1NW6A

Structure of the beta class n6-adenine dna methyltransferase rsri bound to sinefungin
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
279
structure length
271
Chain Sequence
GTTRHVYDVCDCLDTLAKLPDDSVQLIICDPPYNIMLADWDDHMDYIGWAKRWLAEAERVLSPTGSIAIFGGLQYQGEAGSGDLISIISHMRQNSKMLLANLIIWNYPNGMSAQRFFANRHEEIAWFAKTKKYFFDLDAVREPYDEETKAAYMKDKRLNPESVEKGRNPTNVWRMSRLNGNSLERVGHPTQKPAAVIERLVRALSHPGSTVLDFFAGSGVTARVAIQEGRNSICTDAAPVFKEYYQKQLTFLQRSYEIVEGAANFGAALQR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION METHYLASE RSRI
publication title Structures of liganded and unliganded RsrI N6-adenine DNA methyltransferase: a distinct orientation for active cofactor binding
pubmed doi rcsb
source organism Rhodobacter sphaeroides
molecule tags Transferase
total genus 91
structure length 271
sequence length 279
ec nomenclature ec 2.1.1.72: Site-specific DNA-methyltransferase (adenine-specific).
pdb deposition date 2003-02-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01555 N6_N4_Mtase DNA methylase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.150 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Vaccinia Virus protein VP39 1nw6A00
4P7FA 4FP9A 2BM8A 2PX8A 4KIFA 1VP9A 3Q7EA 5EMMA 5HEKA 4QQNA 2PXCA 2P3LA 4LECA 2WK1A 3DTNA 2P35A 3G5LA 1BKYA 3LECA 5EHGA 4C08A 3BGDA 3OZTA 4AZTA 5BXYA 2HWKA 3G2MA 3PS9A 5F2KA 3GJYA 5DX8A 2NXEA 4F86A 1P39A 3E8SA 3GRUA 2PT6A 1F3LA 2ZULA 1JSZA 4RTKA 5DSTA 1RJEA 2PT9A 2ZBQA 5FHRA 1M6EX 4MIKA 3FTFA 2PX4A 5GOZA 3NDJA 4E2XA 5C1IA 3G2OA 4AZSA 3DXZA 3MGGA 5EEGA 5HIJA 2Z6QA 2AZTA 3OU2A 5ICGA 3I64A 2BR5A 3LDFA 4JXJA 3HNRA 4X41A 3FPEA 3FUWA 4YUZA 5K05A 2IBTA 1FJXA 3SMQA 4HRAA 4YMGA 5EMJA 4X60A 1HMYA 3RODA 2ZBPA 2YXLA 1QAOA 1KIAA 5KS2A 2Z6AA 5E1MA 1I1NA 3TQSA 4KDRA 5EOVA 2C7PA 2PVCA 1NBHA 3JWJA 4A6DA 3BKXA 2AR0A 2E5WA 5FQNA 9MHTA 1NW7A 1N7JA 4GC9A 2GA9A 2FPOA 5LR6A 5CUQA 4R8RA 4V0RA 1FPQA 1JR4A 1INLA 2NNWB 4R05A 3TM5A 4C06A 2OKCA 2ZZKA 3A4TA 3Q87B 3FPFA 2JHCA 4FSDA 