDA 2ZB8A 3TNLA 1X0XA 1AUPA 1VJ1A 3NT2A 4QXMA 4LMRA 1VKNA 1T25A 2P9CA 1LUAA 4E0BA 3U9LA 3WTBA 4E2XA 1NVTA 4UEJA 3DHNA 4XKJA 2XF8A 3GMDA 4TROA 4BIIA 3DEYX 3QWFA 1E5QA 4AJOA 2OGUA 3Q0EA 5KIAA 2O3SA 4IMRA 1Y9EA 4RVHA 4OM8A 1NFQA 1PX0A 2FPPA 5BSGA 3Q3CA 1LDMA 3DMTC 1IOLA 1TI7A 1FDTA 3CKYA 1HDXA 3DZIA 4BNFA 1WZIA 4R1TA 2FR0A 3WMWA 3DAPA 4Q9NA 2GLXA 5L9AA 1PJQA 1A7KA 2I3GA 3VTFA 1MC5A 3OQ1A 3QIVA 3JQBA 3TJRA 1GPDG 1GU7A 4ZN6A 1YH3A 1HDZA 1PSDA 4QO7A 3GDOA 3PJDA 5ER9A 1Y7TA 1IE3A 3MJ4A 3QWBA 4IQ8A 4IXWA 3PK0A 3VKUA 1IUKA 4CV3A 3SBOA 5I7EA 4JJFA 4YR9A 2FZWA 4TMFA 4TKLA 1EFLA 5L7WA 3D0OA 3EZYA 1RYEA 2UDPA 4GAEA 3I9LA 1KEVA 1KBZA 4YQYA 3WGIA 5HM8A 4AJJA 4S3MA 2Y1GA 2DM6A 4GI2A 1HE3A 3JQ7A 5A1TA 4PZEA 1GZ6A 1RKXA 3DZHA 1I3NA 5BQFA 2BHLA 3CE6A 1EE9A 3H9JA 4W6ZA 1CJCA 2B35A 3W4JA 5JDIC 4FFPA 4IS3A 3KLMX 2BKAA 5F1KA 1YWGO 5DZSA 2JAPA 4BO7A 5A4DA 4KQWA 2CF6A 1L7EA 3K31A 4GX5A 7ADHA 3ADPA 3PQDA 2X6TA 4OYRA 4WNCA 1YL7A 4F45A 3OJLA 2FP4A 2PD6A 1R0KA 4J1TA 3TN7A 1LQTA 4WEQA 1ZW1A 3K30A 2EKLA 1ZK4A 3EW7A 4L74A 3Q2IA 1H5QA 3PWKA 4D43A 5CDYA 3FD8A 3JQ6A 3ULKA 4J49A 4UUPA 5JLAA 2GO1A 3WSWA 3ZWOA 4DYVA 5COBA 3AK4A 3F46A 2A4KA 4YAEA 2B5VA 1MB4A 3MWEB 5C7IO 1ISHA 1EK5A 3I83A 2H6EA 2AEJA 3EVNA 4DREA 5MDHA 5FI3A 4Y6SA 3GEMA 1WDMA 4BO8A 1R37A 4MP8A 4LN1A 4OKIA 3PPIA 4BO4A 1Z45A 1HF3A 2UV8A 3VC7A 3GN2A 4DLAA 2AXQA 2YDYA 4GSKA 2WYUA 4FGSA 1JKIA 3CEAA 2EERA 2Q99A 1E3JA 2CF5A 1N9GA 3VHRA 3F1LA 4DLLA 1E6UA 3HDHA 4GWGA 4JLWA 3HB4X 4FB5A 5ITVA 1YOVB 3VPFA 2AA3A 3D5QA 2I65A 3IJRA 3OMLA 3H3JA 5DCYA 4CMAA 4DWVA 2EGGA 2I5PO 1P1KA 3TFOA 3H2ZA 7MDHA 3UAGA 4HFRA 4CM4B 4PZCA 1UXIA 3GGOA 2PNFA 1TVEA 3MJCA 4GH5A 3A9WA 3F9IA 4IDEA 4IM7A 4IZHA 1U8FO 1LA2A 4ALKA 1HL3A 1A4IA 4Y6RA 4HFNA 4IDBA 4AJPA 4F46A 1NYTA 3RUCA 3TL2A 4QX6A 1Q0LA 4DC0A 3SEFA 3H2SA 4XDYA 4D3FA 4PVDA 1EE2A 2PH5A 4TSKA 3QVXA 1T2AA 1N5DA 2A35A 2V65A 2D0IA 3CZMA 4WLUA 1DIGA 5A03A 3PP8A 2C59A 2PH3A 5EIOA 4M1QA 4XD2A 4ZA2A 3AY7A 3C7DB 3FR7A 1CQIA 2DTEA 1PJ2A 3RIHA 3WGQA 1YXMA 3K8ZA 2HMSA 2HRZA 4GX1A 3JYQA 1OC2A 2IEDA 4MVJF 1FDSA 3DO5A 3PXXA 4PGFA 1B3RA 4MP6A 4RQUA 1LU9A 1SB8A 2PGJA 3IAHA 3PRJA 3R3JA 3VH4A 1ONNA 3JQ8B 3WGHA 1I3MA 2CVZA 1SEVA 2YV3A 1YJ8A 3GVPA 2P9EA 3L9WA 3PQFA 2VRCA 4BKOA 3UUWA 1HLDA 1BG6A 3VAZA 1LC3A 1EBUA 3OIGA 2YY7A 1X7DA 4E33A 4CQMB 1GQQA 1HDRA 1ZNQO 3JQDA 4L76A 4NI5A 4DQXA 4AJLA 4U6SA 4J6FA 3BAZA 5JCJA 4F6LA 5JCJD 2I6TA 6LDHA 4CM8A 4CM6A 4CLRA 3I23A 1PR3A 3ZH2A 3JD4A 5EQFA 3GQVA 5U4QA 3RUFA 2X9VA 1C1XB 1ZXLA 4DYDA 3I9OA 5A5EA 1LLUA 1KC1A 1LSJA 1LNQA 4IDCA 4PLGA 4J9UE 2C5AA 3Q11A 1C0LA 2PLAA 2ET6A 5JDCA 5A9SB 3NUGA 5COQA 2QRLA 4EI2A 3PLRA 1DJQA 3JQ8A 5I8WA 2WWRA 4GQAA 3VVBA 5CDUA 3ZHYA 1TT5A 2OOSA 2I9PA 4R5HA 1VL8A 4N5MA 4RLSA 4RZHA 4EJ0A 1A7AA 1CYDA 3G17A 3OM9A 5LC1A 3O4RA 3V5NA 2DUWA 2EEZA 2PK3A 3K6JA 5IZCA 3NDIA 4I5DA 2HJRA 5H82A 5T67A 4CLRB 4CM8B 4LISA 4D44A 3P2YA 1B15A 4UUOA 3ETEA 1NWCA 3IP1A 4HX5A 4B7CA 3MJSA 4RDIA 2GERA 1D1TA 1ZSYA 1QYWA 2BGKA 4INAA 2WDZA 1WWKA 4XRGA 3FTNA 2OMEA 2J3IA 1GPJA 1K89A 1Q0QA 4W4TA 2FN7A 2Q1SA 2DBRA 1MG5A 4N7RA 4FFOA 3D7LA 2CUKA 4E32A 1IPFA 2ZTVA 4M86A 