1NVUQ

Structural evidence for feedback activation by rasgtp of the ras-specific nucleotide exchange factor sos
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTGGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transforming protein p21/H-RAS-1
publication title Structural evidence for feedback activation by RasGTP of the Ras-specific nucleotide exchange factor SOS
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 60
structure length 166
sequence length 166
chains with identical sequence R
ec nomenclature
pdb deposition date 2003-02-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
Q PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1nvuQ00
1KI8A 1G64A 3LH5A 2GVDC 3DKVA 1M7GA 2J41A 1EWQA 3GJXC 4PHGA 3NHAA 2NO7A 2Z4SA 5JLJA 5GJCA 4PO1A 2ONJA 2N46A 3AVUA 4O0MA 2VLIA 2F3TA 2W2TA 1E0KA 3EG5A 2WSMA 4E09A 5AUPB 5TARA 2GZDA 5IK2A 4PX9A 4EJSB 3NDBB 2EFCB 2QAGB 4GL2A 3GFPA 2DFTA 3QNUA 1F48A 2EFGA 521PA 4F91B 4TWZA 2NO0A 3AVTA 1IY0A 1W46A 1WRBA 1WXQA 2G83A 5JCPA 2QMOA 1NVVR 3WP0A 2F6RA 3M6AA 1DBSA 3QOFA 4DCNA 2VSFA 2C2HA 4Q4JB 3GJ3A 1V43A 2OUKA 1U98A 2AKYA 1SVWA 4PAQA 3AVXA 4HLUA 2WWXA 2X2EA 2G1JA 3PEWA 1SKYE 1SKYB 3THOA 4TLEA 4LBWA 4B3XA 3LNCA 2YZ2A 2GETA 4TN1A 4UXIA 4I4LA 2AD5A 4RD2A 1NBMA 4DWJA 5KDOA 1MRNA 1KAGA 5FPTA 4YLGA 3NC0C 4ZIRA 3S1AA 4IOMA 4C30A 1OV4A 5BW8A 1WQ1R 4QGGA 1IY1A 1IN7A 4NPHA 4GMXA 4F38A 1N0VC 4PANA 4JL8A 2BBOA 3B2EA 1B0UA 2G88A 4WOPA 3FGNA 1D2MA 4FWIB 3U2QA 4NU0A 3PUYA 4MKFA 1SVKA 3GLHE 1NIPA 1B23P 4QGAA 4B3BA 1ZUIA 3PUXA 3IO5A 2EW1A 4R71A 4B6FA 1Q21A 3X1XA 2ZRGA 2IWHA 3U44A 2ZS9A 2BM1A 2NO6A 3KTAA 4ZI3A 4PC2A 2EU8A 3ZH9B 2A7QA 2I4IA 2VHCA 2HV8A 2A5FA 4ZI2A 4C0KA 4JLOA 1D2EA 3P27A 1Z08A 2QT1A 2WZQA 3CH4B 2G9NA 2ZI5A 4IXMA 3OFNA 2ZS8A 3CR7A 3AF1A 3NTUA 5KNCA 4FMCF 5FUVA 1Y3AA 5TV2A 1CEEA 3SJBA 4GMDA 1QRAA 1R5OA 2RH5A 3C7KA 1HH4A 3N2EA 1ZAKA 4TL9A 4RD4A 2NG1A 3FMIA 3WNBA 4D4MA 1JJVA 2SHKA 3L8ZA 4LJYA 3PEUA 4D81A 4RD0A 4CT5A 2GEDA 1N5JA 3W90A 2JEOA 3LWNA 4V0LA 5DNYB 1S9HA 3ZZ0A 5JEDA 1AN0A 2FE4A 4M1SA 2P67A 1NY6A 2ZXUA 1VHTA 1ZD1A 4C0AC 1SGWA 1CP2A 4LSGA 2X8AA 3K0FB 4EPTA 4V02A 2EFDB 4TYNA 1JQJC 4MA4A 3ND8A 2RAPA 3OIYA 3LLUA 3DMDA 1TQ2A 1ELOA 1KKMA 3WRYC 1NN3A 2FSFA 3SR0A 2ZREA 3FKQA 3Q85A 4IDHA 2VYFA 4MYHA 3QXXA 4RFSA 5FFMA 4K46A 2BKEA 4AURA 5KOYA 1HT2E 1NMZA 3DOFA 3C4JA 2ZSFA 1R2QA 1IXRC 3IKJA 1PLKA 4RZXA 2Y8EA 3SHWA 1P3JA 5AK0A 4XD7A 4CRWB 4PZLA 5L3QA 1JQLB 1BMFA 1E4VA 4G5RA 5JECA 4G5OA 1GRRA 4LJ7A 3DMNA 2JIZD 2VPPA 1QHHB 3H1TA 4TQAA 3QKSA 4QBHA 4PQYA 4B33A 2PJRA 3THWB 4GFDA 3M1IA 3AUYA 2C8VA 2QG6A 5SZIA 5DI3A 4YMUA 1NLZA 3TGPA 2ATXA 2Q6TA 2EFEB 2OXCA 5KNDA 1PV4A 4M1YA 2FH5B 2ZE8A 3VKWA 3G82C 3UMSA 1XNJA 2RGCA 4ARZB 3AKCA 1RPZA 4PFSA 2J7PA 5C2JB 3B1WA 1II0A 4W5HA 4AYTA 4RD1A 2QM7A 4OHZA 5CLQA 1WDTA 2QP9X 1NN1A 2IYUA 3IHWA 4ZKDA 1ZCBA 1DAEA 3RRNA 1SXJA 4A15A 2QSZA 5F9FA 3TUJC 3GFOA 4DLYA 5BN4A 2IEYA 4GT1A 4LHWA 4PTLA 4CVNA 3H0KA 3A4LA 4H1VA 3SBDA 5FTKA 2IEZA 2ZRFA 3TSOA 1GNPA 2VF7A 5FUWA 4PHHA 1XCPA 4XTRA 1FP7A 2O0HA 4AKIA 1AGRA 4DHEA 2ZJBA 1QF9A 3KX2A 1E2DA 4MITA 4TMKA 4U02A 4HAZA 3HU3A 1AJEA 3RS5A 3AVYA 3K0CA 1X8LA 3ZVRA 2BBSA 2C77A 4ACBA 2ECKA 1OH6A 2O8DB 1KSJA 3BOSA 2OFXA 1KTVA 1EFRA 2PMKA 3EZ2A 2AFHE 2W00A 2QMUA 3CPEA 1XCGB 1ZU5A 5AJXA 4TYQA 4G01B 4NYMQ 1ZM2A 2I1QA 5DISB 3P32A 3CKLA 1YR9A 4DUGD 2W6JD 4D80A 2AXPA 2OCBA 1MT0A 2QTVB 1QHHA 1VCMA 3BB1A 2JGNA 2W2XA 3RS4A 3AVWA 1RW4A 3L8YA 4E03A 5FBWB 3MWLA 1HE1C 2WMNB 3EXAA 4A2WA 1OSNA 1KDOA 3NKVA 4B3DA 1UADA 3B13B 5FR2A 2CK3D 1FTNA 1J7KA 2VO1A 5DN6D 4FMBB 4G5GA 621PA 2FEOA 2R44A 3U44B 3CNNA 2GNOA 4BFSA 1OB2A 1KSGA 3NDPA 1K8RA 1KJWA 1KO1A 3OZXA 2H57A 4YDSA 1I4TD 4NTZA 1CJVC 4NE2A 2H92A 5AJWA 2JJ2A 3WHLA 4IDQA 5FBQB 1G9XA 5AUQA 3TLXA 1AA9A 3LBNA 4QNMA 2JCSA 4ARZA 1WP9A 1PUJA 2BEKA 1C4OA 5CB6A 1XMSA 2DY1A 4JL5A 4Y0VA 2R6AA 1LVGA 4H9GA 1UM8A 3IO3A 1BOFA 1VG1A 4Q9HA 3VR3A 1G8PA 4O3MA 1W47A 1H8ED 2WBLC 3MSXA 4M1OA 2J45A 5KSYA 3BWDD 4G0NA 1E3MA 5CJPA 3RS2A 1TX4B 4LHXA 2ZRCA 2IWRA 1YZKA 3JZMA 3JZAA 4KVGA 1ZC4A 2ZRAA 2BV3A 3AGQA 2R8RA 1P2UA 2E9SA 3AP2A 3LXXA 4U00A 2GXSA 1MRSA 4Q4JA 2GILA 1XEFA 2ZITA 4Q9IA 3RHFA 2WKQA 5JFGA 4ON9A 4C0JA 1CR2A 3WP1B 2IS1A 3Q72A 1S0UA 5KYKA 4URWR 2ZRHA 4EIWA 2CL6X 1GWNA 2XX3A 1ZUNB 5KSZA 2O8FB 1GTVA 2XGJA 2Z0MA 2XNDA 4JVMA 1E9BA 2ZJAA 3D3QA 4GSYA 3K09C 4YMWA 2L0XA 2BC9A 4HZIA 1N0UA 2ZAMA 1UDXA 3P4XA 2GAAA 1HURA 2O8CB 1E2HA 3BB3A 3K0EA 1KMQA 1UBCA 1E2KA 2KWIA 1UFQA 1VIAA 2GZAA 3TSWA 4ESHA 2BHRA 2ZSDA 5TXGA 5H70A 4POAA 4PAMA 3RSOA 4URVR 4HI0E 1RRCA 3B5JA 3F3YA 2MSCB 3AF2A 3IBGA 2F9MA 1CULC 4KYUA 4LJ4A 1DAHA 3I3SR 3I5XA 3R7WA 2FA9A 4D2IA 4CEHA 4DLWA 3RVBA 3FMOB 1NY5A 3JVUA 1EFCA 2UKDA 3B9QA 1ESMA 1U0HC 4S35A 2QROA 5FTLA 3T5DA 1GOTA 2GEUA 3SOPA 3KB1A 2R6FA 4KV9A 3ZVNA 3KXKA 3VHXA 2BEJA 2ZI3A 3F5FA 2V6JA 3OF5A 2WHXA 3EA5A 5TVKA 1GVNB 2B21A 2W83A 2IYRA 2D74A 4TMWA 5FBVB 3NEYA 3TRFA 3THWA 1KYIA 3U4QB 4LX0A 3H86A 3I1FA 1P73A 4O2LA 4PPNA 1E2MA 3U3RA 3BFXA 4BRWA 1KI2A 3LLMA 3Q5DA 4KBFA 4Q7MB 1RJ9B 4AKGA 3THXA 3H4MA 1ZNYA 2R65A 1P6XA 1T5LA 1W4BA 2RMKA 