1JG2A 4HGYA 3GXOA 3BWCA 1PRYA 4IV8A 3VSEA 4E2WA 4RTNA 3ANXA 4KVZA 3CKKA 4RTQA 4WXHA 1O9HA 5E9JA 5HIKA 5GM1A 4RYLA 3CCFA 4YUVA 2CWWA 3D2LA 3KPWA 5K0GA 4GOLD 3DULA 3G8BA 1QANA 4KW7A 3NVKI 3KQMA 1EG2A 3V8VA 2FCAA 3UJ7A 4RTPA 2IGTA 5K03A 4GOMD 3M4XA 3MHTA 3EVDA 3X0DA 3P9IA 4HSGA 2HNKA 2AOTA 2ESRA 3C3PA 3SXJA 4E32A 1JTEA 3BKWA 1G8SA 2KW5A 4KRGA 4DMGA 1FBNA 3ER8A 2AOTB 5FADA 3OPNA 2H1RA 5K0NA 1X1DA 2B78A 3OFKA 3T7SA 1WG8A 3K0BA 4MTLA 3SX0A 3UJCA 2YUIA 2ZIFA 3SGLA 2OO3A 2XYRA 3LPMA 3GRRA 4G56A 4HTFB 3EGVA 5CVVA 1UIRA 3P8ZA 4QVKA 5GM2A 4PWYA 4RVHA 3FTDA 2ZCJA 1PJZA 3UZUA 1DCTA 5ERGB 5C0OE 3B7PA 1QZZA 4OBWA 2O05A 1YZ3A 3WSTA 4FR0A 2G72A 3R24A 4ISCA 4QVGA 4E2ZA 1MJFA 2XVAA 3BGIA 3GRYA 3A26A 3G88A 5K0LA 4Z2YA 2GPYA 5DWQA 3KPVA 5GIOE 3PFGA 1G8AA 3CJRA 3EVCA 3OZRA 2AVDA 2PBFA 1XDZA 3KQVA 3EVGA 1DUSA 3HCDA 4M37A 3IHTA 5K0FA 5GWXA 1Z3CA 3FRHA 3EVBA 4C04A 2CL5A 1X19A 2FRXA 5FA5A 5CCXA 5CM2Z 1QAMA 2XVMA 3GU3A 1I9GA 4U7TB 4X63A 3UFBA 4POOA 4PYOA 4QQKA 3UBTA 5DRTA 4GEKA 5HZMA 1XDSA 2YX1A 5KQRA 2LD4A 1U2ZA 2UZ4A 5DSXA 3NMUF 1QAQA 3P2EA 2O07A 5E8JA 4RX1A 2IDJA 3HCEA 3RIEA 2ERCA 2JHPA 1Q0TA 3A27A 5T67A 4YUYA 1NE2A 4OX9Y 1YUBA 4H0NA 4O29A 5DM0A 5K01A 3U81A 4DCGA 4QPNA 1NW8A 3NW9A 3KHKA 2OBFA 1XDUA 5EIWA 4HC4A 2ZFUA 3PVCA 1R8YA 4MWZA 2FK7A 2AOUB 2IP2A 3FTCA 3NWBA 4ER7A 4YV1A 3VC1A 4X1OA 5FA8A 4DZRA 5KVAA 5E2AA 1I4WA 2EJUA 2PXAA 3MCTA 4YV0A 1B42A 5D1NA 5EKXA 2PJDA 4AZVA 5GP1A 1EIZA 4RWZA 3GWZA 3A7DA 3KR2A 2Y1WA 4YMHA 4RTOA 1UFKA 2AOVA 2P7HA 3GGDA 2CMGA 5HILA 1VLMA 2PX2A 2GB4A 3M33A 3ID6C 2FHPA 3G2PA 1FP1D 4GF5A 4RVDA 4U7PB 3UA4A 4ER3A 2C7QA 3LKDA 4RSRA 2JHAA 3AWIA 4WVLA 5KQSA 2Y1XA 5E2BA 4RV9A 1T43A 1SKMA 4CTKA 3P97A 2DULA 1D2HA 2ORED 2YXDA 3JWGA 1XCLA 4PGHA 3CC8A 2ZBRA 4IKPA 2NXCA 2PXXA 4BLWA 2QM3A 1X1AA 4PYQA 4GOOD 2YVLA 5LSAA 3DR5A 4UOEA 2XYVA 1KPIA 3T0IA 4X61A 2OZVA 5DXAA 4NECA 3SR4A 4E70A 3CVOA 5CCBA 2O06A 4M36A 3H2BA 5EVJA 3DP7A 1YZHA 4HGZA 3AJDA 3ELDA 4OQDA 1AQIA 3JWHA 4ER0A 4BY9E 4YUXA 5DTMA 3R9XB 3REOA 