3I9JA 1XKQA 2O3RA 3CMMA 3WBFA 4A5OA 1XU9A 1U4OA 4CQLA 5L7YA 1YB5A 5T8KA 3W8EA 3PJEA 4EBFA 4BNHA 1T1SA 1L1FA 1GZ4A 3HE3A 5KJEA 1TT7A 5GMOA 4CLDA 3E1KA 4PG4A 5ES3A 2A9FA 5IDWA 2NU9A 3ZU3A 3B6ZA 5JDCC 2FR1A 3WDSA 3ZWAA 4O1MA 1DIHA 3H65A 3F6YA 3E9QA 2VOJA 2CVOA 3ENKA 3GVXA 1E7SA 4XIJA 1BXZA 3HN2A 4JJIA 1W6UA 1F8FA 1LX6A 2H63A 4C7KA 1GV0A 4NNJA 1EUCA 3ZU2A 3HN7A 1ZJZA 4JBHA 3ZWCA 4NK4A 4CLHA 1NAHA 5KKCA 4RF4A 4BKQA 2CY0A 4WLFA 3PWZA 1BDMA 2YYYA 4ROSA 1V6AA 2GN6A 1VJTA 4FJ0A 2YZ7A 2UUOA 1Y8RB 3FWNA 4WCDA 2DLDA 1MA0A 1ZSNA 1KEWA 3OQ6A 3DBHB 1WNTA 2VYNA 2NVBA 2HMTA 3SX2A 3WICA 3M2PA 3F47A 4I5GA 3JCZA 2EW2A 2VYVA 2Q2WA 1DFHA 4NJOA 1ZH8A 3GEGA 5KOIA 4ZVVA 2G82A 4NPCA 2VYVD 4OXYA 1D1SA 4BKUA 1YL6A 2ZQZA 3DOCA 3BTVA 1M75A 1B2LA 1YE3A 3E6AA 3GRKA 3VPGA 4E4YA 2DBZA 1E3WB 3TPCA 2F00A 3OIDA 2X9GA 5IZ4A 4TZTA 4EGFA 1P77A 3KSDO 1ADBA 1PL7A 3RJ5A 3ZV5A 4IBOA 4YJGA 1XLTA 4Q3DA 4A0SA 5KVSA 1EK6A 3W6UA 1KY5A 4L73A 4J90A 1PJCA 1HLPA 1ISFA 3H5NA 3OETA 1T2FA 1IY8A 3H5AA 3RU7A 1NR1A 4J7CA 3PEFA 4CL8A 4BO6A 5EN4A 5KVCA 3HHPA 4ND1A 4R1SA 1U4SA 4Q3BA 4TQGA 4AICA 3IOYA 5KJ1A 2QG4A 2NVUB 3ANNA 2G1UA 2VWPA 4RVFA 2P5UA 3GNTA 5JE8A 3KEOA 4CM9A 4WOKA 5TF4A 5C3MA 3OBBA 3T4XA 4GLOA 3JTMA 4E6PA 5CG1A 3ROMA 1JW9B 2YW9A 3ZN2A 3OHSX 4WOJA 3PHIA 5A06A 2YQ4A 3QWAA 1U2DA 2HK9A 5AQ1A 5CEEA 3KEQA 3ENNA 3GG2A 4G81A 4GGPA 4R51A 1UZNA 1TEHA 5COAA 1CEQA 4R3WA 5F21A 1GEEA 4F6CA 5FYDA 4I9NA 4WLVA 5L4SA 4FIZA 1CWUA 1F8GA 1V3VA 3D3EA 1P1HA 4QO8A 3UW3A 4CMEA 1B0AA 4Y9DA 3ANLA 4NBVA 1B3BA 1KIFA 3BTSA 1SOVA 2YV2A 3QRWA 3S2EA 3VZRA 1EVIA 3BTOA 4DRYA 2NVUA 2PD3A 1DRUA 1ENOA 2VT2A 4A10A 2Q1UA 3EDMA 3MTGA 2LDXA 4IUYA 4UEOA 1IPEA 2IODA 2B83A 1DBVO 4IZIA 4UULA 2OORA 2GNAA 5IF3A 1OZAA 1A27A 2CDAA 2FOIA 4M87A 3EK2A 3LVFO 3KYBA 5G4KB 2ZTLA 1MFPA 2O48X 3MJTA 5TT0A 3GH3A 2X0RA 4BNKA 1EBFA 1LSUA 1P33A 3KHUA 1ENZA 4D3DA 5JSFA 3JSAA 1P3DA 1QR6A 2HK8A 3FSRA 4GL4A 1Y5RA 1S6YA 4KUGA 4CLOA 2Y0EA 1Y8QA 2ZK7A 2P4QA 3C7CB 1DRWA 2X86A 3DHYA 4IJWA 3T7EA 3WR5A 3QWIA 1DRVA 5ILGA 3RUIA 5KNLA 2Q49A 1NQOA 2AW5A 1VI2A 3U4DA 4TZKA 5BNIA 3PYLA 3HNPA 1DIRA 1WZEA 3V2UA 4J4HA 3NTOA 4CMIA 1A9ZA 5C5IA 1P31A 3FBGA 1XA0A 1N7HA 5JC1A 4A73A 4E2ZA 3INTA 1QMGA 1K6XA 4U6QA 4YAGA 4D0RA 4RQTA 5EESA 6ADHA 1IB6A 1V35A 4ND2A 4NH4A 1KEPA 1YBVA 4IJVA 4Y8VA 4BMSA 4JJGA 3I5MA 4CLOB 2UUPA 1P1JA 2VTDA 3ICPA 4NK5A 2PV7A 2RIRA 4MVJM 1YDEA 2D1YA 1U28A 4Q3CA 3WNQA 4RJTA 3JD1A 1ULUA 3W1VA 1DC4A 1PGJA 4QEDA 1R4MB 1XYGA 4IGEA 1IYZA 3DTTA 1T4BA 4WNIA 4MVJE 1YQGA 5T64A 1QXSA 2PZKA 3STHA 2O7SA 1F12A 3KXDA 5GY7A 4A7PA 3AM4A 4BUCA 4UUNA 1LDGA 3O8QB 2X0JA 1ZCJA 2I3AA 4GSLA 1Y5MA 1GDHA 5GZ6A 4JNKA 1C0KA 1DAOA
chains in the Genus database with same CATH superfamily