3IPXA 4J0QA 1WA5A 4B48A 4DT1B 1W0JD 2LCFA 3CH5A 1I4LD 3EPJA 4TLDA 5FI1B 1ZM3A 2W6ID 5TB5A 3W34A 1VYVA 4CDGA 2HCJB 1KMHA 1NSFA 2Q9AA 5FOTA 2NQ2C 3GEHA 3ZQ6A 3C14C 4M53A 4TMTA 1G8YA 3CLVA 1O3YA 3OIVA 4F92B 4US1R 4EPWA 4HEJA 2F1JA 2GCOA 4BLSA 3QF7A 1YE8A 4MKHA 3IEVA 2HDNB 4US0R 1NF3A 3GEEA 1BIFA 5HPYB 2OM2A 3GEIA 4JT4A 5KPDA 2QBYA 1Z47A 1E2GA 4JVSB 3ADDA 3AKEA 4XIGS 2DYKA 2YWHA 4Q03A 1W36B 3AKYA 3AH8A 3EPKA 1KI6A 1KZGB 1Q57A 3WNCA 3KUDA 3WBKA 2ZETA 5EP1A 2GXAA 5BQ5A 4JL6A 5EXSA 1GITA 2OXRA 2AWNA 4NL4H 3WRXC 1H8HD 1G7TA 3PG5A 1R0WA 2WJJA 5FR1A 1XJQA 3CPHA 3Q5EA 5JEEA 3CPJB 4Q5IA 1KI7A 3HYRA 2JDIA 1HY3A 1XEXA 2WPDA 4DSTA 5GJVC 1N6HA 1C9KA 2P6NA 4M0LA 2WJIA 1S3GA 3EIQA 3RS0A 3EA0A 1JAIA 1X1RA 3DO6A 2VHTA 3Q7QA 3E70C 1IM2A 3DL0A 1S1CA 2REOA 2ZR9A 3W9YA 4PQRA 2IYWA 1QHNA 4M1TA 1HV8A 4D0GA 5LDDC 5B30A 4L5BA 2OAQ1 4L4UA 5EE3A 4WXRA 3PXGA 1JJ7A 2FOLA 2A30A 5KO2A 4RY2A 5G40A 121PA 1UF9A 2WOJA 2GTPA 2O5VA 3RWMB 4LYFA 3VHLB 2QQ0A 4XJXA 1HQCA 2QRNA 1XX6A 2PJZA 1KGDA 2EFHB 4FINA 4C0LA 3B85A 2IYVA 2A9KA 1GRQA 2FF7A 4D6PA 3WMGA 4MKGA 4FIDA 1G3IA 3TW4A 4D25A 5IRCD 2BMEA 4D82A 1CBUA 1TPZA 2ZS7A 1W0KD 2ZRLA 1OXXK 5EZ5A 2PBRA 4RFVA 1KI6B 1Z6GA 421PA 4JLVA 4G3XA 3L2OB 1UJ2A 3LY5A 1DG1G 1ZIOA 2QAGC 4QC2A 4RKEA 4KFTA 2CCJA 2FJUA 2GJKA 1VYUA 2ANCA 3KKPA 1CRPA 3QEJA 1TNDA 4KFRA 1NSTA 5HCNA 2QPTA 3HP1A 2YOGA 1ZNXA 2XOKD 2CNWA 5DHFA 1KDPA 4QJ5A 3T61A 3CX7A 4OQLA 4EFMA 5FH9A 5F3WB 4BQSA 1OKKD 5SZKB 1N25A 4C2TA 3FKSD 1G20E 2VIIA 1JR3D 3LQRA 4QHSA 1SHZA 3AP3A 4Q4AA 2JATA 2ZUBA 1E9RA 3GJ8A 4DLSA 4FWTA 2RGNA 2QEQA 3HYTA 2V1UA 1OFTA 1U8YA 1DVRA 3KFVA 5JHHB 1OYYA 1SXJB 2K5UA 3MWYW 3BFVA 2AL7A 3UG6A 5JRJA 3UPUA 3CX6A 4NDZA 3W6PA 3B78A 4JZKA 1GP2A 2BIFA 3A1WA 2P2LA 2MMGA 3VAAA 3RRYA 2JLRA 1E94E 1E99A 2QT0A 4DB4A 2ZRKA 2O0JA 1L8QA 2RGBA 4LUCA 1TF7A 4KU4A 4PR0A 3RSLA 2ZM5A 3TVTA 1W4RA 3QXSA 4IVQA 3CF0A 1E9SA 2VA8A 1IHUA 3HPRA 2DFKB 2CDNA 3TH5A 2VF8A 2ZJ5A 3TUIC 3FOZA 4EFNA 3T1TA 1HE8B 3ZD6A 1S9DA 2OCYC 4RZ3A 5JMTA 4RJLA 2NO9A 4CEIA 1JPJA 2GK6A 3L0PA 1F5NA 1K6MA 1KO7A 1SXJD 4JLBA 4P4UA 4BEJA 3BH0A 1COWA 2GBLA 1H8HA 1Z83A 3QKSB 5L3SA 1IN8A 3SBEA 3B1YA 4TZ6A 4FCVA 1XXHA 1XJCA 4MGKR 2ZRIA 3TQCA 1BYUA 4HZUA 4D26A 1T4GA 2ZRPA 1A2BA 1RFLA 2ZYVX 3R7WB 4EDHA 1QHSA 1Z29A 3A1TA 5B2ZA 1YHNA 2C78A 3HJNA 3V00A 3BGWA 1XJ0A 5CM9C 2PLRA 2QZ4A 2ZSBA 4N0EA 4DLVA 2PMDA 5KPJA 1ZRHA 4DDUA 4PQFA 2VQSA 5JS7A 2ZRMA 3QJYA 2YINC 4BWYA 4DLUA 4Q66C 3MFYA 1OHHD 1NKTA 4XVRA 1ZJ6A 4IW3B 1E9CA 2A78A 3CX8A 1FNMA 1QHXA 3CNOA 4Q1CA 1GKUB 4ERNA 1XRJA 2WMOB 1US8B 2VTKA 2BKUA 4L8GA 1BMFD 1ZCAA 2IYLD 2VP9A 1DO0A 2XNDD 3GLIB 4YC7A 2QMEA 2QORA 1FTSA 3FWYA 2WICA 1EFTA 3BE4A 2YOHA 4GRAA 1RRPA 3ADKA 3ZIAA 3EZ6A 2WWFA 2BWJA 3ICEA 4Q9JA 1G3UA 3Q7PA 4F93B 1VYTA 1HYQA 4UJ3A 5D3QA 1D5CA 5JWOA 1MO5A 2IS4A 4M9ZA 1JI0A 2XXAA 2WOOA 1U90A 4MQBA 4B75A 1IBRA 4DVGA 1TQ4A 3SHFA 4ZCMA 3I5YA 3B7GA 3QXJA 3HU2A 2KE5A 4GOJA 1CF4A 4V0ME 4TL8A 4UXHA 1AZSC 4LBVA 3QPWA 4DJTA 2IF2A 1IN5A 1Q1BA 2YV5A 1FQKA 4A1FA 1L7VC 2UVQA 1IXZA 1S3SA 4NCNA 1R8SA 4NH0A 1HQYE 1Z6XA 1EX7A 1SHKA 1N2CE 3LX5A 2A2ZA 2OG2A 1SULA 1OFUX 3KJGA 4I99A 1JXOA 2YC2C 1P61B 5E4FA 1R8QA 1NLFA 5CYOA 4LV6A 1EXMA 3TIFA 5GJWC 4GNKA 3DEFA 1G6OA 1G7CA 3UMRA 2Z5FA 4OHWA 1CR0A 4JIMA 4Q1BA 1AS2A 2ZAOA 2GWHA 5FI0B 3PV0A 2GEVA 1DG3A 3IIKA 5CIWA 4JLAA 3O8RA 5K8UA 1R5BA 2QY9A 4RSGA 2V1XA 2ZROA 4Z8XA 2IYZA 4HAVA 1VG9B 1VHLA 3FDIA 3PENA 1G5PA 1NI3A 3C8UA 1OH7A 1W0JA 1QZXA 1XEXB 4HB0A 2J0QA 3MJRA 3NHBA 3B82A 5AJYA 3KL4A 3SE0A 2ODEA 2VBCA 2IYXA 4R2HA 2J7KA 2ZJ2A 1S96A 5LB4A 4BRUA 1YZLA 1ZM7A 4LYAA 5IF9A 4OI2A 1J8YF 4QJ4A 3L0IB 5G3YA 2NZ8A 2EYUA 3NBYC 2C95A 3UIEA 4GI7A 4C0HA 3FHOA 4M9SA 4MRVA 4F7WA 5KSOA 1E9EA 4A0HA 3IPYA 3Q3JB 1NBME 1VCNA 1R4AA 2D4HA 4H1UA 5KSPA 1UKVY 4EJSA 1DAGA 4UNQA 3CRVA 1JR6A 1NBMD 4EPRA 4K81B 3VNUA 3IQWA 2QAJA 4F4IA 1RYHA 3LAWA 3RRMA 3QVVA 1XPRA 2FPKA 3ASZA 4FMDF 4KFUA 3ADCA 1YR8A 1ZM9A 5TMPA 3RWOA 2GF0A 4TMZA 2EYQA 2WJVA 5KUTA 2IUSA 4E22A 1TEXA 2FFQA 4AIIA 3L43A 5FUXA 5KTYA 1P5ZB 3U6KA 2ZVPX 5FPKA 1ZNWA 4YXWA 4URXR 3LO5A 3QXHA 1NJFA 4QHTA 3RLFA 1OIWA 1G8FA 1N5LA 4DZZA 5B57C 2ORWA 1HTWA 4GOKA 5DGXA 2FG5A 4TZ0A 4JYBA 3FB4A 4MRPA 4Q4HA 2CBZA 3AVOA 4R9UC 1SZPA 1XMJA 4Q9LA 3MWJA 1RRFA 2BJVA 4IFEA 4DSUA 1EFHA 1NLYA 1Z07A 2BBWA 4Q19A 3HR8A 3ZYCA 1EWRA 2ZE7A 1E98A 2J9RA 4BLRA 2YOFA 3FE2A 4W9MC 5DIFA 1CU1A 4LC0A 4BECA 1QHIA 5DH9A 1VECA 1GIAA 1TF5A 4UXJA 4BFWA 1D6JA 3TUZC 5JRZA 2ODBA 5TDHA 2IXEA 1Z0KA 2CLCX 2ZU6A 3AVPA 1XTKA 3ZIAD 3PUWA 2GXUA 2J5XA 2G0NA 2R62A 4Q7LA 1QBKC 3WYGA 5GJBA 5JWRA 3BERA 4HYYA 3IGFA 4BLPA 3THYA 1QG2A 2XB2A 3EWAA 2OBNA 2UZIR 5JWHA 3CIOA 2Q3HA 2KBEA 3AEZA 1E1QA 1XFAA 3SC3A 3T1QA 2ERYA 2H7VA 3O8BA 4C9BA 1Z6TA 4NP6A 4X8OA 1GNRA 2OESA 3T06B 1IJEA 3FYHA 4G1UC 2P6UA 1WB9A 1NMYA 1UDWA 4OHXA 2V3CC 3J81k 1AZTA 1S2MA 4MGYR 3TK1A 1NN5A 4WW0A 1BYIA 1K5DA 3FFBA 3P20A 4NKRA 5CK4A 3PFIA 4ZDWA 3D8BA 4LJ8A 3GLFE 1LNZA 4US2R 1E9DA 2QGNA 3L0OA 3CO5A 4JBXA 4KBGA 2QP4A 1E6CA 4ITRC 3SFVA 3LV8A 1FPMA 3OEHD 1XEWY 3U5ZB 3VU9B 3H84A 2Q9BA 2V55B 4GOXA 4OL0A 5FPYA 1GDDA 4I81A 4Q21A 3MUFA 5SZHB 