3UJ8A 3R0QA 3RW9A 4RTMA 5JR3A 2P3QA 1XCJA 3HCFA 2C7OA 1YB2A 2PX5A 3FUTA 2R3SA 3IYLW 1D2CA 5CVDA 5DTRA 3AXSA 1KYZA 3OCJA 5E1DA 3THRA 3KQSA 5LQUA 3TM4A 3M6VA 2ONYA 3PT9A 3MERA 4PONA 4B17A 5K0EA 3FUUA 1YFLA 4MHTA 5E9QA 3SSOA 2V74B 2PKWA 3OE4A 5T64A 4FT4A 3C0KA 3P71T 3C6KA 3BWMA 4PGGA 2I6GA 1TPYA 5EKUA 4PCLA 4XUDA 5DX0A 5FHQA 3LDGA 2XYQA 3PX2A 4MQ4A 5U4XA 1NW6A 2QE6A 3G8AA 4DQ0A 5GIPE 5P8WA 4AZWA 1VIDA 3ELYA 5MHTA 3CJQA 3DOUA 1WY7A 3OU6A 3PFHA 1H1DA 2CMHA 4IWNA 1NW3A 3O4FA 3LBYA 2VDWA 1JSXA 3EEYA 3NDIA 1R00A 3NVMB 4C07A 3MTIA 4PIMA 4DCMA 1XXLA 2FYTA 2IDKA 1NT2A 1JG3A 3MCZA 3KQTA 5F2NA 2Z6UA 2EX4A 3C6MA 1X1BA 1SUIA 4IV0A 5M5BA 3G89A 3TKYA 2O57A 10MHA 2VZ9A 3O7WA 2VDUE 4EMSA 3IV6A 1D2GA 1DL5A 4RVFA 5HIMA 3FTEA 1L3BA 4P7GA 3VYWA 3DXYA 1G6Q1 3SSMA 2UYCA 5CVJA 2G70A 2G8NA 3P9CA 4ER6A 3OE5A 4FT2A 1KHHA 1L3IA 4RVGA 3EMDA 4KDCA 3DLIA 5EC8A 5EZSA 5K8VA 1AF7A 2ZZNA 3GCZA 3GNLA 1Y8CA 3M70A 5DM2A 5EZQA 1N2XA 3THSA 5LQKA 1RJDA 5FWAA 4RTSA 4PIPA 2ZZMA 4Y30A 2N47A 5DM1A 3VC2A 2BR4A 3GDHA 3FUXA 1WZNA 3UJ6A 1VQ1A 2JJQA 3SVZA 4EKGA 2ZSUA 4HH4A 4Y2HA 2IFTA 5K0JA 2ZWAA 4YV2A 3G5TA 2AOUA 5GINE 2I62A 3CBGA 4P7JA 4PYKA 4XCXA 2EFJA 3KQQA 1SVUA 5FWDA 3E23A 4E30A 2BZGA 2YR0A 4BLUA 2P40A 1QYRA 3FRIA 1RI3A 1EJ0A 2VS1A 4E31A 1ZHFA 4LWPA 1O54A 4KIGA 3FPGA 3O31A 5HOQA 1L9KA 3HCCA 4GOND 2NYUA 3E05A 3FUVA 3TLJA 4CKEA 3A25A 2UYHA 3B3JA 1EQAA 3KPUA 5DX1A 4C03A 1VL5A 1RI2A 3FYCA 3TOSA 4F85A 2V7EA 2AOXA 4FSXA 4XUCA 3HA5A 3EEOA 4PYLA 1KXZA 3BWYA 4LG1A 2HMYB 1XVAA 1RJFA 1ZKDA 2AN4A 3HA7A 2OXTA 5EIFA 5EHIA 2GS9A 3KR1A 1OR8A 3UWPA 4AUKA 2NP6A 2BH2A 3OZSA 1XTPA 1R8XA 2P41A 1EAMA 4ATNA 1JQ3A 2IIPA 2QRVB 2UYOA 3ELUA 3MB5A 3TMAA 3TR6A 3PTAA 2PGXA 4EKIA 3B3FA 3DMFA 1KPGA 3MAGA 3QV2A 2K4MA 3KQPA 2I7CA 1L1EA 4CKBA 2NXJA 2PV0A 1L3CA 1NV8A 2YXEA 5K0BA 4CWAA 1ZQ9A 1WXWA 3BZBA 2F8LA 3KU1A 3QOWA 2ZTHA 4P7KA 7MHTA 3G2QA 3GRVA 3JWIA 3OU7A 3TFWA 2EJTA 3GO4A 4DM3A 2QYOA 3BWBA 3T7RA 3P9KA 1YFJA 3UJ9A 1IM8A 5EMKA 1YF3A 5LQRA 4E33A 4DF3A 2XBMA 