1HYHA 1UQUA 4L3VA 3SXJA 3T9BA 4K6KA 3A14A 5FQNA 3TZBA 3VR4A 2WVAA 3RH0A 3F3SA 5ALNA 1XZMA 3USCS 1MLDA 3GRFA 4DDTA 4ARZA 3L40A 2W6MA 2CL6X 1ZHOA 1AZWA 2QU7A 3FFWA 4D9KA 4E21A 3T5PA 1U63A 2JPDA 3ICQB 1F51E 3NR2A 4L4RA 1WW2A 2Z04A 5B3JC 2YBDA 2Q1TA 3EA4A 1NM5A 2RHGB 3QE4A 4O4IA 4OTZA 1X7WB 3K0HA 2PZJA 3QPDA 1XC7A 4INOA 4AIIA 4CMEC 3IQZA 3U6BA 1XD2B 1N3IA 1P1IA 2O2YA 2O06A 4ZALA 1ZJ4A 5JO9A 1QO7A 4ZRNA 2HLDA 1XKXA 2OG1A 4AQDA 2GS9A 3NHBA 4ILKA 3F73A 1Y9AA 4HTAA 5A05A 2IYEA 2R7LA 3AGPA 4L8GA 4B2IA 1H8HD 1GGHA 1LTKA 1KAOA 1UMBB 3CNHA 3LCUA 1EUDA 1BAPA 3IMKA 1CR0A 2XWBF 2YHAA 3DTVA 3K8QA 3L4BC 1KEUA 3EXIB 1W46A 3HNOA 1YE5A 3I76A 3KQYA 1I36A 4MKFA 4MGIR 1MV5A 1UXJA 4D74A 3DLIA 4LIPD 2V0GA 3HO1A 1KH3A 4QTZA 2YFKA 4RANA 1OCEA 4G0QA 1ODTC 1TNDA 3HJNA 1G41A 3UN1A 3T61A 3ONFA 4LY6A 3AIOA 1CZKA 1PQWA 1DWQA 2DBYA 2G63A 3ORRA 3QXCA 4H17A 4PO1A 2W8BB 2CLDX 1JVNA 3H5WA 2KLBA 3M3PA 4PLCA 5FHRA 4Z5XA 4J4BA 2I6QA 3HI4A 3M9LA 3OEWA 1X7YB 2ZRNA 1C0EA 5TT1A 3F74A 1NXVA 1KDOA 2DWOA 5JNRA 4DB4A 1ZOOA 4QYWA 3VDRA 1A1SA 2ZIEA 5LLSA 4RCZA 5ALZA 3VSEA 2UU9B 1LS1A 4EB6A 1EFKA 1P3Y1 4LSGA 5E4YA 2IE0A 3A9UA 2GBPA 3L6RA 3NPMA 4RPKA 4K40A 2VNAA 3RROA 2C42A 4B6FA 2HUNA 2BTQA 5IAEA 4R84A 5KYNA 2RH8A 1MQ8B 1GNRA 4JI0B 1KVSA 1HURA 2ORWA 1LS6A 3ST7A 4P9NA 1QTNA 3RVLA 4Y2HA 3BWYA 2WMOB 2D1FA 1FSFA 5REQB 5JS8A 3PEVA 4RMGA 3MJFA 1CQWA 3EGIA 1GL6A 2XY4A 3NHKA 2IXTA 3D6UA 1GTL1 2PWZA 2Q4DA 3KX2A 3OE7A 4JT2A 1KSGA 3RARA 1NUHA 5ITZA 2Q6KA 2A0YA 2AFHB 1W48A 1FX0B 3ABRB 3ZU4A 2UVQA 3UBMA 4EJ2A 5IAOA 1N5JA 4ARIA 3RE1A 1HGXA 4N5LA 3K09A 3D1VA 2BEVB 5F23A 3COSA 2Q6OA 3CUUA 4F91B 3GDHA 2KLHA 4ZJPA 2HB6A 1BOOA 2HDOA 4RDCA 5DHQA 4QUBA 2FQYA 1W0KD 3GF4A 3L07A 3CRQA 3TZKA 3BZBA 3ZNQA 6YASA 1KVRA 3D6JA 1EZZA 2BYTA 5KVAA 2ZRAA 5DNWA 4CEHA 1C1HA 1XK7A 2QB5A 2BDUA 3R6LA 2P77A 3HPQA 3VR5D 3KFXA 1XWFA 2NQTA 1TK2A 3WKAA 3IVGA 4LSMA 2A59A 1OLUB 2OP1A 4QYSA 2KYRA 1DTWA 1A8QA 1K0UA 1O89A 1V6CA 1G66A 2FPOA 2Y1DA 2Y68A 3NU1A 3KPUA 4JUCA 1QP8A 3CXUA 1L7NA 3Q10A 2A9PA 2PM8A 3AJ8A 3Q1KA 5JNUA 6REQA 2X5KO 1N78A 4CV1A 2RONA 3QPVA 1ZUWA 3MTDA 2AF4C 2G0TA 4YREA 3AUUA 3OSZA 4X97A 5JMPA 2WABA 1ZM3A 1HT3A 3IPRA 3JAWA 3CSDA 3AZQA 2AB0A 5HJ7A 4JIGA 1ADFA 2X6RA 1P81A 1PT9A 5C32A 2FQWA 2OV8A 4P1ZA 1NNI1 2IHZA 3U1TA 3VH3A 5HIMA 3DDSA 4CKCA 1XL0A 3ZU5A 4FCTA 2JI7A 3G2NA 4IUDS 4MPPA 3OCJA 1SH7A 4RHCA 2NO1A 1U0GA 1P8JA 5FB3A 4WEOA 4MK4A 4DABA 4ZEVA 1JAXA 2QR2A 1D0IA 4R2XA 1E2IA 3IDZA 2ALJA 5E9AA 4HVLA 4LRQA 5DYIA 1W0JA 1XQWA 1L5HB 5JR3A 1GPMA 5B3JA 2OBBA 2VPWA 4GZ5A 4ND6A 1DI0A 5DRYA 3ZHRA 1M2HA 3QF4A 3D7NA 3FG9A 2Z9DA 3GUYA 3U4QB 4M8KA 1N7JA 1P44A 2X22A 3HY3A 2BZGA 3G2PA 5EE1A 4CODB 2BEUB 4IXDA 2IBTA 2H85A 1JDZA 4RGQA 1TZ2A 4Q1VA 2E4UA 1MXFA 1BMQA 1Z6PA 2Q27A 3B2EA 3BA6A 3IYLW 3HUUA 2ZYTX 5FQOA 3USZA 4E5NA 4OMCA 3B5EA 2I78A 3AG6A 1EPUA 4D9JA 2AFVA 3VPCA 3GNSA 5A62A 2WHPA 3GLFA 5JS1A 1TC1A 1KZ6A 3E81A 5GADl 1Q1NA 3D8BA 5FTKA 2REXB 2WLTA 3CRZA 3G7NA 3KU4A 1R5OA 5SYNA 4MIYA 2XE6A 1AKRA 2PKWA 2X0DA 5CAEB 3NX4A 4GOXA 3EVBA 1SM4A 4KBFA 1VKJA 3IUEA 4B3HA 1YBHA 1MNAA 4FDAA 2Z6UA 2P67A 1AS2A 3PFKA 1DCKA 5AUOB 3MTIA 1XR3A 2HQSA 3AILA 4M98A 3TQOA 1G7SA 3WOHA 3TE7A 4BEBA 1L5MA 4DN6A 1JN0A 3KKEA 3KXIA 1EVKA 1TRHA 1JIUA 3DP9A 3GMTA 3MLBA 1OV4A 2I2XB 5ECGC 3L2OB 3DEZA 3GT3A 3JSXA 4JSRA 5AK0A 4C7MA 5C8YB 5L3QB 1U5BB 2QDXA 3DFMA 1Q14A 2PZFA 1SXJB 4Y9TA 1CF2O 2PDAA 4GMGA 4DSOA 3RTAA 3ORSA 3KJZA 4FZRA 1ZOPA 3R5TA 5AHWA 2NSDA 3GMIA 3W4KA 4DOMA 5KINB 4NVRA 1R5NA 1KK3A 1Z28A 3AEYA 3FNFA 3H84A 