2YWEA 4KFSA 2ZRJA 3AGPA 5KU1A 1ESNA 3BORA 3KDSE 3U7EB 2PEZA 4A6XA 1R0YA 5JSZA 1GM5A 2AN9A 3AUXA 4P0TA 3A1VA 2ANBA 1NVXQ 1W5TA 1ZUHA 4C0QC 4EUNA 2Q3MA 4M2LA 3KQKA 1Q0UA 4IJMA 4WXPA 2CXXA 4RFSB 5BN5A 4LPSA 1KNXA 2G0TA 5BN3A 4DLXA 1G3MA 1LF5A 1MO6A 3EARA 1ZMXA 4NCKA 1U8AA 2C99A 2JA1A 2WJHA 4QHYA 1M6NA 4WZ6A 1SKQA 4YMVA 5AWFC 3DZ8A 3I8SA 5EE9A 1LW7A 3ZDQA 2FDCA 2BM0A 4P32A 4PZZA 4RKFA 2AHOA 2ZU0C 3QVUA 1M7HA 5ANRB 3P4YA 3GPLA 3SS8A 3NIBA 1GG2A 1RIFA 1Q3TA 1XDBA 3UWKA 4PC1A 5B58C 3FTQA 3N5CA 5SZJA 1E2JA 2A5GA 4L9SA 3EZFA 5K8IA 1ZYUA 1HT1E 4B6EA 1T0JB 2J59A 2R2AA 2HLDA 2C9YA 2WJYA 4M9XA 1BS1A 3X1WA 3EW9A 3IBYA 4E07A 5FL3A 4CF7A 5KDDA 1YRBA 3GLGA 3EPLA 4ZCLA 2RGEA 4IHQA 4AWXA 3I61A 3SI7A 1XPOA 3QBVA 1S8FA 2HCBA 3AQ4A 5HKKD 2QAGA 4LYHA 4QKQA 3TMKA 2D7CA 2CCGA 3FHTA 2IL1A 3T1OA 5HCIA 2FX3A 5ELXA 2OSBA 1AQYA 4P33A 1X3SA 2ZPTX 4RZ2A 3MGCA 1G41A 3WBJA 4JVNA 1YR6A 3BRWD 2Q3FA 1YJ5A 2HXYA 3KFXA 1MO4A 3X1DA 4DEYA 5C46F 4EPXA 4B2IA 3IDQA 4PC7A 4URUR 3BIFA 2BDTA 2BMJA 2DCUA 3IQXA 3GLIE 1TUIA 2WVJA 5LB2A 1A4RA 1P60A 4JLNA 2FSGA 2WWIA 5FPSA 2PZGA 5FL7D 1J99A 2N42A 1EGAA 4PC3A 3U3KA 4AYWA 2WTUA 2H16A 3CR8A 1XMVA 3UATA 5FOXA 2GVZC 2CCKA 4DIDA 1T3SA 2WSSA 3UG7A 4A82A 3K0SA 1N6KA 1CLUA 1QDEA 1XXHB 4LHYA 5H8WA 2B8WA 3QENA 3TE6A 4V0MA 1G5TA 3OIWA 4LRWA 1KIMA 4HB2A 3EASA 5TY0A 1Z28A 2XOKA 1Z63A 5CYPA 3SFZA 2ODNA 2E1RA 1ZBDA 2QUZA 2ZYTX 1E1RA 1OE0A 2PZEA 3R9WA 1ZVQA 4KLZA 1YZUA 4HAWA 2FV8A 3OEHA 3E5HA 1L4YA 3QQ5A 2FFBA 1F2TB 4CZ2A 2OILA 1ZIPA 2F55A 2RGAA 1RE0A 3BFKA 4B44A 4YMSA 3QG1A 3X1ZA 2GCOB 2WWHA 2X2FA 4JS0A 3IUYA 3QBTA 3SDZA 2P6RA 3QE0A 5FTNA 2VP4A 5CJ2A 5CB8A 3IIMA 2Z43A 4V03A 4C2UA 3VKHA 1PLJA 2JLSA 3EC2A 2QA5A 2BOVA 2O0KA 2OCPA 4LC1A 1HEIA 1WMSA 3LVQE 1G17A 4PHTA 4MKIA 1DARA 1NP6A 3EZ7A 4KAXA 3DOEA 2NMVA 4HZUB 1D9XA 3F0TA 1ZW6A 4LBZA 1FW6A 3GCGA 4CT4B 5DYGA 2QRZA 3BS4A 4GZLA 3GJ6A 3VR6A 4EJSC 1OH5A 1JB1A 4Y0AA 2Q21A 4TLAA 3I4LA 4WAUA 4IOKA 2FEMA 1NJGA 1KNQA 3L82B 4W5JA 5KNBA 3PVSA 1MABB 4NONA 3RRZA 4RD6A 1Z2AA 3GQBA 3PUZA 5AJZA 3AVVA 1CJTC 2D06A 4DXAA 5F98A 2PCLA 3K0AA 1FMLA 1AM4D 3DM5A 1P2SA 1CS4C 1SQ5A 1OXUA 1OPXA 4AC9A 2RGXA 2FU5C 1GL6A 3BB4A 2GJAA 1Z8FA 4CEJA 2JJ2D 2G3YA 3SEAA 1LV7A 2AK2A 3GLGE 4A92A 2JJ1D 1Z22A 3RC8A 4YXWD 2V54A 1IOZA 4QM7A 3KTAB 1X8KA 5EP4A 4OBEA 3A58B 2HUPA 4FMCB 1T0HB 3U6BA 4QXAA 4HB3A 5EQTA 5A4JA 2FWRA 2OE2A 5GADl 4M21A 1KY3A 1U0LA 2ZR7A 3MRSA 4EFLA 2A5YB 3WXMA 2CHGA 1D9ZA 4JMPA 3WHKA 3RYTC 1A2KC 4IVPA 2OFOA 2CEAA 2GK7A 4EPVA 1A1VA 5IHPA 1KI9A 4II7A 4MRRA 3QKUA 5CM8B 2N1BA 1C1YA 1AIPA 1KJYA 2XJ4A 3FFAA 3U60B 4CYMA 1WE2A 1ZD9A 1FUKA 2D3WA 2FGJA 5EE0A 4AG5A 5L3RA 2AX4A 1TU4A 2D62A 1WF3A 2ZI6A 3O47A 4XD7D 2GXQA 2YC4C 5F9HA 2VSOA 1FOEB 2WAYA 3HPQA 3SN6A 4E5UA 1NVWQ 3CM0A 4MUBA 4CIDA 3BD9A 4UKDA 5BWMA 2ZVQX 4KHZA 1N6RA 1T5IA 1CR4A 3QKRA 1L2TA 2VP2A 4EKDA 3VR2A 3D7MA 2HYIC 3REGA 3IHLA 4JLPA 4A36A 4QBIA 2DWOA 1VCIA 1XBTA 4I1UA 1TL7C 2XTZA 4TQ9A 3NH6A 1VCOA 2V7QD 3BC1A 4DCUA 1NIJA 2IX3A 4PHFA 1KZ7B 1KI4A 1DAKA 2C5LA 3F8TA 4B76A 3LVRE 4XH9B 3LFUA 1XEWX 3RABA 1G4AE 2Q0HA 2CNWD 4IVRA 1G3QA 3SJAA 4BLQA 5B64A 4A9AA 4M1WA 5UKDA 3VMFA 2FZLA 3KB2A 5BYJA 1I2DA 1KI3A 1X8JA 1ZD8A 2FMXA 2H8KA 2AXNA 3A4NA 3BK7A 4PC6A 4RCZA 4DLTA 4DDWA 3GJ4A 3MAAC 1ZP6A 3A37A 3DHWC 5L3SB 1U8ZA 2VEDA 5J4VA 2ZYUX 1U2RA 5JBQA 4ZIRB 4C3ZA 4NHOA 3CB4A 3AKDA 3K70C 1M8PA 4Z51A 2ZQ5A 1Q1ZA 2IYSA 3CRW1 3I8XA 4IEEA 3ECCA 1QVRA 4YQFA 2CVFA 2QMHA 4BLTA 3H2YA 5G41A 4DB2A 2GJSA 2YWGA 1AQUA 1SXJE 4OQMA 4ACAA 2O8EB 1XF9A 3DDCA 4JSYA 1F2UA 1IY2A 4YONB 3LDAA 3ZVMA 1GNQA 1E2LA 1AS3A 1DADA 1IJFA 1QHYA 4LJ6A 2FGKA 4UNSA 1VMAA 2BCJQ 1H8EA 3U3JA 1P2VA 1UPTA 1XTIA 2O52A 2V6IA 4IFBA 3FMPB 3RANA 4AKHA 5FOWA 3P26A 3R9IA 1J8MF 3ETLA 2RKOA 2HT6A 1IN4A 1P62B 4Q4AB 4D0NA 3KQHA 1OHHA 3THYB 2BMFA 2J46A 2JAQA 2D2FA 3RDPA 5J5CA 1W4AA 3THXB 2JLUA 2C04A 4C0BA 4HSEA 3TAUA 3MJHA 1E32A 2PX3A 1HA3A 5JI3E 2OBLA 3PQCA 4NYIR 4DCSA 2HLDD 1SVMA 3I72A 3IEUA 5CDFA 4C4PA 4IDOA 4L16A 3EAQA 2NGRA 1F2TA 3TNFA 1Z6YA 3ZS8A 4IOJA 4C7OB 4XSHA 3Q9LA 2JJ8A 2CE2X 4LCBA 4D4JA 4AKEA 2CJWB 3PR1A 1XCMA 2H17A 2KI5A 3LA6A 3X1YA 1KOFA 5HE8A 1Q44A 3T12A 1BH2A 3DVLA 2RGNC 4B2PA 3OE7A 3T1VA 1KO4A 3QXCA 2DR3A 3T34A 1MV5A 1JEEA 2F1RA 1BKDR 4LK2A 5J4LA 3SJZA 3K09A 1TUEA 3AP1A 1F3OA 2FFAA 3SQWA 1AKYA 3K0CC 3OAAD 3OEED 2NIPA 1Z0DA 4RCYA 5DYIA 5FL7A 2BBTA 1IAQA 3G5UA 1W5SA 1XWIA 1FP6A 5AR1A 5G53C 2GA8A 3M4YA 1F6BA 5CITA 1O87A 4Q1FA 5A0FA 1KJZA 1LFDB 2KBFA 3HU1A 2ZYWX 2DWPA 2JASA 3PITA 2FSHA 3EIHA 3TKLA 3ASYA 5FOSA 1XD8A 4P3YA 1R0ZA 3QI2A 3K0FA 1W36C 3NEJA 2O8BB 2B8TA 2P3SA 1A5TA 1E2NA 2F43A 2AFIE 2JLZA 4A8JC 3CF6R 1R7RA 3DPUA 1II8A 4N3NA 1E4YA 4HUTA 1E2PA 2O8FA 2WWWA 1E0AA 1F60A 2OV2A 1TEVA 1EX6A 1T3LA 2LWIA 4MRNA 5FOUA 3K9LA 2W0MA 4UJ5A 4JJKA 3BBPA 4ZO4A 1DO2A 1E2EA 2QQEA 2OBMA 3V4FA 2NO1A 3FVQA 4PPQA 4DKXA 1G291 2NZJA 4MRSA 4QBGB 4ZV4A 1NKSA 1NL3A 5IDVA 3FHCB 4PO9A 1MOZA 2GCNA 4PAOA 5LD2B 1OJLA 3EWSA 1Y63A 1DPFA 3QPUA 4ILEA 3WYAA 4B3GA 2DHRA 2OAP1 3NC1C 3W6NA 1T8TA 1W1WA 4V0OA 4Z8YA 1PZNA 1X86B 2PCJA 3EIEA 5HTKA 3B1ZA 3HR7A 1OB5A 4DSOA 1ZC3A 