1AQJA 3HVHA 2BM9A 5C9ZA 4FZVA 5CVUA 2OB1A 4HG2A 5E9WA 4FS8A 1JTFA 2ZW9A 1O9GA 2WA2A 2JH8A 3EVFA 3V97A 1RJGA 1KP9A 2A14A 4K6MA 5FTWA 4EVIA 4ER5A 5DXJA 2Q41A 3HVJA 5ICFA 5F2OA 2OYRA 4PINA 5LQNA 3HCBA 2O0LA 4OBXA 3UA3A 5DM4A 2JG3A 1M0EA 3AXTA 1AV6A 1WXXA 2P8JA 3LL7A 1ORIA 2OY0A 3EVZA 3NJRA 4FGZA 5EQJB 5ICEA 1V39A 3EVEA 3PLAE 1NV9A 4QTTB 3EMBA 4OQEA 3LSTA 3BT7A 3ME5A 5H02A 4C4AA 4EK9A 5K09A 2IBSA 3KQYA 1NBIA 5IKMA 4OA5A 4BP3A 1RI1A 2GH1A 2IPXA 3HA3A 4KWCA 3BGVA 3EGEA 4M7RA 1R6AA 2B9EA 2PY6A 5CVEA 4CKCA 3OFJA 1MHTA 5LQAA 4A6EA 3FZGA 3LGAA 4XUEA 3EGIA 1NKVA 3LKZA 2I9KA 1WS6A 3KPJA 3ERCA 3EPPA 5G02A 2YTZA 5K0CA 2JH9A 4HTFA 3T7TA 4PYJA 4F84A 5EEHA 2PLWA 2QRVA 4CXMA 5CD1A 3LHDA 1BHJA 3UJBA 2C7RA 1XJ5A 1G55A 3HVIA 4PYMA 4LWOA 2ZIGA 4GQBA 5LQCA 2ZLBA 1P91A 3KQWA 3M6XA 1R74A 1ZGJA 1IY9A 5EGSA 1FP2A 4C05A 4QTUB 3SSNA 3G7UA 1RI5A 2PWPA 4DKJA 2WA1A 3LCUA 3AY0A 3IEIA 2G71A 4RTRA 2IH5A 5FULA 2IH4A 4PCAA 3MQ2A 3ER9A 4GUAA 2NP7A 5E1BA 3PX3A 3FYDA 5B1SA 1TW2A 4EQZA 1JG1A 1F38A 3ELWA 3S68A 3M6WA 2B2CA 4M38A 5LQJA 1EJ6A 1SUSA 2GAFA 3KR9A 4GBED 5IH3A 1VP3A 3HTXA 1NW5A 4GC5A 1X1CA 8MHTA 3I58A 2UYQA 3CJTA 2OPBA 5DRYA 3F4KA 2PWYA 1SQGA 1Q0SA 3KQOA 2HR1A 3P2KA 1KR5A 3B89A 2ZIEA 3E7PA 1KPHA 3I9FA 4CTJA 5KYGA 1JQEA 2ZWVA 3TRKA 2P7IA 3GRZA 3NTVA 5DLYA 3B3GA 4AX8A 2EG5A 2CKDA 3MTEA 3I5UA 1ORHA 1N7IA 3ORHA 5FCDA 3SM3A 4YUWA 2B25A 2P1DA 3P2IA 1R18A 4RTJA 2BR3A 2DPMA 3C3YA 3K6RA 3L8DA 5DPMA 1SG9A 4BLVA 1BC5A 2H11A 1IXKA 3LBFA 3GIWA 2G1PA 4L7VA 3DMHA 3TPZA 5DTQA 5CIYA 5D1HA 5HIIA 4BP1A 1ZG3A 4R6WA 5FQOA 2ZVJA 1M6YA 4V0QA 4QPPA 2QY6A 4RTLA 3BUSA 3LDUA 4QDJA 2OB2A 3HVKA 5E1OA 3KKZA 2AVNA 5E8RA 3FPJA 2FK8A 5EMLA 2AS0A 4P58A 4PYNA 2P3OA 5BP7A 1SQFA 3LCCA 1VPTA 5ICCA 1KYWA 5T6BA 4PYIA 2HTEA 4QDKA 3DLCA 3I53A 1VE3A 5EPEA 1ZGAA 3FPHA 5FUBA 3BXOA 3LCVB 1TW3A 3HM2A 3HCAA 2NXNA 3KPYA 3A7EA 3KR0A 4R8SA 3TKAA 3DMGA 4DA4A 1P1BA 2HV9A 1HNNA 3DH0A 3HP7A 3NWEA 5DT2A 1RI4A 2VP3A 2ONZA 2GLUA 1JG4A 3DXXA 1BOOA 3HEMA 3P9NA 2AN5A 2R6ZA 3PB3A 3R3HA 5BW4A 2IH2A 1UWVA 3B5IA 2YQZA 4E2YA 1JQDA 2AN3A 3DUWA 2VDVE 1P1CA 3R6TA 4OA8A 2B3TA 4R6XA 1VBFA 2AOWA 1G38A 5EG5A 1G60A 3EVAA 3LX6A 3CGGA 3M6UA 3QOXA 4ZTBA 5HFJA 3UJAA 3UJDA 4PNEA 5BW5A 2H00A 5JUWA 2ADMA 2PSSA