3ZZMA 4PY2A 3AR8A 4AFNA 2OR3A 4I50F 2EF1A 2FPUA 4FP9A 1KE2A 2Q3CA 3AP3A 5FTMA 2PIAA 421PA 5FUYA 4OHWA 4OK6A 4H18A 1NPTO 8GPBA 3QA9A 4BN0A 3FA2A 2X2OA 3OP4A 3DMYA 3MCWA 4L0CA 3VO2A 1XB2A 1KFKB 2C84A 3O38A 4HOYA 1QE3A 4XQCA 5JBNA 2O50A 2CZGA 1NF2A 5BXQC 3NGLA 4HQKA 1MBZA 1O96A 2DUMA 2ANCA 3KV3O 2BGMA 2JJQA 2OLEA 2PV0A 4IDGA 4R2HA 4R9VA 4B4KA 1GRNA 1RLUA 1IJEA 4EUHA 3H9CA 5DBIA 3GRPA 2ZYWX 4JA2A 3HV0A 4QHTA 4D80A 1RHMA 4CKZA 3IUBA 4HMQA 5ICMA 5ICSA 2YXDA 3ZGXA 2C9MA 1I33A 4JUBA 3R5SA 1W88B 1H3NA 4UDOA 4V39A 2GVZC 3C3XA 3PWTA 4DLSA 4Q7EA 4K2HA 5FRDA 2GK4A 3G0BA 1Z36A 4BAUA 3MD9A 4R0MA 2HEGA 2G4CA 3OQIB 3Q7RA 1M72A 3BIOA 1WB5A 3RTBA 4R16A 1U4NA 2V7PA 5CFOA 3N58A 4IJSA 4I36A 4DXHA 1HFWA 1WA5A 2WF8A 3U3XA 1QBKC 1U5CA 1RI5A 4GMKA 4ZHQF 5HIKA 2D2VA 1DIOB 2B61A 3EXIA 1TYAE 4PX9A 1R8XA 4OJTA 5GONB 2WWHA 4B8WA 4ZIRB 4UJ5A 5HFAA 3UNXA 4B7ZA 1MAHA 1QVRA 1VJCA 3TLGA 5AJVB 3VC2A 3EZGA 5KAMA 4HGNA 2I4MA 5HPYB 3IOEA 2C7RA 3IL2A 4IJQA 4MWEA 3MAJA 1TYZA 4MVJA 3HCPA 1GM5A 1CERA 3NV7A 2G5PA 5L53A 4X92A 4HN9A 3WLOA 5IT0A 2XMBA 1QG2A 1E9AA 1PKEA 2QMOA 4RK6A 5EKXA 2OCBA 2ZW9A 4NECA 3WIBA 1ZJ5A 1KC3A 1P74A 3E9CA 2BUBA 1G2PA 2A9VA 3HEMA 3LUHA 2RGYA 4GOKA 4EX6A 1QHNA 2O5EA 4AK9A 1X1EA 4JQCA 4UZEA 1MG0A 2FW8A 3X2EA 1E3SA 1CQIB 1X80B 3MMZA 4S2EA 4NPHA 5TEWA 4CU5A 1IY1A 3PD1A 1JFFB 1VCIA 3ETHA 1UOQA 4A2PA 5CDHA 4U0KA 2AWOA 4BMVA 1NIJA 2A33A 1OA1A 4YBZA 1DT3A 1GOTA 5EIBC 3LECA 5KWVA 2BBOA 1CDDA 4Z4GA 4GZ3A 4LQ4A 4MWOA 4WSOA 3T4EA 2WYVA 4Z0HO 4O63O 3RANA 2IXEA 2PZLA 2XUPA 1QCZA 3F5SA 1T10A 3O4HA 1R4NA 4KE9A 4KKXB 4YA6A 4ASUA 2AMLA 4PTZA 1PL0A 1JV2B 1NUAA 1VLLA 3O8DA 4F5EA 3Q9SA 1AGYA 4CMJA 1ZXBA 5TPZA 1CRQA 4PZDA 1FX0A 1NY6A 4LDPA 4DLRA 4E3WA 1IPHA 2FZLA 3TOZA 4E5YA 1OZ0A 2FPIA 2IUFA 5LQMA 1DKUA 1C4XA 2DWUA 3LXRA 5LZ7A 3SC4A 1A4UA 4BB0A 1B8UA 4RC9A 3EDRA 3FY4A 1EFHA 4NATA 1WMFA 2IRWA 3ENZA 2GM4A 4UHHA 1F7UA 3SG0A 1CS4C 1EP9A 4OOFA 4J03A 5LYJF 3RK0A 4D2IA 3WP0A 1NTRA 3GRCA 3RSGA 3RS9A 3ZG6A 4ZTUB 3DMRA 1ZMTA 1YVEI 2A9QA 4FFMA 4NTZA 2VTKA 3VUEA 2WWIA 2VQFB 3GPDG 2Q45A 4EZEA 1EMDA 4PHTA 1QE0A 2JFOA 5DTRA 3PC8C 4F5ZA 1T5BA 4CJXA 2ZIUB 2QYTA 2IDMA 3JWEA 1WZNA 2GYVA 3OMXA 1P61B 2VJQA 5E6UB 4BZXA 1EDOA 6REQB 5GJCA 3I5YA 1G8JA 3ASVA 1BOFA 3H4VA 4RD4A 2CWDA 3TZQA 3HSKA 4BNGA 2FQXA 4JBNA 1V4NA 3T3NA 3KJGA 3TTSA 3H1TA 4LTMA 3MYRA 3NHPA 2FLKA 3QBEA 4QGFA 4DAOA 3MQ4A 1ISPA 3TKAA 3VU8A 1QS0B 1M9NA 4A0HA 3ENVA 1JDJA 3N3BC 4LA4A 3CT4A 5ARBA 2ZIZA 4H7EA 3OU6A 3A6KA 5JD4A 2AN1A 1PGQA 4YRTA 5EL0A 2J7PD 4WLEA 3IQGX 4NU5A 1SA0B 2GCOB 3K7EA 2IELA 3L1VA 3JQBC 3SEQA 2GPJA 3ASUA 1MTOA 3PQCA 5AOVA 1MC4A 2ONKA 3H19A 3KWFA 1TTHA 3ZY4A 3CZRA 3GAAA 1R5BA 4XOIA 4ZI2A 4BNYA 4CIXA 1RPNA 4ND3A 4MRMB 1J8VA 5EP4A 5K1ZA 3NDPA 2BM1A 3I72A 4RZ3A 1J8FA 2BHSA 3JVIA 1AY0A 2ZROA 5EMHA 3ZDQA 4H4DA 3ZTWA 2WAXA 5A2QA 4RL4A 1ZICA 3ZCXA 2EGHA 1TKRA 2ZJFA 3DFIA 3QHQA 4XVUA 1A2KC 3RSFA 2ZB7A 3IQEA 4HZUB 3I2JA 1JMYA 2WU1A 3D8RA 4KQKA 2MYUA 2R4QA 3Q8MA 1B0ZA 4HYYA 2WIKA 4XFKA 3RJ9A 1KYVA 1T8PA 3K1YA 3U16A 5E3IA 3T5BA 3AFNA 3D7KA 1TU0A 1S3GA 5FUQA 5IJ9A 3WLEA 2YHIA 4YASA 5CA1A 3CUVA 1XQ1A 4QDZA 5IDYA 