4CGZA 1JR3E 1GZSA 5EP2A 2D7DA 4OI1A 2R9VA 2E87A 3KKMA 1G7SA 1PLLA 2J87A 2OO7A 3KKNA 3LX8A 1EESA 3PCRB 4OYHA 2GDJA 5E95A 4QOSA 3TSZA 4A8JA 1G8GA 4P4TA 2DFNA 1RZ3A 2F9LA 1U81A 1U9IA 1Z0IA 4R7ZA 2Q9CA 2OLKA 3GLHB 4M1KA 1KK0A 1SVIA 1G8HA 3VFDA 1L4UA 4NYJR 3QF4B 1OF1A 3BAFA 5EUQB 1DAIA 2TMKA 1ZNZA 1UBFA 2PZFA 2P0EA 2VHQA 3MWKA 1S1MA 5JSZB 4PSKA 4GPTA 4MGZR 4A6PA 1YVDA 1CJMA 4LYJA 1NN0A 4X8MA 3B60A 3QKRB 4R98A 2VL7A 4BZQA 4TL6A 4XWOA 3U61B 4M9QA 3QEOA 4HATA 1OXSC 3V4RA 1E9FA 3W3AA 4FD2A 4FXPA 3AF4A 4LDJA 5FUYA 4JJZA 4C7OA 2XITA 2HF8A 1KDRA 1VDZA 4KSBA 4KODA 5FOVA 2IT1A 3ZQJA 1GSIA 4X8HA 1GL7A 5HKKA 1KK1A 3DM9B 2QL6A 2EWVA 5BXQC 3CUEF 2QNRA 1COWD 1Z5ZA 3NBFA 2WV9A 2PH1A 5K8TA 3BH7A 4RZUA 1XTRA 4OI4A 2O8CA 4S2EA 4LHVA 3PEYA 5EXXA 1FX0A 4BFXA 1P72A 2C9CA 4IRUB 5AJVB 3ZS9A 1WBBA 4ASUA 3VNVA 2XSZD 3B9PA 1SVSA 2I1VB 5K8LA 3QKTA 4X8LA 5LBIA 3A1UA 3EPHA 2XAUA 2CL7X 2WSSD 3NBZC 3UK6A 4LPKA 1AS0A 2JLVA 2ODWA 4DLZA 5DSZA 3A8TA 1K5GA 3R9XA 2GCPA 4RVCA 4B2LA 2PT7A 2OT3B 2J1LA 4Q18A 4Q4LA 2ZJYA 3T5GA 3A6PC 1SVLA 1XD2A 4MH0R 4Q7JB 2C98A 3GP8A 3K53A 4MUAA 2VHUA 1DAMA 3AB3A 4Q02A 2AD1A 4WZAE 4Z54A 4FCWA 4Q7KA 1OW3B 4K8OA 5GVRA 5D3MB 3K70D 2WAXA 4XTCS 5JHGB 1N3BA 2B6HA 5KHOC 2AR7A 3BH6A 3MG9A 1KY2A 3VR1A 3CRMA 2GF9A 4Z1MA 2XZLA 3HDTA 5JJKA 4M4SA 4I1OA 4B3FX 4ESVA 2G77B 2Z6VA 3VU9A 1A7JA 3CZQA 1KKLA 2QPAA 4UNNA 3DKPA 4JLDA 4PXAA 2XSZA 3NXSA 3JVVA 3WYFA 4IKEA 3B1XA 1T91A 3B8HA 4DIEA 2DBYA 1CJUC 5JJLA 2KSQA 3QF4A 2CHVA 3LRPA 2GBLC 2JJ1A 2V9PA 1W44A 3GLHA 1N6NA 4W7SA 1RRGA 1JPNA 1T6NA 2GJ9A 4KJZA 2UZ3A 3CW2A 4A0FA 4A0GA 1FZQA 1KO8A 1II9A 2YKGA 1Z3IX 1AK2A 2VP0A 3MLEA 3NBXX 4I1SA 2AWOA 1IONA 2GAOA 2B7CA 1KDTA 1MO3A 2W2VA 2HF9A 2IW3A 2R6GA 3K1JA 4OI0A 5DE3A 2LKCA 2WIAA 2VHJA 1ETUA 1G19A 4A0RA 2P5TB 4HLUC 3WY9A 4XWKA 2CVHA 2WIBA 5EE5B 2H1LA 2QTFA 3FPAA 3K8YA 3K9HA 3NWJA 3OIUA 4D0LB 4HLDA 2GHIA 5EZ6B 3TW8B 3EC1A 4EPYA 3C41J 4WVFA 3VX4A 1RVDA 4Q47A 4G5QA 5JS8A 5HE9A 1XTJA 5J4HA 1RYFA 3KQLA 1P9RA 2O8DA 1TU3A 4TMVA 1GKIA 1UBEA 3I92A 3G0HA 1AKEA 3CWZA 3KQNA 2C9OA 5DHAA 1E79A 4B43A 3SNHA 4BE7B 4FN5A 4QBFA 3C5CA 3C15C 4A4DA 2WJGA 1DAFA 2QE7A 2XNSA 4M22A 3PUVA 3TAHA 2O8BA 3ZD7A 2DWQA 3N70A 1E2QA 3A36A 1W48A 4TYPA 4GDFA 4R2IA 5E7JA 1NNEA 5E3HA 2ATVA 4DLRA 5LPNA 3AVQA 2IHBA 5C1BA 1TQDA 3LW7A 5CDFE 3RS7A 2NOAA 1CRQA 1OYWA 2JLQA 4B71A 4TL7A 3EX7C 4OK3A 4Q1AA 3RS3A 3CNLA 2OLJA 4B73A 2F1IA 1VIYA 2XB4A 1SXJC 3NVAA 2RGGA 2W58A 2BMDA 2V4ZA 3W6OA 4LZZA 1PVOA 4WA7A 2F7SA 4Q00A 2ZSAA 3NG1A 4GBMA 1EFUA 1U94A 4OKSA 1X6VA 2F1HA 4QNRA 1M34E 4TTPA 5FPHA 4BFYA 4LV5B 5CIQA 3CZPA 4URZR 2CHQA 2C96A 4Z1MD 2ZTSA 1P2TA 3SU8A 1OFHA 2G6BA 2H18A 2R6DA 1GFIA 4MGIR 1LTQA 3U7HB 5D3MA 5GVSA 5EJEA 2JIZA 5JI2E 4OHYA 1MABA 1WBDA 2W6IA 3RC3A 1W49A 2CMKA 4TSFA 1IN6A 1QHGA 4YDHB 3OAAA 5C4GB 2CLSA 4DDTA 3TJZA 4QL3A 1G6HA 3PIRA 2YJTD 4L15A 2LKDA 3CBQA 3PEVA 1US8A 3CRRA 4QRHA 1J90A 2QPOA 2W0SA 1W7AA 3W3ZB 1Z06A 3OE7D 2JLYA 2QU8A 1OH8A 2C03A 4PSAA 1LY1A 4FW9A 1OKKA 1XU4A 3R8FA 1YR7A 4IOLA 4O25A 1CR1A 4N0DA 4JBWA 2FSIA 1IXSB 4BUJA 3B6EA 1OIVA 3TBKA 4ZKEA 3WMFA 1KK2A 2ORIA 3KXLA 1U99A 2OFWA 4WIAA 1FNNA 1G3RA 1N0WA 1OT3A 1DTSA 4LBYA 1GAJA 1D2NA 2IYQA 4D4LA 1NG9A 5J4YA 5E7IA 5EP3A 1Z0AA 2J7PD 3GLGB 1W0KA 3FMFA 2IYYA 5JJIA 1F2UB 4LGMA 1UAAA 3ZZTA 1IQPA 1Z0FA 4PPFA 4ZPXA 2HYDA 2ZR0A 3N2IA 1VG0B 3OESA 2OCAA 3R8CA 1N6OA 2CJWA 4MDFA 3O8DA 4HAUA 5CK5A 1E9AA 4EQ6A 4Q4HB 4JVLA 2EQBA 4HDCA 1YZNA 3V9PA 3QPVA 4IEIA 2QE7D 2ZANA 1SVOA 1UKZA 1NMXA 1M74A 4JKYA 5M04A 3ADBA 4XWAA 4QG7A 1LB1B 4KSCA 1E2IA 4BFVA 2WWYA 1Z0JA 1YZGA 1E79D 1QVAA 2ERXA 6Q21A 1XB2A 1HUQA 4RD3A 2HJVA 1JECA 3REFA 4BZXA 2J3EA 1T9HA 1YQTA 1CXZA 2FN4A 1XXHE 2CE7A 1YRAA 5HR5A 4LWZA 2GZHA 2ZE5A 3FKSA 4NCJA 1ZU4A 4B35A 4I1VA 1G5RA 1M7BA 1V5WA 1OXVA 4TMXA 4MYCA 4ZDJA 3TR0A 1E0JA 4HDQB 3S1AB 3UMFA 4JYCA 2F3RA 4YMTA 3KQUA 3SZRA 3A1SA 4OQNA 1XPUA 3X2SA 3QG5A 3RAPR 3UANA 2IBMA 1DELA 3KJHA 3TVDA 1GRNA 2HJGA 2OZEA 3T15A 3GJ7A 4FI3C 4JKIA 4P31A 5A5GA 2MMCA 4DRZA 2O8EA 1Z2CA 2ZI7A 1TF2A 1MKYA 2YWFA 4TT3D 2EVWX 2HEIA 3ZZUA 4N1AA 2RHDA 3GJ0A 3VR5A 2GKSA 4PZYA 3CRQA 5L8VA 4KO8A 2ZUCA 4OK5A 4DUGA 4UQOA 2QENA 2REBA 3GMTA 2NPIA 3KUCA 1Q12A 3IILA 2VP6A 1ZM4A 3KJEA 4XSGA 3T35A 3VR4A 2XTNA 4ZCIA 4TYWA 2F43B 1QG4A 1G18A 1ONBA 1Q22A 3LBIA 3KZ1E 1T8UA 2H5EA 4DC9A 2A5DA 1PUIA 2IXFA 2IA5A 4DCTA 4QGFA 4GP6A 2DFLA 1R0XA 1UBGA 4XVUA 2BJWA 1LS1A 4HAXA 4NYIQ 4MDEA 2ZSEA 3L0SA 3CWQA 4HUQB 4A8JB 4U7DA 3OEEA 2FPLA 1P4SA 5DI9A 5DLQC 1E0SA 3ZGXA 3ICQB 3K70B 2P65A 4FCTA 5DO9A 1BO6A 2CL0X 1YU9A 4IXNA 4V0KA 4EQ6B 3UWOA 1FUUA 3C16C 4OHVA 3TR5A 3WMEA 1CJKC 2IK8A 5HZHA 4OK6A 2GESA 4ABYA 5G3ZA 3SYKA 4D4KA 5JCZA 4AYXA 4BEBA 5AUOB 1G4UR 1JBKA 4OJQA 4TYYA 4LJ9A 3KJIA 1ZINA 3RNLA 3HWSA 5L3QB 4QFMA 3EZ9A 3BJIC 3GD7A 1XD2B 3K9NA 1S4QA 5J47A 2IF0A 2IXGA 2RCNA 2NTYC 2REXB 3Q8XB 3DZDA 1XZPA 4JLKA 4EAQA 5DN6A 4TQUS 4WBSA 3A4MA 3I32A 3R20A 2ZEJA 3KKOA 2ZRDA 1VTKA 1E1RD 1U9IC 5P21A 4NCIA 1VG8A 2DB3A 2B92A 2QN6A 5FTJA 1DS6A 4DT1A 1MR3F 4F4CA 4ZDIA 4HAYA 1TQ6A 4PO8A 1OIXA 4TLCA 4M8NE 2FZ4A 4OJKA 3WNDA 3MCAA 4AY2A 4OQFA 5H68A 3QIAA 