chains in the Genus database with same CATH superfamily
4P7FA 1G9TA 1KI6A 1L9XA 5AM4A 4IW3B 4HAZA 2PXCA 2IHNA 1Q19A 3DTNA 2IUSA 5IZ4A 3OICA 2PSJA 2RB5A 3BFXA 3CLSD 4TKZA 4Z2AA 3L0CA 5C80A 4A0RA 2RG7A 4JBXA 3RR2A 1M8JA 5SZKB 2FSGA 4JDPA 4PSCA 1FJGB 4HAXA 2ZBQA 5LB4A 1CDZA 1NUAA 4N3BA 1F4LA 5AW1A 4WDRA 4J0KA 4C0LA 3LE8A 1GTL1 5EN4A 4JB3A 1TU4A 3ZV4A 1WSDA 2IXDA 5B53A 2Z1NA 1VI2A 4DTCA 3NQ41 3RHFA 2DR2A 1TYBE 4LE2A 1AK2A 3IULA 1Y80A 1Y5IA 4GT1A 5DCUA 4BZXA 2GZSA 1WY5A 4MDYA 1O6FA 1V1MB 3NWPA 2O0MA 1HDCA 1P73A 3GGCA 3W8DA 1Q7BA 4ZVMA 5KS2A 1QAOA 3IV9A 1U9ZA 3RSFA 1W5AA 3OBBA 3U3XA 1AXRA 2ZWMA 3S55A 4BUJA 13PKA 2P3SA 5CHYA 1RYHA 4H16A 4P4GA 1JFFA 5BSRA 5K3AA 5J2TF 1NW7A 4V0ME 1YHZA 4RXMA 5LR6A 1ZLYA 3MPUA 2IPNA 1R0YA 2V0NA 1IHOA 2YJTD 3INNA 4YFYA 3HBNA 3S2IA 2VDLB 3TW4A 4C4TA 3FPFA 2JJMA 4FW8A 4MDFA 1T2AA 3C7CB 3T3EA 1BSVA 1HEUA 1SG0A 1U11A 3DYVA 3EA5A 2A1TR 5HGJA 2WJ4A 5JV5A 2EXXA 1CDOA 5A6VA 4M0DA 2XYPA 4TROA 4G37A 3O8QA 4P31A 4PAQA 3GAZA 5A4AA 3DYIA 1FFGA 3CX7A 3SBDA 2OLEA 3GFVA 2Q5IA 2YJNA 4U2KA 1GPMA 2RH8A 4X20A 1V8FA 4YMLA 3QLVA 3HDTA 5IHXA 3C16C 3HACA 2XGJA 4B83A 3L79A 2I03A 3SS9X 3T4UA 3USES 1HG0A 3FWNA 4WXMA 1J1ZA 2LGJA 1IY0A 4N82A 4RULA 1F2DA 1FBNA 3T7SA 3H5NA 4EI7A 1ZD9A 1X1DA 3RRNA 3PENA 1C9MA 2VSFA 4JYPA 4DV1B 1PUIA 1OZGA 4KR6A 2PKXA 2RGXA 2CW5A 3B6JA 1NBAA 3S2UA 2FPWA 1L7XA 1QZUA 3GCGA 2RONA 1NMQA 1BXGB 2ZB4A 1RJ9A 1N5RA 2PMFA 3AX6A 1KI1A 4QAQA 5DW3A 1S2OA 5T3YA 2ZBGA 4YR7A 1ZITA 3NU1A 5JWRA 4E2ZA 1E2QA 3WGHA 4GVPA 2B1IA 1M9NA 1SU7A 4WXRA 1JKJA 3ESDA 4P83A 1W36B 2FR1A 1FB5A 4WEQA 3D0KA 3ROMA 4FQ5A 1IFXA 4EPWA 1H2EA 3OZRA 4B7ZA 3GZ4A 2PH1A 3GUZA 3O1IC 4HK4A 1YB5A 1XBTA 1NNEA 4J7UA 4OLAA 1PJRA 1XYGA 2NU6B 4LA4A 4NL4H 4YO8A 5GY7A 1RD4A 1QAMA 2QP3A 3GU3A 1CWUA 1TD9A 3BK1A 