4UU1A 1P9RA 1YUNA 4C14A 4GVXA 1XK6A 3TLJA 5E0KB 2BFOA 2WQ6A 2HA2A 1E77A 4C0LA 1ZYUA 4AC9A 1PEDA 2QI9C 1XEWY 2JAHA 3ECCA 4P38A 4ZT7A 5H3CA 3D2CA 4NV3A 4L7QA 3W8NA 4PGMA 2GPNA 2O2SA 2ZYVX 5FV7A 4J2OA 4PZLA 1NNUA 3S2FA 2HSGA 3PU6A 3E3NA 4P34A 2NZ8A 4N49A 4NG4A 5G0SA 3JALA 3FPEA 3TSWA 1HE4A 4YECA 4KQ6A 3ITEA 4GI3A 1T5OA 3HBJA 4HDCA 1I7QB 1XZBA 3H1PA 1XE3A 4AJNA 4AB1A 1X7HA 3KJHA 1FP6A 1H3FA 1JPNA 2D6FA 1HRDA 1IH8A 1DRJA 1VHLA 2A84A 1TU4A 2KQUA 3H99A 2ATEA 1XQYA 3LU1A 4L7VA 4M8IA 3ND6A 1QLWA 5GOZA 4BCBA 1FFGA 1L5WA 5DWQA 3ESQA 3BK1A 3IVCA 3L7DA 2R6DA 3UHJA 3OA0A 3NTQA 3LPMA 1GLNA 2QMHA 4L8WB 4U7GA 5KVQA 1TB4A 1USWA 5DHPA 4JP1A 3WA6A 3GJTA 1OAKA 3JX9A 3BCSA 1RAAA 1B8VA 4DIKA 2OHJA 4RFVA 3UGJA 3FI0A 1VSUA 1Z18A 2FJPA 4GKVA 3IVMA 4X90A 2A5LA 4HXYA 2ACVA 5KWJA 3K1TA 4MKHA 3G8CA 3R3SA 4FZVA 3QPAA 4RO0A 1X7XB 3BD7A 1G3UA 4DYHA 2FCAA 1HTBA 4BQFA 2Q3EA 3M7IA 3ER8A 1RM5A 3OUUA 4BWFB 4GXQA 3BL6A 3PD0A 4OUDB 1OYYA 2BJWA 4F2PA 1PL6A 3BMCA 3BQNB 3OEHD 4RVDA 5T4EA 4CI9A 5FLYA 4BMZA 3L6OO 3FB4A 4JYZA 1WL8A 1K68A 1O0SA 3D6VA 1T9AA 1CY2A 1KFJB 2ORVA 4BFVA 5JEDA 1V45E 2J31A 3A6FA 4MMZB 5JSUA 3OEED 3EIUA 4KPYA 3SP1A 1A8IA 4PPQA 2EF0A 2AR9A 2O19A 4WPGA 1T36A 3C6XA 1V96A 3TSCA 2I7DA 4CMHA 1LZKA 4HMOA 2P9JA 1TUBA 1YUMA 4N3GA 4BASA 2XQJA 4GPZA 1J4AA 2PMKA 1BU8A 1UBRS 1KP3A 3KZKA 4HYQA 1L4YA 2A78A 4R1NA 5CX1B 5JXIA 2VZEA 3OZBA 2ZBVA 5C8YA 3G59A 4J0KA 1L4LA 5TR9A 5IT9A 4NBWA 3K96A 3SQOA 4YK7A 4R3UC 2O7NA 5TLSA 2G6TA 2PYDA 3C3MA 2GJKA 4JJKA 1I3LA 1ITZA 3V33A 2IEAA 4HCJA 1O57A 4CM4A 5B1DA 4M0MA 4HB4A 2XGOA 5B1IA 1ZMXA 3T95A 5KNBA 3HBMA 4TV9F 1Q0HA 1M7HA 5IT4A 1XMIA 3COYA 3JQ7B 3L8CA 1SZJG 4AZWA 4EJSA 3MQ2A 3ZGLA 2D5CA 1A4RA 3H9EO 1EHCA 1SHZA 4YAUA 1JAZA 1VIMA 2JLSA 2ONJA 4JKYA 4I46A 1UBHS 4MV5A 2K4MA 4B9AA 4YIKA 3CTPA 1UM9B 1SD5A 3HMQA 3OE1A 1Z6GA 4QELA 2BGTA 4WMLA 4HJRA 4V0SA 5CVUA 2Q8NA 1ORWA 2G8NA 2NO7A 2IVFA 1VG0B 3QENA 1SXIA 3C6QA 3LY9A 2D1RA 3EYWA 3W6NA 4D92A 3D3KA 1OAOA 4UUMA 4J4TA 3L4JA 1Z0AA 3WXBA 5CT6A 3OCZA 5ARDA 2XGGA 3OZEA 4O4HA 1XDBA 2J3MA 1D2GA 4O1IA 1IN4A 5EHGA 4E5MA 4RK7A 1UZMA 4DQUA 1S2GA 4MI9A 3O91A 3W9YA 2Z83A 2LUOA 4B87A 4DY6A 3U39A 2I67A 2BR5A 2BH9A 3H9GA 4HWTA 3V2HA 4E7OA 1J56A 1IOVA 5D00A 3WGLA 1Z16A 3A6JA 4CETA 2HSEA 3LWNA 1NU6A 2RGGA 1ZD4A 4Q48A 1J2UA 1FLDA 3PHLA 4Q03A 2XVAA 1FXWA 5B57C 4HP8A 3QVOA 5KPDA 1M33A 2BZ1A 5E0OA 3GY0A 4V0ME 5H02A 3FVRA 3VKVA 4YDQA 3E48A 3R23A 3EVTA 5JS6A 4NCBA 1GUDA 1SC6A 5DP1A 1F6BA 4MR7A 4P08A 2L2QA 1XXHE 3KQTA 4UE6A 3SQLA 3ZE7A 5A02A 3AU9A 3KJXA 4LBZA 2I6SA 4RIGA 4MW1A 4TMWA 3A6GA 2EKPA 5DEOA 3U0VA 5K99A 2EW1A 2WAAA 1SQ5A 1M1ZA 1PTJA 1GCGA 3EXG2 4UPEA 1K7FB 4K9OA 5FWYB 1JKMA 1YOBA 1DG9A 3VJMA 1E1NA 1XFDA 3QIAA 4DVJA 3FUTA 4DWOA 2ZUEA 3WFIA 1LQ2A 1N9GB 5E7IA 3OCWA 2A7QA 4UVDA 2IYSA 1AE1A 4XJXA 3ZWWA 1SN7A 5KHLB 3O0TA 4MVYA 1YGYA 4H2DA 3AERB 1ZNXA 3U3ZA 4NNOA 1CK4A 1Y7LA 5KTYA 4YN3A 4JX8A 5F33A 3PC4A 5EJ4A 1Z15A 3Q1LA 4MRPA 4YX9A 1MDBA 4EG6A 5JY1A 2J5KA 2LBPA 3LT2A 2DR3A 2GEDA 3R0IA 4Q7LA 3QVSA 5KYWB 4MV7A 4XUDA 5BSRA 4CIBA 2JI9A 3CRNA 1SUEA 2JATA 2XA9A 4RVOA 4DJAA 4DBVO 4IDAA 2DZDA 2A5FA 2Q9AA 1R00A 