1E2FA 1P9WA 3LD9A 1NVUQ 1FX0B 1RC8A 5IT5A 1E96A 4M1MA 3U4QA 1P9NA 2XZOA 4Q1DA 3ZLJA 2J0UA 2PLFA 3LW8A 3CONA 4DCVA 2ZUDA 1KO5A 4JLMA 4AK9A 4XVQA 1MH1A 1A82A 1YZTA 1XTQA 4V0NA 4P4SB 5AUNB 3E1SA 4FMDB 5DI3B 1KHTA 1OFIA 2XTMA 5BYKA 2RHMA 1UKEA 2QGZA 1I4DD 1XD9A 3K0AB 4IDPA 1Q3HA 3QSYA 4NBSA 4B34A 2IHYA 1YKSA 3M0EA 2JLXA 4TT3A 4NMMA 4GZMA 3GFTA 4HLQB 2Z83A 2XEXA 4LJ5A 8OHMA 1D8TA 3MD0A 4NYJQ 5F2EA 1XTSA 4IDNA 4KCGA 2ZJ8A 3ND9A 3W8RA 1CKEA 5EXTA 4OQXA 5KDLA 3GLIA 4DDVA 4NYMR 2G1KA 3ONWA 4LOAA 3VX3A 2FPMA 2R6CA 3VTKA 4BZPA 4HB4A 4LJAA 1P75A 1G21E 5FTMA 2ASEA 2X77A 1U0JA 4HLCA 5FBRB 3D6TB 5C18A 2Z4RA 2J0SA 4JSTA 4A2PA 1KMHB 4B74A 3I73A 4UNPA 2VP5A 3SYNA 4KVAA 2EWWA 2V8OA 5CLLA 1AGPA 5E7MA 3LBHA 4TLBA 1NVVQ 3ZJYA 4LY6A 2W6JA 3I62A 2A5JA 3U7GA 1JALA 2CLDX 4ZDKA 3U3OA 1NG1A 1FL9A 1KK3A 1ANKA 1EK0A 4XOIA 1EFRD 2AKAB 4KXFB 2FFHA 1GKYA 2ZJOA 4B32A 4Q9KA 2OHFA 1FQJA 1R5NA 3O8CA 1JAHA 4Q1EA 2MSEB 1R10A 1DE0A 4AD8A 1JXMA 4BLOA 2JLWA 2JDID 2WPDD 2QBYB 2A3RA 1JEDA 2IS2A 821PA 1II8B 4QJ3A 3P1JA 4BFUA 2VSXA 1VPLA 3W5JA 1G7RA 4Q01A 2IUTA 5J40A 3QY0A 4HUQA 2J0VA 2HXSA 4TTRA 3ZVLA 4A2QA 3GLFA 2ZRNA 4QGHA 4CEHB 4KLNA 4L9WA 1CIPA 1XMIA 1W4CA 1X1SA 4LHZA 1KSHA 2QP3A 1GL9B 2YNMA 2ONKA 3CF2A 4JBYA 5EE1A 4W5WA 1TTTA 5EXPA 4BFTA 1KAOA 1EG7A 4CEJB 5FBLB 3LQQA 1R6BX 2CK3A 1UEJA 3MMPA 5IK2D 3GLFB 5H1YA 1ODFA 2X19A 2GRJA 1TAGA 2ZE6A 2HT1A 3OFND 1Z6AA 3LXRA 1H65A 3VKGA 1E1QD 3NH9A 1UKYA 4AG6A 2QTHA 4UNRA 5HZKA 1W2GA 3BXZA 3E2IA 4DBLC 4AI6A 1E69A 4U5XA 3SQXA 4PPGA 4DEXA 1RKBA 2QI9C 1M2OB 4MYTA 3OHMA 4URYR 4F4JA 2QM8A 4LI0A 4O2RA 4LV8B 2QSYA 3U7FB 4G5SA 1GILA 4P4SA 1Q1QA 4GP7A 2BCGY 3K9GA 1T3HA 2D2EA 1DOAA 1XZQA 4TSFD 4KI0A 3IIJA 1W36D 4C0SA 2XXAB 1XP8A 2VRWA 2YVUA 2ZI9A 3VQTA 1J70A 1Q1EA 2IS6A 4NZYA 3KXIA 2IUUA 1JR3A 2YYZA 3AV0B 3KKQA 1N6PA 4ASUD 1KSFX 2XJ9A 4BASA 2ORVA 1LS6A 2WKPA 5JZVA 1UEIA 1Q20A 4B47A 1OXTA 1GUAA 721PA 2B7BA 1N5KA 2KJQA 2WWGA 4CW7A 3TQFA 2BVNA 4PSVA 1TADA 4WZBE 1N5IA 1I2MA 1W2HA 2MSDB 2ZRBA 2WKRA 2FNAA 2PEYA 1RJ9A 3D31A 1N6IA 1DEKA 3GJ5A 3SJCA 3U3MA 4BGDA 1KI1A 3SYLA 1P7CA 221PA 2IC5A 3W8NA 2ZI4A 4Q48A 4BFZA 1FFHA 1CTQA 1WCV1 5EUMA 2PL3A 2PT5A 1FMJA 1YZQA 1LF0A 2X1VA 4BPBA 5L3VA 2YHSA 4KYIB 2VH5R 2PX0A 5LD2C 4B3CA 1TMKA 4CEIB 2AK3A 2ZJZA 2I3BA 4KITB 4JLJA 1PJRA 2WM9B 4DSNA 1OLOA 2V7QA 5C4MA 2GJ8A 2XZPA 1G16A 3AF0A 3B1VA 4NCHA 3UKDA 4QM6A 4HDOB 2KB0A 1M1YE 1J2JA 2P5SA 1G1MA 5J4KA 2IYTA 2RB4A 3W5IA 2DPXA 4JT2A 2OEPA 1VKJA 1NRJB 3C5HA 3QUSA 4MYUA 3AM1A 4TTQA 2RGDA 1N6LA 1JNYA 3AF3A 2NPFA 3PJRA 2ZIAA 3UXMA 2J0UB
chains in the Genus database with same CATH superfamily
2EF0A 4IZIA 3WLJA 1G64A 1DHRA 1ULUA 5ES3A 2P6OA 1A4XA 3DKVA 4AJPA 1QIFA 3G9ZA 2J41A 4YAWA 1QRSA 4I55F 4H1TA 1LNSA 3GJXC 4L8YA 4LMAA 5J1SB 2NO7A 1UBHS 3A7EA 5GJCA 1ZI9A 4QLBA 3KJQA 4BTVA 4Q34A 1BGVA 5EJ5A 1LZKA 4R1OA 2QVLA 5TARA 1CNEA 2HHAA 1GG8A 1JKFA 1X0VA 4OXQA 5IK2A 1JJAA 3VDNB 6NULA 2QAGB 1TGYA 3LY8A 4K2HA 2EFGA 4NZNA 1YC5A 2NO0A 1VJGA 1W46A 4DXDA 2DC1A 2G83A 5LZ5A 4S12A 4E2FA 5JCPA 1AN9A 3WP0A 1RQGA 1DBSA 3K16A 3M6AA 1C7JA 2C2HA 1XK7A 2VSFA 2Q29A 4KN8A 4Q4JB 4Y6QA 3IQGX 3QIVA 5FV4A 1SVWA 3E0QA 4XX0B 1L7EA 3ZDBA 2NXCA 4HLUA 4MV7A 3MIIA 1N2CA 1JEYA 3TX2A 3KUKA 1X0XA 3D0QA 4NQRA 3S44A 3DZBA 3N3AC 2HSDA 4G1CA 4TLEA 4WFJA 1DG9A 4ETNA 3PLNA 3QUTA 4IGIA 5LIRA 2YZ2A 5DX1A 2QD5A 2ZGVA 4C20A 4ZT4A 3TW8A 4YT8A 3EIFA 3GMSA 1XN4A 4TN1A 4PSDA 4XIIA 2ON6A 5KDOA 2POCA 4R2WA 1QGED 3E7DA 1Z12A 1YI0A 4XVCA 2PO5A 1LCIA 3NNSA 4LG1A 3MRXA 3VPXA 1EP3B 4BKUA 1IN7A 4GMXA 3QELB 1N0VC 4PANA 4XQGA 1G5HA 1PK7A 4JL8A 2BBOA 3B2EA 3GNTA 3KEFA 4Y2TA 5EXDA 4RTMA 4M6WA 3F2IA 3FGNA 3INYA 1GPBA 1BXRB 2I03A 2YZKA 4KIUA 1KHHA 3HSSA 4JGBA 5T67A 1X7XA 3IO5A 3N8KA 4JBHA 1C3OA 1VKHA 4P4NA 1XYYA 1HYBA 2JBWA 2JLAA 4YO7A 3UT5A 3U44A 1QVVA 2BM1A 1E5VA 1Y4DE 3BX1A 3RAGA 3UB3A 1N2GA 2EU8A 4EYKA 2F1KA 3EIUA 1EUDA 3EQ2A 3HUEA 5JAPA 2HD4A 4IO0A 3CN9A 4JLOA 1D2EA 3P27A 1BN7A 1KEPA 4EVRA 4P38A 5K0GA 4AQYB 2YDXA 4JI6B 2EEZA 2G9NA 4K9OA 4IXMA 1VKNA 1XTUA 1ADJA 3NT5A 3RH0A 2CY0A 4OGGA 4WHMA 1ZHOA 1EHIA 1N2CB 2A0FA 1PDOA 4P83A 1IPFA 5FUVA 2JRLA 4EUFA 1Y3AA 3E3MA 5TV2A 2Q3CA 1WY7A 2RH5A 4Y18A 4AFNA 4PGMA 1C4WA 3F71A 1HH4A 3PQ5A 4DA7A 1YRLA 3N2EA 4ND6A 1ZAKA 4EI9A 3VJLA 3MOSA 1E2UA 1EHCA 4MW2A 1LBTA 3D6NB 2N1MA 3OCJA 1OLSA 3ASVA 3WIEA 3CQ9A 1ZH0A 1RWBA 4CT5A 4F5DA 4BB6A 4P7JA 4BBJA 5CVJA 1N5JA 2JFPA 1FTWA 3AFIA 1J0AA 3WK6A 5AVSA 1PBTA 4RBNA 3MS7A 1S9HA 2CXUA 2R4UA 1DXQA 3RTEA 2JPDA 3KPYA 2A14A 1A0OA 1C9NA 4FN4A 1ZD1A 1IPHA 1KETA 1KY4A 3OPMA 5EIOA 1Q7CA 3C70A 3K0FB 4ZCSA 3TRIA 1J5EB 1D6SA 4V02A 1Y4AE 5DM70 3WLLA 4BP3A 3FTEA 2RAVA 5F4ZA 2BM9A 3ND8A 3W06A 1P1JA 3OIYA 1WJGA 3DMDA 3PHJA 4MV5A 3FCAA 3SEQA 3WRYC 2Q2NA 2Q45A 2ZREA 4IDHA 2I8CA 4E5SA 1YI1A 3G2JA 3QLVA 3H6GA 4K46A 4QTZA 5DDIP 3WB0A 3QLJA 1NMZA 2HO5A 4Y9TA 3REQA 1R2QA 3AYZB 4F8EA 4KNYA 1KEUA 1GQQA 3GRRA 4UUOA 3KBBA 4XD7A 4CRWB 1NXPA 3TTYA 1U7OA 5TIIA 4KYVA 2ISSD 1E4VA 2G67A 2YFYA 3CINA 1Q7RA 3OJCA 4G5RA 1ZCZA 4LRSB 1C3LA 2Y6UA 3BF7A 1IEWA 3PFKA 2FEPA 1XFDA 2JIZD 3HMQA 4R9NA 4TQAA 2AT1A 3MPOA 1XDDA 