4Q1VA 3UEOA 5HZMA 5EGNA 3O4GA 2FDCA 1CP3A 4CW7A 2Y1GA 3WGQA 1I1QB 4HCJA 4KQ9A 4DSAA 3C6QA 3C3BA 1GZ3A 1I6LA 1X38A 1NULA 1M6VA 2O3SA 2D2VA 2GYUA 3DO8A 4P34A 2FVYA 1N75A 4YGXB 3SVTA 1K3UB 4FFBA 1FDTA 1T3SA 4QPJC 3KVOA 3MYRA 4F6RB 4DR5B 4EYKA 2QG6A 2C9DA 3E2PA 1GCAA 3HZZA 2KLHA 4KB5A 2ETVA 3OD5A 3VR5D 3ZNPA 3DVRX 3CZPA 1YC2A 2B83A 2COUA 3M82A 4FFRA 5ALLA 3TL2A 3IBYA 1UJ5A 3TOZA 2NZ2A 2CNKA 4XYMA 1EIZA 3GWZA 2HPVA 3IDZA 4LF8B 3P9ZA 1DO2A 3HCPA 2XJ9A 3MJEA 1OFVA 4GPAA 4J0JA 2P7HA 1XN1A 1ZH2A 4X62B 1MC8A 1VLMA 1NTOA 1GL3A 2WUEA 1TQDA 3COWA 3ID6C 3OSZA 4DFDA 2VNAA 3BFVA 1BRTA 2YHUA 3FKSD 1WUHS 3SYRA 3LT5A 2CT8A 1OILA 5FLKA 1CHDA 2JGIA 4ZYZA 3GFBA 2M32A 3C1AA 1I36A 1SKMA 2HK7A 4W5RA 1PD1A 2DULA 3HG7A 3WDKA 1JDUA 3I04A 3F6EX 4Q1CA 5F64A 1XRJA 4WESA 3PNBA 4GGOA 3BFKA 2IY7A 4GOOD 4HHEA 3WWYA 3GUYA 2Q1WA 4I1IA 4JT2A 1A9TA 2PJZA 4GM4A 4DMFA 5HR5A 3NHRA 3UH1A 1XTIA 1PG5A 4I9FA 3NZEA 3T0IA 2W0MA 1NVUQ 5LBIA 1OV4A 4LQDA 1PS9A 2I4IA 4MI1A 1NUQA 2O06A 5FPQA 2WWGA 3LPNA 3M9XA 3D1JA 2H54A 2R8EA 4TKMA 1G8KA 2BDUA 2WMYA 4UBOA 4F71A 2F3TA 2BFEA 4J2TA 4BQNA 1YGPA 1UT8A 4M99A 4CCYB 1MPTA 3WIVA 3ZJYA 1SKAA 1GAJA 1WIWA 2Q3BA 4DJTA 2AKEA 1YB2A 3ZE8A 2C99A 1VJCA 3ZLVA 3VZSA 4EHAA 1YFLA 1N3BA 1GA1A 1GXSB 3DA8A 4NRDA 2K7FA 5IAGA 2I1WA 1GFSA 1JAYA 3IPXA 2NYAA 1IIRA 2NUPA 4NOMA 5ELLA 4N7MA 4BKOA 3B6ZA 5FHQA 3LDGA 2P90A 3AFGA 2JFOA 1RVDA 8AT1A 1AH2A 3G8YA 4B3MB 2ZGVA 3DP9A 3BMNB 2Q4OA 1PI3A 3P2OA 2Y77A 4OFZA 4Q7QA 2NU9B 4Y6PA 5I9MA 5BWLA 3O6VA 3THYB 1OSNA 1VJRA 3NKVA 4DW8A 3WB2A 3EEYA 3T54A 2C78A 2D5IA 1TX4B 1CQIB 2RGGA 1IHUA 3SFTA 3SEQA 3AR7A 2VWQA 2ODNA 4K9NA 2FQWA 4HFJA 1ZCBA 1YZYA 4MXDA 3EY9A 3LRTA 4QUDA 1XTVA 4OHWA 3WB1A 1SXHA 1UPCA 1ZQ1A 4NESA 3NB0A 1MAUA 4JJFA 4MHSA 4UU7A 2ZWOA 4DR2B 4DLSA 3L05A 1S7GA 1IVNA 5IN5A 1E7SA 4D45A 3GBVA 5H1YA 4WMLA 3GD5A 4JJ7A 2XOKD 4H7PA 3AZQA 4OMDA 1XEXB 3QYJA 2KX7A 1TF5A 5J1SB 1MRZA 3ORSA 3R3YA 3GFGA 5F5NA 1M7GA 1CSEE 2PA3A 3L7NA 4H7FA 1FW8A 5KTMA 4RTSA 3CPEA 2RC5A 1ULUA 4GP6A 