2QD3A 3N6VA 1F2VA 1QH8A 2VJMB 4C03A 1JSZA 2QRPA 3QUTA 3AF6A 5TX7A 4MA0A 4PNHA 5AKKA 1DGQA 1WMDA 5DYGA 1XJ0A 2PT5A 4DV3B 1UXHA 4TN1A 1NAIA 4RTOA 1NJGA 5HDQA 3WAKA 3IO3A 2PGLA 4KJXA 1M6WA 3IIMA 3L7JA 4EB3A 4QPZA 2AV6A 4NMMA 2I71A 3GNQA 3A3PA 3ROPA 4ALNA 4ZQEA 3CY6A 1HNXB 1E3WA 2PYIA 3VU0A 1YQQA 4RLFA 1J97A 5ELLA 1PJLA 3K6SB 3C5HA 3RRYA 3ZJUA 2AG0A 3A6HA 4ID9A 2Q5QA 3TW8B 1U81A 3FPSA 4JJEA 2WUWE 3CLHA 1CRWG 3UMVA 4CF4A 1BW9A 4WA8A 1TOAA 2MIIA 2PMWB 3ZQUA 1Z4KA 2RKOA 4FFNA 3UK7A 2WMNB 4N5NA 4WTOA 1DVRA 4I66A 3RNLA 5KCZA 2IP2A 2J1LA 2V7VA 3B1FA 4UTZA 4KXWA 1AOXA 2HKIA 4AQYB 3RSQA 5D5HA 2X1HA 2FPSA 1XD2A 2BF4A 3G1WA 3JTEA 4AKTA 1C7FA 1SUIA 3LZCA 4MDHA 1JIVA 1T5SA 4LXYA 3V1KA 4KVZA 1W59A 4LNUB 1B14A 3L7BA 2ZFUA 1UQTA 1HTTA 5JCPA 4WJZA 3IUSA 1BJTA 1AA6A 1ZM2A 1KSHA 4K26A 4IIUA 3L1UA 1XA3A 4R1PA 3N70A 4LI0A 3AFGA 2NU7B 3FGPA 4GXNA 4TZ0A 1BEUB 1PJRA 2VHWA 4W9NA 2P68A 2YS6A 1GD1O 3WRWA 1MO6A 4HXGA 4U4AA 3QZUA 3JYPA 1E0JA 3IBGA 4V3CA 3DE3X 2C1XA 3E9NA 1N2SA 1KETA 1EP2B 4RLHA 4RMNA 4PNPA 1IQ0A 4JVOA 5F4ZA 3L82B 1TZKA 2PD4A 4M55A 3HZZA 1FS6A 2GFQA 5KDLA 5CBKA 4BV9A 1HR0B 5KMGA 5DV9A 3EMBA 4GLFA 4L78A 3OG9A 5DTJA 2H3HA 2IU0A 4W82A 2H3EA 2N1BA 3F8WA 4XYBA 1NQUA 2JFUA 2QR3A 4JEHA 3F3MA 3GLHB 1MJHA 1WCYA 3EOAI 4UUAA 3U9TA 4AS2A 2UKDA 3ABQB 3R5XA 2A3RA 2B37A 2VJDA 3A1TA 2OQRA 1QIDA 4JLKA 4A0GA 1JQAA 1CUBA 3LC7O 3NHUA 4C7BA 4DIFA 5TIIA 3L8GA 2OMKA 4FEEA 4ACBA 2H1RA 2PU5A 3DYVA 4ENTA 1TLLA 2J6HA 2Z4SA 1EVLA 3OKCA 3NPAA 4JT4A 5FPQA 4NH0A 1ZUNB 3IAS1 4WJKB 5ENZA 1RIFA 1WCV1 3RJZA 1VBKA 3DFFA 3SC6A 2H52A 3U48A 4LKOA 4FCVA 3IAS6 5BT9A 2NO9A 1FXUA 1PS9A 4F12A 2DU8A 4PONA 4J0HA 3M33A 1DBSA 4ZYXA 3K5PA 5LA6A 3QY9A 3C8UA 5ER6A 1TX4B 4BNIA 2FWAA 2A9OA 2HK7A 2J5BA 4OFZA 3SJBA 5B5SA 5JZVA 3TG2A 1CP3A 2HWWA 3GPBA 3QSGA 3HZOA 1G21B 5K3BA 1FYVA 3W5DA 1TW2A 3LDGA 4F8EA 2WM3A 4P7GA 1P60A 1KE1A 5L3RA 4HNRA 2SICE 2XBLA 1UK9A 2BGJA 3P0RA 3QYAA 4KKVA 5EA2A 1QONA 5LZ8A 4C3OB 4F85A 2RGXA 2ZIVB 3QX8A 1G6KA 2G83A 4DMMA 4Q4CA 4LRYA 3W5BA 2AOTA 3LWBA 1IXYA 3G85A 5DXAA 1WUYA 3LNCA 4GMDA 4XA8A 5THKA 2Z4TA 3C6KA 3DUWA 4Z51A 3FIJA 4GNKA 4XIYA 4QE3A 4FD3A 2VDKB 4FMBB 4CCAA 5J4VA 1EBBA 2B8EA 2VZ8A 2IY9A 2JAUA 4OBBA 4XWTA 5C9ZA 1IUNA 4PIVA 4BYGA 4JR2A 5EJAA 4C0SA 4D4LA 5GIPE 2PS0A 1L7XA 4KVGA 4Z4CA 2J3HA 1CJVC 2UAGA 2VH1A 4Q9AA 4D97A 5LQJA 2OA0A 2BMAA 1DLIA 2DUUA 1P4HA 1SIUA 5ENVA 3RKSA 4PPYA 3MERA 1L7MA 3SDZA 2O8CB 1UZLA 4IRXA 4OJQA 1JEAA 1PZFA 4OFWA 4AS3A 3AHEA 4ARSA 2R6CA 4DCNA 5B1YA 4ZD6A 3VV2A 4QM7A 1P0IA 2A94A 2EP8A 4JWKA 2JBAA 4DKJA 3SS9X 1GPKA 2EFGA 4D8TA 5TSDA 3OJOA 4BLSA 1IATA 1USVA 3W2GA 2ZYUX 3Q98A 4QRDA 1XFAA 3UH1A 2YICA 3A4IA 1M6VB 2G5CA 2PS3A 3EXHA 2JCVA 3PD7A 3Q7IA 4HWKA 4K8OA 5CDGA 1VJ5A 4DNOA 4P7JA 1SZPA 1ZOLA 2AQIA 4EDFA 3S2IA 3FZEA 4CF3A 4L22A 1N1DA 4QTYA 3ZD7A 5CMLA 4ZEXA 1LKZA 5AOCA 3GUCA 4EWLA 1D4OA 2H0RA 4FXOA 5JROA 1NMYA 3SE0A 3P94A 3LNTA 1ZW6A 3E5MA 1AHNA 4V3BA 2RGCA 5J40A 4BGEA 3TLBA 2IEBA 2X2EA 4F2DA 2QTFA 1B1CA 2FRDC 4ODIA 3UWKA 1Z22A 2QPAA 2XWSA 1F14A 4POAA 4QNMA 1A2QA 3ZDRA 4X41A 1GUFA 4JB8A 4JR0A 5TE9A 3JQAA 2JJ8A 3E9YA 3A0UA 1Y8QB 3KDAA 