4QBHA 5AXCA 2FEAA 4DV7B 2I2AA 2PJRA 5CBPA 4IFTA 3ROGA 4BLWA 2QG6A 3FUWA 5DI3A 1SIWA 2ATXA 5SYAA 2OXCA 5DNUA 4P0PB 1W87A 3R6DA 1YBMA 5LU9A 3ER8A 2FH5B 3P2OA 3WL3A 4A27A 2CMGA 2ZQYA 4OPMA 2W2MA 1KH2A 3DH0A 4J07A 4F8JA 1RPZA 1PNTA 4LGVA 4ZTBA 5A03A 1QCDA 3UENA 4BEWA 5C2JB 3ZHOA 1MAAA 1RQXA 2EG9A 4FD3A 2EQ5A 4CBVA 3GP5A 2AUTA 2F8MA 2P5UA 3FPCA 3NRJA 5IJZA 5CLQA 3ZEAA 4MV1A 3RIHA 4PIMA 1NN1A 1JMYA 2IYUA 3VOSA 4G63A 4NR0A 4YJFA 5P8WA 8AT1A 1YDMA 1R4NB 1L4KA 5ERXA 4UU0A 3CFYA 3HH8A 4TVKA 5I9SA 2ZBUA 1OZGA 2PSDA 3PGXA 4EK9A 4A15A 5F9FA 2A6PA 2ZT8A 2IEYA 1Q0ZA 4PTLA 4H35A 2G06A 1XDZA 3H0KA 1TCCA 4H1VA 4WUVA 3SBDA 4P34A 1L7AA 2IEGA 5FTKA 1GNPA 2MHCA 3LUCA 2VF7A 2AEEA 3UQZA 1Z3CA 2VKQA 2A7XA 4XTRA 3UKOA 2FVXA 2FMIA 2FSSA 2J48A 4YP0A 1T1IA 3GN2A 4D42A 1ZI6A 3JATA 4FP9A 3WDLA 4B6GA 4J6FA 4OREX 4TMKA 4U02A 4ZRMA 1AJEA 1YJ8A 2FN8A 5I7UA 3RS5A 2P9BA 2HQSA 3PNVA 4X1KB 4X60A 3K0CA 4FDVA 5FHRA 3VC2A 3NVDA 3SG0A 2CNOA 4L51A 1RHQA 5KTOA 2ECKA 4L08A 4B82A 1KSJA 1JXAA 2OFXA 1UOQA 1XLUA 5JOQA 1I3KA 3CPEA 4UEQA 1ZU5A 3L8EA 2R6R1 3T7RA 2O19A 2JIQA 3KZOA 3U26A 4MSUA 5DISB 3EE6A 1M2OA 4O4IF 2CLHB 1YR9A 3JD0A 4IG9A 2VNJA 1RBZA 4WJLA 4DUGD 2ZZNA 4RK4A 3R74A 3LHFA 1QHHA 4MP3A 5EKSA 3UK0A 1WXXA 3ZLUA 2EX1A 5JAUA 4PYNA 5KQLA 1SR8A 4JA0A 2Z95A 1SCKA 1QNLA 3PIIA 3R40A 3GEPA 1RBMA 2WMNB 3AJRA 5FBWB 3TIGA 1TC1A 1KDOA 3NKVA 5HFAA 4QQKA 2VWGA 4B3DA 3Q8MA 2CK3D 2BZGA 1QQ5A 4FMBB 3ZNPA 3RR2A 4G5GA 3N07A 3O1HB 2JI4A 3F8SA 1SC1A 1M5UA 3CNNA 3FPEA 3KK0A 4FKMA 4GU5A 2GNOA 4D9BA 2POQX 1JVNA 4GE0A 1QRRA 4LRUA 2I9PA 5EIXA 1KO1A 1NW4A 1DEXA 1B8PA 3B3AA 4RTRA 4NFLA 4YDSA 3ZIDA 4DIFA 3RASA 4L5JA 5E1DA 4NTZA 3H0EA 4PGHA 4X1IB 2Q1SA 2EGHA 4DS3A 5CXQA 2YBEA 3TLXA 5LLDA 3ESZA 3PQ8A 3DT9A 4WKCA 1AA9A 3E84A 3Q88A 4QNMA 4U6NA 4OX9B 1Z13A 2WIDA 1IEQA 2P7IA 4KUGA 1JU9A 4ZCQA 4ARZA 5K03A 3X1MA 2B1GA 4DKJA 1OFVA 1XMSA 3EIXA 3LRXA 4YBZA 2RFLA 3ORRA 3EWNA 5GPBA 1MDFA 1Q2UA 2R6AA 3OIDA 1V4VA 3RUPA 4Z49A 4GEGA 1DQNA 2NAPA 4ITVA 2E1PA 4H1HA 3DEAA 3KWLA 3OT1B 4JB3A 3ZKAA 4UQLA 4YIHA 1GFWA 1G8PA 1Z7GA 4YN3A 1W47A 1H8ED 5HOQA 3W5BA 2XRZA 4OLAA 2F3QA 1WVMA 3EZNA 5C3MA 1CDEA 1WZ2A 3RKRA 3HDQA 1TX4B 4GLFA 2PLAA 2ZRCA 2MSWA 4K3UA 4ZVPA 2IWRA 3B3FA 3CJRA 4KR6A 3DZHA 3JZMA 1U8XX 5KIAA 2ZRAA 2CV0A 3AGQA 1CB7A 3GZNB 4RVOA 4D46A 4Q4JA 2EP8A 2FWAA 2GILA 2ZITA 3RTGA 4Q3KA 5I7EA 3MXOA 4ON9A 5A3SA 2IS1A 1AUQA 4FE7A 3DKIA 1VGRA 2CUZA 4J91A 1Z73A 3UGQA 4YRKA 1BX0A 5CYGA 4TWRA 4PHCA 4YTEA 4W99A 1GTVA 3R7AA 4A5SA 2Z0MA 5I3ZA 5G4LA 2XNDA 1U2GC 4GGPA 3UAXA 5A1JA 1DKPA 3D3QA 1CR6A 3JQAA 2AVNA 2ZAMA 1M66A 2EATA 1I7PA 3T7DA 2NNWB 3P4XA 1XZGA 3WKDA 4J7UA 1E2HA 1GTL1 2C9ZA 4YWHA 3TRDA 1R16A 3BB3A 3BJZA 3FZYA 3OO1A 5J59A 1FXUA 3TJRA 1SQ0A 2GZAA 5F73A 1Z8NA 4FHGA 1QCCA 1MD9A 4DR5B 1NW7A 1PP4A 4HVAA 4CCWA 1RRCA 4NCBA 3B5JA 1DAOA 3I04A 3CTPA 2OYRA 2VFAA 1IU9A 1KR2A 3BXGA 1X13A 3HCEA 4MQ4A 4OIMA 3KIPA 3RKUA 3SPXA 2D1SA 3I5XA 1EFAA 3HBAA 4CEHA 4XM0A 1NW9B 3DO5A 5KWIA 3IEMA 2XQKA 3HEAA 2C2OA 4I50F 2CHEA 1EFVB 4OTZA 3LHKA 4J0IA 1ESMA 4BKMA 4S35A 4I19A 5BMOA 3QPDA 2BE9A 3DCYA 5J2TF 4C1NA 1BHJA 2P2GA 3LGXA 4XGQA 5FNZA 1XCJA 5SY6A 3SOPA 3KXKA 3VHXA 2ZI3A 5E8RA 1NTRA 3IUBA 2Y9MB 1NP7A 2LDBA 1L1QA 4KO3S 2W83A 1VIMA 2VXCA 4TKUA 3TL6A 1PJ3A 1N1GA 5FQNA 4Y7CA 2I71A 2D74A 4TMWA 5U4XA 3B6KA 2ZUUA 3ZH2A 3TRFA 3WDSA 3BEDA 3THWA 4DWVA 1RWNA 1ZAYA 4FONA 2H1IA 3T41A 2HA7A 1QYRA 1XKXA 2KPOA 3GCXA 3H86A 3PXAA 1NJ8A 4PPNA 1E2MA 3IXLA 1RJDA 3BFXA 1HDRA 2AF3C 2L42A 2ZUTA 3SHOA 4KBFA 4BMZA 2PRKA 2VPWA 1MPXA 4AKGA 5K0JA 1M6EX 4DLPA 2VHWA 2FCRA 2WLTA 1VJTA 4ZCPA 3M5DA 2ZSUA 5IM4F 3IPXA 4J0QA 3RVSA 1MF7A 1DAPA 3WJ7A 1C4KA 5KNCH 5LQMA 3GAMA 4PIVA 3ZYZA 1ODIA 3W34A 4CDGA 2ZUEA 4HH3C 3ZHYA 2XH8A 4MV9A 3D1JA 3LVBA 4IGEA 3FVWA 4GNRA 4UCXA 2ZIEA 4X7BA 4YWJA 3VYTB 1E3DA 4M53A 3LTNC 1J24A 4G97A 3PQ2A 3KOOA 3OIVA 5EJGA 2IZ6A 2CGEA 2MYUA 2Y1XA 3MYYA 3QPAA 4XGNA 1OI2A 3E82A 2WZBA 5HKLA 4E5YA 2GM9A 5JISA 1OTYA 1ZGAA 1G60A 3QF7A 1QR2A 5EWMB 1C9MA 4CV3A 3IEVA 4US0R 1AHIA 2HBYA 2OM2A 5KPDA 4HNQA 4PTYA 2FEXA 4RDCA 4OM7A 1PZGA 3LP5A 3D1LA 1SU6A 2CLLB 4N18A 4XIGS 4Q03A 5DMHA 1PEDA 3SZMA 4ZYTA 2OR3A 3DD1A 4JODA 2H1SA 1GITA 1TYCA 2I34A 3OZUA 4OP3A 3EPRA 4ZI5A 4NL4H 3W3AD 4HWRA 1G7TA 3NWBA 2ZQZA 3PG5A 3G8AA 3PF9A 3VNBA 1MA3A 3C5VA 4WTOA 3Q5EA 2G7ZA 1YC2A 5HDQA 2CD7A 3DF7A 5EPEA 2JDIA 1XEXA 3HLTA 2YJNA 4YLEA 3I6YA 3PYXA 4R81A 2P6NA 1N78A 3LBFA 4RHTA 2HREA 3L79A 1L4BA 2GBIA 4HFJA 1DTWB 1JPVA 2YL2A 1SNYA 1KMIY 3E70C 1S1CA 2REOA 2PV7A 1LPSA 1NBAA 2ZR9A 3B9RA 4Y2RA 1R9JA 3UW1A 1T36B 4IS3A 4PQRA 3GFRA 4HV4A 5HSGA 5J2UA 1KF0A 3U56A 3N2GB 5JQGA 1V5IA 3MJ4A 4N8EA 4DQVA 2VF5X 3F5SA 2O3UA 1JXQA 3FHLA 1K4KA 2VAMA 2VOEA 4L4UA 4L5BA 2R5FA 4MVJD 1PFVA 2M1ZA 5IC6A 4RY2A 4ND1A 3C3CA 1UF9A 4U7GA 1AV7A 1U2GA 3ZWMA 4LYFA 2OTCA 1TVKA 4L8WB 4B2YA 1ZVMA 2QQ0A 3WGUA 4D79A 4AECA 4KBYA 4EGAA 3VOTA 2PJZA 2ZCUA 1M2KA 1KGDA 2VNKA 3HB4X 1NUUA 1QH0A 1YA6A 5KPJA 3LG2A 4KB5A 5IZCC 4C76A 2IQ5A 4D6PA 2X3UA 3QOWA 5HA5A 3QVSA 4FIDA 1PDWA 4KLAA 2FUEA 2PGAA 4D82A 5CVEA 5AK6A 4LXUA 5EI5A 2ZSHA 2M6LA 2CN1A 3HJBA 2O2XA 2BT4A 1U0FA 