1H6BA 1X6VA 2FR8C 5DM1A 2OGWA 5ILQA 2FQQA 4FZ3A 1OX6A 1Q6YA 2HJHA 4C29A 1M7HA 3F49S 3CVXA 4N6GA 1IZYA 3UJ3X 3VH4A 1GG8A 1WPRA 2UKDA 2WFZA 1XK6A 2IYNA 1JIQA 4IOLA 3EWAA 4PR0A 1YDEA 4BLUA 3RB8A 1VFNA 1VGQA 2B4RO 3SK0A 2HWYA 3L7LA 3PR1A 3SFVA 3RAJA 1JAHA 3OJEA 3P4YA 1JYSA 3U3ZA 3JQAA 3CR3C 4Y7DA 3B3JA 5FOVA 3KPUA 3H3XA 4DCCA 5JO0A 2VYFA 4JB0A 2DPLA 3IAUA 5F9MA 3EEOA 3VHXA 3LF1A 1H69A 4HUQA 1E0DA 3AGQA 2PBRA 1LI5A 5JCZA 2FRVA 2W2NA 3IILA 3SLRA 3OQMA 1SXGA 2O5VA 3H6HA 3VKWA 4EENA 2IIPA 2OSBA 4GNRA 4I50A 3W6UA 3TMAA 4H6WA 4QDUA 3DKKA 2FG6C 3IEXA 4KE7A 4R1LA 1PGOA 2AEJA 1G5PA 2WF7A 2A8YA 5CFNA 2I7CA 4DA6A 3RVPA 1P4GA 3ZNNA 1PNVA 1S6YA 3R8FA 1ZQ9A 3I9V1 1EU1A 4RK4A 4B74A 2UUBB 5HNKA 4E12A 4WKCA 4H1UA 2DC1A 2Q2OA 5BV0A 4MI3A 2YN4A 3MWJA 4I99A 4Y6GB 2IP4A 4POAA 4DV0B 4P0PB 5JO9A 3AILA 1E2LA 4UXIA 4WVFA 1E2JA 2AFHE 2XBMA 4PRKA 1P6XA 3I34X 4XX0A 1AQJA 2P2SA 3HU2A 1WHTB 1NTRA 2WA2A 3DAFA 5LMUB 1ZI6A 3HB4X 3HBMA 2A14A 5TMDA 4EVIA 1QH8A 4Q47A 4RK7A 2GEKA 3NO4A 2OYRA 1DAHA 4MQEA 1RWPA 4RZXA 2A9FA 4JGBA 1EX6A 3NXKA 1ENOA 2CXUA 4YACA 1Y8ZA 3AXTA 3GBSA 1OC4A 5LXTF 1E3JA 1EHIA 5BN1A 1M2HA 1JDSA 3E61A 3EMBA 4PQFA 2ZI6A 3DOEA 3EEIA 4ZU6X 2AMFA 4HNQA 3KT8A 3OCUA 1XZAA 5A4DA 4V3CA 2WE8A 4MUBA 2LBPA 1PWZA 6GPBA 3BTVA 3EGEA 1FEZA 3FCEA 4NZ9A 1NUTA 2HDNB 2QJWA 4ADSG 1KEEB 1UMBB 2OBNA 4R2JA 1FP4B 4DBVO 4MDEA 1RXCA 4F3TA 2YZKA 1PL8A 2VZLA 4JI5B 3V8QA 5C37A 1A5AB 3EPPA 5G02A 3P0RA 4UU1A 3EWNA 1R6XA 1FUUA 1SC6A 3K30A 4CHGA 4JP3A 4EW6A 4F84A 2WZDA 5L4SA 3KVNA 2ZRNA 2Q7DA 2OILA 1MORA 1BHJA 1P1FA 3FM9A 1KK2A 4QT4A 5B4UA 2ZM6B 2P6NA 5AHRA 1NZDA 4ZC1A 4PO1A 3ONWA 4BNNA 5CR9A 2DTXA 1N2ZA 4R7GA 5AOVA 2IXEA 5THXA 3P52A 1JWAB 2FZ4A 1LQTA 2FUCA 2HRQA 3SHOA 2B4YA 4PZDA 1JR3D 5DULA 3U39A 3VR6D 2DTDA 3AHIA 1TB4A 3ER9A 1C1DB 4LVNA 1W46A 4N1AA 1XA3A 5G0VA 3JQQA 1N0WA 4EQZA 5JSZB 3ZUPA 1X2BA 3EFOB 4UUOA 3T34A 5EIEA 4DR3B 2P91A 1SUSA 2IP1A 3AV0B 1N2CE 3Q3JB 4HDQB 4I1RA 4D9JA 4F2WA 4Z1MD 2ILTA 3G0CA 3L7YA 1DT3A 5SY9A 3VZQA 8MHTA 4KE6A 