3MGCA 4NEQA 3DLCA 1N36B 2A9KA 2ZGVA 2H29A 1PZGA 3LDUA 2WJVA 3TWOA 3JASB 3TSAA 3ZNOA 5FORA 3AF2A 4QBIA 3GT0A 3M4XA 3WNVA 5C8ZA 3L92A 2OCYC 4ND8B 2RAVA 3LX5A 1E1MA 4REMA 5CYOA 1UANA 4CBVA 2L18A 2OC9A 1OF1A 2OO5C 1UC4B 3BHJA 1VE1A 3I2GA 3AM3A 1YB4A 4D5EA 4R9RA 2ZAYA 1QIGA 2ZB4A 2ZJ2A 4YC7A 3D6HA 1RZ3A 2AI1A 4DLXA 2X15A 1U7UA 3ZW9A 1H1TA 4EMSA 1Y1LA 1QDLB 3HWRA 3QEKA 1NUQA 2IXFA 1GNSA 3VMMA 1NLZA 4ZEMA 3ECSA 4XASA 2GK6A 3ZEIA 3TZCA 3PXGA 2VYFA 1O9BA 1UFVA 2XNSA 2XMZA 3RTCA 3II6X 3A1CA 3MGBA 1XALA 1N77A 3ICWA 3R7BA 4KK3A 1U2GC 1P2VA 1ZX1A 3MILA 1NN5A 2PGXA 2B0CA 1BXGA 4DA0A 5T5QA 2XXAA 4Q4HA 1XD8A 1GSAA 4JY7A 1Y9DA 4RV4A 2PFKA 3OT1A 2JIOA 3ZCUA 2I2BA 1A1VA 3KR0A 2JG3A 3AHFA 2VLIA 3VSCA 2QZ4A 1M0TA 2ZWVA 3RVNA 5JH7F 3DAYA 2BE9A 2R44A 1QIEA 2O6LA 2XIQA 4ER7A 2BRUA 4N3AA 2V96A 2HLDD 3HDQA 1P75A 1MGPA 1II0A 4LOAA 2C4UA 2FMFA 2W2MA 2X1LA 4MEAA 4MUNA 3VPXA 3WHKA 1LLDA 1MUUA 2C8JA 5DYTA 5I7RA 2XKKA 2EHDA 3PUVA 1Q7CA 4L4XA 4V0OA 3RABA 4BUJA 2VPQA 2C2WA 4ZGGA 4U7FA 2QRJA 3QX3A 4AI6A 1Y34E 3FKSA 1RD4A 3GEBA 3VZQA 4HL6A 4UM7A 4D3SA 2IDZA 5DCUA 5HA5A 3ESCA 1C3OB 2Y0CA 1NATA 4FK8A 5FOSA 3O9ZA 4RWEA 1NGSA 4MUHA 1E92A 2GEJA 1ZA2A 2MSEB 3DL7A 4DA9A 1AXGA 1GYPA 2QUBA 4DLBA 3A4LA 3BCRA 4ZO4A 5K3OA 2PQMA 2W2KB 2XMSA 2YHSA 3MA0A 3ROFA 3TINA 1NASA 2XNKA 1Q57A 2D13A 4CCYB 5LIPA 3BSSA 3LLSA 3WLRA 3N2GB 4PE5B 4G0UA 1HMYA 1RXYA 1FQOA 2PZGA 4CMBA 1BXGB 4R69A 5HXAA 1ZJJA 1PAUA 1AO0A 1M2VB 1H5NA 1W52X 2O8EB 3JS5A 4TS3A 4G67A 3WZMA 3VKWA 1Z7YA 4FBGA 4QXQA 4YMLA 2JBAB 4CTNA 1GKUB 2NV0A 5BN4A 3HYRA 5HM6A 3BH6A 3AR6A 3JQGB 4GC9A 2GDZA 3E9EA 3L1IA 1Q0UA 2WZQA 4JVSB 5LCXA 4B4UA 1JLLB 1L1QA 1PSZA 1XNJA 2P62A 4FMCB 1T4CB 2EX4A 4MQBA 1IRXA 3BA1A 2C92A 2O8DA 1BYUA 2JGRA 5TQ0B 3THSA 2C5SA 4UU0A 4IQGA 1X8LA 1Y1KE 1ZSVA 3HA2A 2CVFA 3KTOA 4FGUA 3RUHA 2CYCA 1QFZA 2B6HA 3FZGA 3V3KA 5I4CA 1JBEA 1I0ZA 4MZXA 3NXSA 2X9LA 5FWAA 3JYNA 4CMKA 1UBKS 1PFQA 4JBIA 4AZ0A 1JHZA 2CDBA 3ETNA 3IQDB 1VHTA 3U17A 5AW7A 1QG4A 1YA8A 2ZTSA 4M53A 3KYDB 4N0PA 4EI7A 3KKNA 2GDJA 4TKUB 4X00A 1H9BA 4OA5A 2NZYA 1FJHA 2Y2VA 2QRGA 4C20A 4MR8B 3LW7A 3VRHA 1BVYF 5K0JA 2GN0A 2ARKA 4IV5A 1ZVMA 2Q7XA 2QN3A 5JOQA 1RWVA 2I7XA 2HU7A 5E2AA 3ROZA 2BUAA 4KL8S 4M0KA 2Q5JA 3NKLA 3PDHA 5IVIA 3AOEA 1FTYA 1D6SA 2AN3A 2Z30A 3NW9A 3P4UA 4RHYA 5DHTA 5AKJA 3PDUA 1O95C 3VVCA 5ISMA 4KFSA 3N59A 1N75A 1O6GA 2P27A 2Z98A 4X6XA 3OUZA 3NJ8A 1J09A 1K4MA 2CXUA 1Z8FA 5G0TA 1IUOA 1EWRA 1VFPA 1MO3A 5C81A 2O8FB 5J2UB 4HNTA 1LVHA 2GJ8A 1H8HA 1U8UA 1Z29A 2HLHA 2QMZA 2TECE 4RSRA 3S2GA 2GRAA 1J33A 1WDWB 1SVNA 2C57A 1E1LA 4QSHA 3VNRA 1AHHA 3FVQA 5LOVB 2AHRA 2QIOA 2QTGA 4GRIA 1YJBA 2PTGA 1L7QA 5LUBA 1PNRA 3IELA 1QX4A 4M0UA 1M2KA 3PXDA 4RDHA 1OW3B 4TLBA 1TZMA 2ZVDA 3GFTA 3TFWA 2FFRA 1XN1A 5GVRA 1Q1BA 2HN9A 3CF6R 4TWIA 1VYHA 1ZBQA 3E5HA 4Q21A 2JD0A 1LJ8A 5ECDA 4N4AA 1CQZA 1UFRA 3SIRA 3UFXA 2OFPA 3PDJA 3V4ZA 4L28A 3SF8A 3I0ZA 3VR2D 1MXHA 1RHJA 3A3YA 2GPTA 1Z25A 3MELA 4WK0B 4BNVA 3U5ZB 3L84A 3X2FA 4E1VA 3WTCA 2JLRA 3JR7A 5EZ5A 3VVMA 2VCEA 3LO5A 1IBRA 3SJ7A 4BCDA 2QTCA 1BDIA 5F3WB 3IXMA 5B53A 3ERCA 1W96A 1JQKA 3VBCA 4BO5A 1GPH1 2LCQA 2VSFA 