2CSUA 2GPWA 2PBRA 4L85A 3RO7A 2JI6A 2OSVA 4RFVA 1EB8A 1KS9A 1TJNA 3NX4A 3VVLA 3H8WA 4KXXA 5COQA 5SYMA 4E2ZA 2G82A 2IKSA 4G3XA 1N8KA 3P94A 1UJ2A 4QECA 1ZIOA 2YTZA 4KFTA 2GJKA 1GZUA 1IEXA 1EHYA 2ANCA 3HJHA 4QU0A 4ZOBA 1CRPA 1G66A 1Z4KA 2Y6VA 4P3KA 1NSTA 3GIDA 3GRAA 4BNDB 5HCUA 3AONB 3ZU5A 2RHRA 4BGEA 4E08A 3W04A 1QIHA 4O4JF 1RKQA 1ZNXA 1J21A 5FH9A 3VSAA 4BN4A 4HJRA 3RTDA 1PFGA 4DSZA 2V6BA 1G20B 1SHZA 3AP3A 4Q4AA 2JATA 3MJCA 1E9RA 3B6IA 5B12A 1WKVA 2RGNA 3HYTA 4OOFA 1K6XA 1GN9A 1OFTA 5F78A 3CG0A 1CPYA 3HFGA 3R3XA 1VCHA 3GVXA 3OCZA 1H3EA 1WB6A 2C29D 3BXEA 1YCHA 3DNPA 4QREA 3UG6A 4CV0A 4LA4A 4WXEA 1K8QA 5H4HA 2D59A 3PHGA 3BE5A 4G1EB 3B78A 5E7QA 5ADVA 1O94D 1NX9A 4QYIB 4MUNA 3A1WA 2JLRA 1WUHS 4QUEA 4YJ3B 5I9BA 2RIRA 2ZRKA 1JJFA 1L8QA 2RGBA 1TF7A 3KWFA 3QPBA 4G0YA 4OGKA 5IWCA 1W4RA 1F4LA 4WCVA 3SF0A 4GMFA 1GCOA 5LYYA 1YRHA 2DFKB 2CDNA 1ID1A 2VR1A 5F9MA 3TUIC 1T2DA 5A3RA 4CEIA 2OCYC 1K08A 2Y1LA 3NFYA 4RZ3A 2X0FA 4CLOB 1K6IA 2GK6A 4CDNA 4JLBA 1KO7A 1SBYA 1WNFA 2FOXA 3B7PA 1PNVA 1AGXA 3BH0A 2X4LA 4H7PA 2GBLA 2VYQA 3II6X 3QKSB 4RLQA 5L3SA 1USGA 3HCDA 4MR8A 3A6HA 1XXHA 1P2BA 3MMZA 2Q9UA 4P36A 5EWJA 2WQ7A 2Q4DA 4ER6A 4D26A 5LP6A 2ZRPA 3T9EA 1RFLA 2ZYVX 4RSMA 1LW6E 5B2ZA 2C78A 1DBQA 3HMKA 4WX2B 1T6ZA 1GGJA 1DHTA 4Y6GB 1JN0A 2PLRA 3ZNOA 1TW3A 5ETJA 5FPQA 5IULC 4G1MB 4Z5XA 3T3NA 4DDUA 1IM8A 4AY5A 4PFJA 3A3OA 1X1TA 1GPLA 1W6RA 1OBHA 5A2GA 2HJRA 1HG1A 3UJAA 1UDRA 2AFRA 4BNNA 5HZGA 3NB0A 2A78A 2YFKA 5I51A 1KEVA 2Z9DA 2ZTMA 1GKUB 1CUXA 2O2IA 2BL4A 4WESB 4ERNA 2IYLD 1I24A 2XNDD 3O73A 1CUZA 3ECAA 1K92A 1ZWKA 2YNMC 1WUKS 2QTCA 1REQA 3LHDA 2ECOA 2WICA 3I3OA 3IE1A 1P4JA 2YOHA 3BE4A 2CXRA 1NPTO 3EZ6A 4R1TA 2VRNA 4Q24A 1JR2A 1M2JA 1Y42X 5D3QA 1A8HA 4Y2QA 3NWOA 4HTFA 1DNPA 1IG3A 5BW6B 1JI0A 2VDVE 5B7GA 1U90A 2XXAA 1QF6A 2GERA 1IBRA 3LQ2A 1D07A 4F3KA 3CUUA 3OT1A 1GGHA 3TLMA 3M2PA 5AVUA 4XIYA 4ZCMA 3I5YA 1Z8HA 3F6CA 1U1IA 5BVHA 4K9MA 9LDBA 1XQ9A 2NV0A 2KE5A 4GOJA 4EA9A 3QHAA 3FYTA 5BSUA 4ETWA 4WV3A 1K4YA 3DBIA 4KVZA 4CQLA 1G63A 1IN5A 4GPAA 4MLDA 1S4MA 1CUUA 4A1FA 3R3HA 4EGQA 2XCLA 1IXZA 5I8PA 1EFDN 5GOZA 4R1UA 3DDZX 4D8TA 1HQYE 1NVFA 3JV7A 2O4UX 3LX5A 2OG2A 3KD2A 2WUVA 3OJOA 3P5BA 4L2IA 3KJGA 4I99A 1A4UA 1BE0A 3JTMA 2VPQA 3TW0A 3UA4A 1D04A 1R8QA 1NLFA 1XR3A 2B2XA 1RWWA 1PDVA 3PGMA 2I4LA 4PZAA 4YACA 5GJWC 3TIFA 3G2KA 3VDQA 1GJRA 2JGDB 2XGSA 3H1PA 2BUCA 3WA6A 2Q2VA 3RVMA 4Q1BA 1BZYA 1AS2A 2XRYA 2GWHA 3EUAA 1M0EA 1CIJA 1TCBA 1YDHA 3ONVA 4LE0A 1M1ZA 2VJDA 4CU2A 3DZJA 3HXTA 3YASA 3DGFC 1B1AA 5HQTA 4JLAA 4RHCA 1UAGA 5PNTA 2YW2A 2GHRA 2QY9A 4G9GA 3HM2A 3H2SA 3RU2A 4EOGA 2IYZA 4HAVA 4NH4A 5LDGA 1VHLA 3IA7A 3PWKA 1CQWA 3B1JA 5SY9A 1G5PA 1SOMA 3D3NA 4AICA 1XEXB 2C0QA 3PUJA 3T94A 3MIZA 4DCPA 5I4KA 4FYHA 1FF9A 4E11A 3L8DA 1S2LA 2VBCA 5AVZA 2IYXA 4MI6A 2BEVB 2GN2A 2J7KA 2VAXA 2ZJ2A 3CZCA 3LYAA 2AV6A 5J63A 3W8FA 4CMGA 2O4CA 1F2DA 3E7WA 5IF9A 1EWYA 3H1AA 4IICA 4QJ4A 1Q1NA 5G3YA 2NZ8A 1VDMA 3EFBA 3K6KA 4EA8A 1FU4A 3HCAA 4EY6A 3DE3X 5EJ8A 1O03A 1F9EA 1N77A 4WXYB 3UIEA 4TN5A 4MRVA 1Z2OX 4M9SA 2E89A 4F7WA 3ZNQA 2Z04A 4E7PA 1E9EA 1H2AS 4MRMB 3UXHA 2D4HA 2HMTA 2Z2ZA 1UKVY 3CRVA 3GGJA 5DBGA 1JR6A 4EPRA 4K26A 2OCXA 5JFTA 1F8FA 2HUNA 5K5EA 4FFOA 1F0YA 3SDBA 3I9MA 4A6DA 2WILA 3F9CA 2GZMA 1PJZA 3T4XA 4BQEA 2YS6A 4L76A 3QVVA 2JD0A 3TEMA 5CB4A 3F67A 2GX6A 2VUUA 2F64A 2GZ2A 1E92A 3I2FA 5AM0A 5KO2A 1XPRA 3MK31 3V33A 3ZTWA 1I14A 5EZSA 4P5PA 2AH5A 2WV7A 1L4LA 3H9BA 2ACWA 4KFUA 5DGIA 3ADCA 2PUBA 1DDGA 3RIGA 3GZ4A 5AD1A 1PL6A 2R00C 1FFWA 4TMZA 2D00A 1Y1RA 2IUSA 1QPBA 3QMVA 4EG3A 4OF4A 3HJGA 1H0RA 2Y1OA 2ZVPX 2HWKA 1E0DA 5FPKA 4YXWA 5B1IA 4URXR 1NUHA 4QDJA 4ARVA 2JFYA 3KVRA 3OPYB 4JI1B 2UZ4A 4ZT6A 4ZXPA 4CKYA 1J23A 2JB9A 2FG5A 3QSGA 3F3SA 3FB4A 1TM1E 1DX9A 2CYBA 4R9UC 3H2BA 4HWKA 3QTBA 2YHIA 3IP9A 1XMJA 3UN1A 4WDQA 3MWJA 1RRFA 4DSUA 4Y9DA 2ZATA 1UJBA 2HQ1A 1IBMB 4JA2A 2I29A 1A04A 1BOOA 3LC7O 1BDBA 1GL3A 2ZE7A 3SICE 3SSNA 3UMGA 4BLRA 3IV9A 3EUFA 4O5OA 5C81A 4N3AA 1QO9A 3DPSA 1T5SA 4DAOA 5DIFA 2AB0A 3OSUA 3WC4A 3GRKA 4LC0A 2B35A 2AOVA 3H4VA 3MELA 5CTAA 4DCJA 2DSNA 1M72A 4WQMA 4UXJA 4BFWA 3Q3EA 3LL4A 1RZRA 3GR6A 4B79A 4U0KA 1QMGA 5TDHA 2IXEA 3AVPA 1XTKA 3MT0A 3OFSA 4GBJA 2GXUA 2MOKA 1EFLA 1FW8A 2CVZA 2CW5A 1L5RA 1NDUA 2WMDA 4Q7LA 4YCAA 5FEMA 5TQJA 3U40A 3QMPA 4FHCA 1DO8A 2VJBA 3QW2A 4B46A 3EG9A 2G1AA 1S2OA 2H7XA 2ALJA 4HYYA 4L5CA 5F64A 4B0PA 5ITSA 2XB2A 2OBNA 2H65A 3GRCA 2Q3HA 3HEMA 4NZ9A 3NAGA 3I4CA 3EAGA 1E1QA 4GE3A 2OM6A 4LXXA 1XFAA 1V5GA 3ICCA 2MJLA 5FAXA 2VK4A 1G1AA 4N5IX 4RPKA 4E3ZA 1FFBA 1IHXA 1VA5A 1VIVA 2WU0A 3HKBA 3O0TA 4JC5A 4QYMA 4C9BA 3DMHA 1XNQB 4X8OA 1A9YA 2GMWA 2Y2UA 3QUBA 4G1UC 4D56A 3FNEA 4ZHSA 2IHJA 3QKWA 4IIJB 4OHXA 1UDWA 1G9TA 2NXNA 2AMYA 3GMIA 4KG7A 5B1YA 5BUZA 3B51X 4MGYR 1NN5A 2JBAA 4WW0A 1K5DA 1U6KA 4QUKA 5HFNA 1HEUA 2UYOA 3KLBA 4P0QB 2M6KA 4AJKA 2H0QA 3LQKA 1P3DA 5AKEA 1TRKA 1ZEJA 4LJ8A 3TLZA 1LNZA 3MJDA 4O29A 4F45A 4U4AA 4V1CI 3U7IA 3GLFE 1SUCA 1GFSA 1ZHHA 1JG3A 2QP4A 2GHQA 2OO5C 2DTXA 4P1ZA 3R7DA 3SFVA 4R0VA 1XVAA 3L04A 3Q0TA 4NU5A 4CG3A 2ZKIA 2G7MC 1LRLA 3KEQA 2LCQA 2Q9BA 5D6OA 4OL0A 1FSZA 1GDDA 2G9UA 4IR7A 3EIOA 3H65A 4ER5A 4CM8B 4Q21A 1RKVA 4P4LA 1A8PA 2YWEA 4KFSA 1JLRA 3AGPA 4ILKA 3U7EB 3KDSE 7ABPA 3QFFA 3LQYA 3KL2A 3OWHA 3L0CA 5F3DA 3AUXA 3A3YA 4EJ6A 4ZYWA 5JJ5A 5JSZA 2ANBA 4Y6OA 3C8HA 2BFCB 1ZUHA 2QUIA 1YHYA 3E03A 3TG8A 4M2LA 3KQTA 4XGKA 3KQKA 1VPDA 2O7RA 3EXFA 5TMEA 4ZOLF 5C8YF 4X85A 4C7XA 4ZGGA 5HIMA 4WZZA 2A0UA 1G3MA 4UUAA 3URMA 1MO6A 1ZMXA 1NE7A 1U8AA 3SIRA 4NECA 1O94A 3MS2A 1EBBA 1SKQA 4MQFA 4WZ6A 3BXXA 5DULA 4P08A 5AW9A 5KTTA 3K15A 3QK7A 2HB6A 3I8SA 3INGA 5EE9A 1KFKB 1LW7A 3CTMA 1NNSA 3KFLA 2BM0A 2FZGA 4YRMA 2AHOA 4LAFA 2ZU0C 3W4IA 1PZEA 4ERXA 2E2WA 2Y0CA 3QBDA 4JYPA 4U2KA 4BUCA 3VZRA 1XDBA 1ODCA 3QFRA 5HNKA 3FTQA 3M6MD 5FLEX 2KM1A 3UAGA 3AHFA 3VNAA 1E2JA 1KY5A 1Q3KA 4AJJA 2VYND 5BSTA 4X94A 4DR4B 3ZD8A 4R41A 5CNIA 1Y8AA 4GVPA 3FJ1A 2FPWA 4WN3A 3B12A 3Q7IA 3BSYA 3X1WA 2C9YA 1ZRNA 1ZJYA 1E66A 3IBYA 1MTZA 3VZQA 5FL3A 2R8EA 5L7YA 3L8GA 5KDDA 2CV1A 1YRBA 4Q3CA 3SI7A 1BW9B 1PW7A 1UQTA 1EK5A 2H2IA 2HCBA 2J3QA 3NV7A 5HKKD 2QAGA 1C5KA 3QGMA 2R84A 4LYHA 5SYNA 2GUGA 2XODA 2EX4A 4FLFA 5AT1A 1N57A 4KOAA 5HCIA 5JDCC 1BA3A 2OC4A 3JQCA 2Q3BA 4P33A 5F1KA 4RZ2A 3O8NA 1GTG1 1PQYA 2X0EA 1IK6A 4FOLA 3V6MA 4IXTA 2ZUVA 1L9XA 3BRWD 1HDGO 1W5BA 3WR5A 5TPWA 2PJDA 4ZJZA 3BSSA 3DV2A 3LDUA 5F2NA 1N5RA 5A6SB 4KN5A 2MU1A 2WFZA 3ZWOA 4B2IA 2Z30A 1V6SA 4O2BF 1Q5PA 2BMJA 3G49A 4RM2A 3UJ9A 1TUIA 1GN8A 2IELA 3IJEB 4WLEA 4KR9A 1B73A 3EEIA 3G1WA 5LB2A 2HHJA 3NYWA 3RYCA 4NOMA 5J2UB 4TSRA 1CUVA 3IURA 3DTNA 5CURA 4B3IA 2PZGA 4HDSB 3C8ZA 4HQLA 2N42A 2Q1TA 2VZ0A 3KYCA 4PC3A 5E6RA 1N9ZA 1UMDA 4IUDS 1DWOA 1KP9A 2DBZA 3HV2A 3IVGA 3ZY4A 2VQFB 2YQ5A 1K97A 4JYAB 4B7AA 2BW0A 3ODGA 5IDWA 4QPJC 4XXHA 3LCMA 1ACMA 2P1ZA 3D3WA 1WDLA 3A9CA 5DGHA 1ZRMA 3LUPA 3RK1A 3TB4A 5A5FA 5IKEA 4V0MA 3J7AC 2IZ0A 1KIMA 1ADYA 2P8SA 4G8CA 3FFTA 4J03A 5TY0A 1PD1A 1N2SA 1Z28A 1XTBA 2X0RA 2XOKA 5D2CA 3FSGD 3QLUC 3F6BX 3ZJUA 2GPTA 4G0ZA 2ODNA 3TYXA 4DPKA 3AIMA 1JAXA 2J8ZA 2QUZA 2ZYTX 3NEPX 3EODA 4YUXA 1OE0A 5LKAA 5DEIA 3E05A 3DTVA 3FDFA 3TZCA 4DNXA 3QQ5A 4BATA 3CCFA 3EGDB 3HB5X 2RGAA 4IJKA 4AP6A 1ORTA 3OWXA 5IH3A 1GTZA 5KHLB 3K9WA 3QG1A 1EQUA 3TLYA 3U3DA 1L4HA 3MUOA 3O9MA 2GCOB 3HYCA 4RQBA 1MC4A 4CMIA 1NR1A 3TSCA 4ZVOA 4ZZIA 1MB4A 1R3UA 3GBVA 1ZK1A 3JX9A 1JDJA 2VP4A 3NBQA 3DA8A 5KC8A 5JV5A 2QG9A 4C2UA 1YI8A 1PJLA 1DEAA 2JCGA 4LJLA 4D9IA 4JQOA 1HEIA 3WGMA 3GV0A 3UK1A 1P1IA 3ETEA 4GWLA 1VP9A 1ACJA 4FZJA 1Z0SA 1H2FA 2LR0A 1D1QA 4TKVA 2NTJA 3C5WP 1GDHA 4I46A 3V6LA 1F6WA 4KAXA 2HL6A 4P3XA 1XKLA 1WWKA 2XNKA 5HJ2A 3QPCA 1D0IA 5CVTA 2NMVA 1FVOA 2Z1MA 4JUFA 1ZW6A 2XYPA 5FTWA 4CU5A 3UJNA 1D8AA 1ZGJA 4WGFA 4TRNA 4CT4B 3GJ6A 5EHIA 4Z9AA 1RMQA 1ADCA 4FSDA 4PRZA 5AOBA 4DDHA 3WTBA 4EJSC 2A1TR 2B9EA 2FP4B 1QGAA 2Q21A 3EDRA 3I4LA 3IDZA 4RHFA 4HGPA 1WLYA 4WAUA 4BNLA 2IYAA 4W5JA 3L82B 1RAFA 1RQPA 3PVSA 5B3KA 4CTOA 1WV0A 5FNVF 3TMYA 2PMFA 4EECA 3LX6A 4W1QA 2UXCB 1I5EA 3AVVA 1UFVA 5AJZA 3K0AA 3ZWNA 4KKXB 4L8FA 4GPBA 4EKGA 1PSDA 1VMIA 2IP4A 5J3JA 4IXDA 4J1QA 3DE2X 3HCFA 1Z4MA 1QH1B 3JRWA 5FWAA 2QS9A 3T9FA 4BV3A 1F0NA 4LTMA 2VT3A 4MW7A 3N39C 3OMWA 2G3YA 4LF8B 1H3NA 1SCUA 3CBGA 4MUIA 3D2BA 2AK2A 1E1NA 1HTBA 1ONPA 2JJ1D 2VG8A 3LS2A 3RVQA 3T7CA 4A92A 4OXNA 1Z37A 4BIIA 3EXEA 4BFCA 2WMYA 1SOUA 3K20A 1NI4A 2XGOA 3LDGA 1RPNA 7REQA 2IUYA 3OLVA 5F7JA 5A4JA 4PE5B 5EAIA 5GM1A 2JGMA 1QQ7A 3ILYA 4M21A 3RUAA 1QRUA 4LXTA 3HB9A 3MRSA 3U31A 2C1ZA 5IUNC 1V96A 2AYXA 2OD2A 4IV0A 2CKMA 1BU5A 1IBSA 1A2KC 1CZLA 1W5EA 4IVPA 3FUTA 1K3TA 3O75A 1J8FA 1HFKA 4MHOA 1A1VA 2B8NA 3W05A 2BFFA 3U60B 2I3ZA 4PYQA 3W5UA 1QTQA 3FLEA 5GWXA 4CYMA 1WE2A 1ZD9A 2W2PA 2GR9A 1RBYA 1KIFA 2D62A 2IYEA 3EGEA 4OLHA 4AXXA 3VPAA 4NS1A 2GXQA 1JILA 1W25A 1QS0A 2PBFA 3EVGA 4DILA 1U04A 5DYYA 3BXPA 2RK4A 2WK1A 3MWEB 1QK5A 2PZJA 4LF4B 2PSEA 2V59A 4LOIA 1LDNA 4MUBA 4WOJA 3BD9A 4CIDA 2B3TA 3D7RA 3FUUA 5BWMA 1YMVA 3ZGVA 2GN0A 2QXYA 1T1JA 2ZVQX 3EZLA 4CLRB 2C97A 2A92A 5TRTA 1GQSA 2X0DA 1CR4A 3QKRA 2VP2A 3LI2A 4R2LA 3VSEA 3IAUA 3WLAA 2X5OA 1XWFA 4H1WA 4B4OA 1C3XA 2MYNA 1HXHA 1QIEA 1WCWA 2Q4BA 3BQNB 4N4AA 5ALYA 3OBIA 5I9IA 4TQ9A 1VCOA 1CCWA 1IMOA 4MWOA 3MCTA 4M3NA 2CFRA 4R6XA 2PVCA 3RU9A 2YWRA 2YV1A 3WLQA 1DAKA 2C5LA 2B1IA 3F8TA 3H9GA 4B76A 1O94C 2IPXA 1JHYA 1ZR4A 1SURA 4J90A 3GEDA 4INJA 4OSPA 2Q0HA 3RROA 1YZVA 4WI1A 3SJAA 1DSSG 4QNNA 1FLNA 5FI5A 3ZW8A 1H1LB 4I8IA 3GG9A 3LUJA 4L6IA 4Q3LA 4PG4A 5UKDA 1I2DA 3EXFB 1D0VA 3BK7A 5CA0A 4DLTA 2PMCA 2A1TS 4JP1A 1R12A 2IFTA 4RCZA 5ECGC 8LDHA 5JSHA 1IZ0A 5JPIA 3DHWC 4M55A 5CHYA 4X1OA 5E3IA 1LLUA 3IMGA 4GR5A 5JBQA 1JIIA 2G8NA 1FSFA 2VYCA 4C3ZA 6PFKA 1Z4IA 1BE1A 3KOMA 1M2HA 1EIZA 5DNAA 5I5EA 1B0AA 1Q1ZA 3DVAB 1CQIA 1C3JA 1WNTA 2XCOA 3FSGA 3I8XA 3G9TA 4IEEA 3UBMA 4F5EA 6ADHA 1QVRA 4N0PA 4YBRA 3A4YA 2NTVA 2R4TA 2HCFA 4CLRA 1XVLA 2W43A 5G0TA 2AJBA 2NZYA 4ACAA 2O8EB 1XF9A 3DULA 3FI0A 2XZDA 3QMWA 4D1YA 5BPFA 3EVCA 4M9UA 1J9EA 1U8FO 3CE9A 1EA7A 4YONB 1A9XA 5JNUA 4HP8A 5F5LA 1GNQA 1WHTB 1AS3A 1L4GA 1IJFA 1LH0A 2YASA 4K3VA 4JI2B 4B85A 2AS0A 3RYIA 3P4UA 3U3JA 2CJYA 1RQNA 1P2VA 3WMWA 2H59A 2O52A 5CX4A 1HGXA 2P41A 1G38A 2PM8A 5HQJA 3CNQS 2MINA