2AKAB 2NO4A 2K5UA 1KGSA 4FFSA 3OQPA 4GECA 2VIIA 3IOMA 1PGNA 4LUCA 2YMMA 3QFHA 4YRMA 4N3CA 1G7TA 5DOZA 1DFGA 2GLUA 4LJ9A 5EJ2A 3OX1A 1T1GA 3E8SA 3NATA 3OQVA 5DLDA 1HBJA 3TBFA 2AMFA 4J94A 4JOBA 3EWSA 3OECA 3SF0A 3AZPA 1W85B 3WQQA 3LPDA 3I6IA 5J58A 2OV4A 4HBGA 2BFDA 4Y2UA 4XGKA 1RKQA 4V0RA 3COZA 4F9FA 3NAZA 1DWUA 3OX3A 1M0SA 3UOWA 2G9VA 3VKHA 3ZDCA 2J3QA 1OZGA 1V26A 4HGZA 5JZBA 1LDNA 1U0TA 5KJCA 1OI7A 1QQ5A 2B3TA 4WOCA 4DA4A 1QB8A 3BQ9A 4RE6A 3TRIA 1PSWA 3MBIA 2O8BB 2FV8A 1OR8A 1NZDA 1W4LA 1QZTA 1MB2A 4WINA 3M1LA 3DGEC 4X54A 1ONPA 1GGKA 3MUEA 1YQWA 5FL7D 1BC5A 2J09A 4ZVLA 4GOMD 2VYND 5CJ2A 5I01A 1NVAA 5I7VA 5EWLB 3QOWA 1IULA 2OBNA 3WRYC 1IBKB 2R8PA 2H1IA 4IEEA 2P9QA 3BIWA 4KXVA 4R7GA 1C9MA 2F1HA 1D6JA 2HL6A 3GRAA 3K4HA 4PG8A 2J0SA 2HBZA 2CHVA 2P1ZA 3T1VA 1QQAA 1EESA 1HOXA 1S2NA 2VP4A 4JSYA 4UMFA 3WNBA 3ZE2B 1P7PA 1SXJE 2GESA 4W1RA 2FWRA 5AW5A 1RPZA 1QIFA 4P3XA 3IS3A 2VOEA 3S2YA 1V4VA 2ZRCA 4OLJA 4I4TA 1UINA 5K3CA 2IA5A 1IBSA 2AC4A 2I62A 1XCBA 1AUVA 1T1RA 2QNRA 3C24A 2O2HA 2OY0A 3QUQA 4KQXA 4XM1A 5EWMB 4GKAA 2ZAMA 3RT1A 1Y7IA 1FZQA 3ZY6A 1C0IA 3OOSA 2VHZA 1UXKA 3KYDA 3KBOA 4G63A 4LYYA 2V7QD 3DDNA 2AF3C 1C9JA 2JIZD 4OXXA 1Q7GA 3NTVA 4TVOA 1JDUA 1OX4A 1QHHA 4K1XA 4M99A 1FW8A 2FX2A 2QPLA 3QEJA 4B33A 4LBWA 5G3ZA 1VCHA 4PZZA 5JLJA 3A3OA 1NONA 3ZY2A 1M66A 4OMUA 2QW1A 3ZDBA 2QMYA 4RGYA 1E9RA 1P2SA 4EGAA 4MKIA 5IN5A 4PLTA 1KVUA 1CQJA 1NUPA 3O3CA 4KWTA 1IL0A 4QGHA 4WKBA 5ESWA 2W58A 2R86A 3P0IA 3D4NA 1I3CA 1BKDR 1PD1A 3AC0A 2NPIA 2B25A 2ACKA 3MZ0A 1SCJA 3GBVA 2A0UA 5D8DA 3OBIA 1ZGHA 4NXMB 1ORRA 2KBFA 1BSVA 2XD4A 3MAGA 3MW8A 1AD2A 4GGMX 2BFAA 4H77A 4XSGA 5AK5A 3ZLVA 5ALFA 3UT0A 3EIEA 2FF7A 4RJLA 4F3CA 4CIAA 2E85A 1LW6E 2H48A 1PYDA 1K7YA 3ENQA 1CULC 2E82A 3LMKA 4L6IA 1KJ9A 4RAQA 3HLYA 3U4CA 2HU8A 2GCGA 2VK4A 4BQIA 1VP3A 3P8ZA 5KTMA 1TXGA 5JSHA 1GFZA 5CCDA 3BILA 1GKKA 3NM4A 4P80A 2NU8B 3ROEA 5LD2C 2CLIB 4M46A 4UASA 3ZHOA 3O4VA 4JUFA 2Z2XA 3KSRA 3O21A 3I2KA 4O33A 3W7VA 2DFLA 2I9KA 4Y6PA 4B09A 1OA0A 1LV8A 1OXBB 4URWR 4KQCA 1RPAA 4AZVA 1YDHA 1XZNA 2CUNA 2PJDA 1E9VA 3L7LA 3OCVA 4CU2A 4YV0A 2FX5A 2R6GA 4AJHA 4UXHA 4L75A 1HZZA 2QVLA 1HE1C 4WZAA 1Q6YA 3KAQA 2MINA 3NBMA 5C4MA 2FSFA 3U5TA 3A25A 4Y1EA 3EZ6A 3KKZA 2AJLI 4Z1MD 4X5OA 4Z3DA 3TZEA 5E3HA 2JFNA 3LDHA 1JDPA 3SYTA 4HUQB 3V8PA 1GU0A 2C2MA 4MUIA 5FFNA 4COKA 8AT1A 2VS1A 2F59A 1BQ3A 1IC6A 5I47A 2AYXA 3FTDA 5LMZA 2XB2A 3U81A 2BFBB 3H8SA 4RBNA 5J9FA 1D3AA 2ZJ7A 3CNLA 3KAPA 5D5PA 4BLRA 1F3LA 3TSZA 2AEMA 5CH8A 1OGJA 2P41A 3UXEA 1Q21A 1ZN9A 4XSVA 3KLPX 4HPWA 5LKAA 4TLAA 2RGUA 3FMIA 2X2PA 1A2BA 5AI5A 3PE3A 5ICCA 1H4QA 4LVCA 1RCFA 2EATA 2PZEA 3EZXA 4JLOA 2XAAA 3DMNA 1A9OA 2GB4A 1ESZA 1TIPA 1V1RA 2X4GA 3BMNA 3BS4A 1AMOA 5DHRA 4YWJA 4BLTA 4QNRA 2CLEB 4GGOA 1QWSA 2AFHE 4N82A 1ZCZA 2ANBA 3QLUC 4LE0A 4G5HA 2AFIA 2O0MA 2QV0A 3CJTA 5THQA 3QXSA 2JH3A 4LVOA 1XAHA 4Q7QA 4E09A 2JLZA 3G0CA 1C9NA 4Y0VA 1WZ2A 4UCFA 5H5JA 4AF8A 3ZVNA 3HI6A 2R62A 3WWOA 3ZKWB 5BSKA 3GXOA 4HN4B 1Y6FA 2GRJA 1RP7A 3HCWA 4B3RB 1W7AA 5GZ1A 3ZWXA 2H7YA 4FMDB 2C9DA 2HMVA 2CLFB 3FMPB 3GWZA 4H7FA 4DC9A 2BFNA 2R60A 2YZMA 2MT9A 4KAXA 1ECLA