3EEFA 1NXSA 2EFGA 5CH5A 3QEBZ 5C1OA 3NORA 4EZEA 3KZNA 2QMZA 3T7DA 3TG8A 1Q0SA 1MEJA 3KLPX 3KQOA 1B15A 4BLSA 3ZD6A 2WPDD 3GVHA 3GUUA 4QBHA 4ZOAA 1XTRA 3V33A 3I9FA 3ENNA 4HDKA 5AW7A 4IG4A 1H2BA 1K4KA 3BE5A 4KQMA 4OQLA 5EMNA 4YMUA 2C3UA 3B13B 4Z4GA 3MTEA 3QUCA 1T3GA 1MX5A 2O2CA 3C1TA 5PNTA 4BQSA 3HV0A 2Q5OA 3C3JA 1ITZA 1G6OA 2V96A 2VHZA 1H66A 4PPFA 1FXUA 3R5KA 1XTSA 4W82A 1GPKA 1P44A 4ZI7F 3FRJA 2R6DA 2JLUA 2XF8A 3M6MD 4DC0A 2E5FA 3HCRA 1GTSA 4Q0MA 1Y5LA 3BUSA 4Y6RA 4ZYTA 2PVPA 1F60A 4WIAA 4YCJA 2J7KA 3FF1A 3KKZA 4B8WA 3QFFA 1E98A 5D3MB 4IS2A 1L7OA 1XZHA 4ZJUA 5TXGA 1F06A 3CSDA 4TV8F 4ZO7A 3AEQA 5KU1A 3AWDA 2O0KA 5BWNA 5IS2A 3LTNC 2HTEA 2ZSDA 3FOBA 4MGZR 4N12A 3AI2A 1P61B 2GAAA 3DLCA 3KXLA 3CF6R 4ALMA 4DLZA 4ARCA 2JBHA 2I91A 3BWEA 4MINA 5GMOA 3WWZA 3C7AA 3KR0A 1Q7RA 4NYMR 3LGSA 1GQYA 2PFKA 1JSRA 2XD4A 3S2FA 4C0JA 1HETA 1CIJA 1E1RD 2VP3A 1CVLA 3FA2A 4XLLA 3M5PA 3V7UA 4AJJA 1U63A 2DEUA 3S6JA 5EYPA 1JQAA 2FZWA 1QQTA 2VG8A 3HBLA 4I5EA 5L7WA 4M0EA 1QF7A 1MW9X 3NHMA 3QKSA 1U8ZA 3I1FA 2J3IA 2YC2C 3O94A 3T9CA 2HCFA 1IVYA 4XDHA 1G38A 5ECWA 1DIRA 4BC0A 3JQ9C 2XAAA 1FFSA 1DBVO 3LHKA 4AY2A 4MGYR 4BFYA 4FCCA 3TYXA 4HGRA 3O9VA 2NTNA 1HZZC 1V16B 3V6LA 2ADMA 1F12A 1YQUA 4JENA 3PSAA 3KYDA 1USUA 3ZWXA 1BVRA 2PKRA 1NI3A 3BG5A 5E3IA 4QQNA 4DQKA 2XXBA 3R5TA 4W1PA 4AQYB 3TBKA 2NU8B 3VTZA 5EHGA 2D1YA 1AC5A 2CXHA 4B7CA 2EWMA 3R6WA 4TGLA 3OZTA 5JAIA 2X3YA 4N7RA 1U3UA 3JTEA 1CBUA 2Z95A 4OU5A 4QT0A 1RLJA 2QTWB 2JLVA 2B92A 1JEEA 3CH5A 4B9EA 4PX2A 4E21A 4MRMB 4OXRA 3GLIE 2HU5A 1L5QA 3V8EA 3TE7A 3IXMA 1U8UA 1JHXA 1K3TA 1WXIA 2P4QA 4JLPA 4ZT4A 4BNZA 4LRQA 2DSNA 5JW6A 3QBJA 2OQ2A 4L57A 5CM9C 4EITA 4GR5A 1Y63A 4BKRA 1W4LA 5HKOA 1L7EA 5ICGA 3MWYW 1JHQA 3R5XA 5BR8B 4I4TB 4KXFB 1NDHA 4FYJA 4B9AA 3KJXA 4Q3EA 1TT5A 4EVSA 1Q44A 3BXEA 5K3OA 3VKUA 3K70C 2D06A 2IE8A 4PZZA 2YWGA 3OHSX 4NU8X 1KVRA 3S7ZA 2YXLA 3CHYA 3KXDA 5B7GA 4HDKB 1VHJA 4KDRA 2OZKA 1V5FA 4FB4A 5L4LA 2MOKA 2DU8A 4CF4A 1OH7A 3LHSA 1C7JA 1VDMA 2ZYVX 4OAPA 1KXJA 4MVJP 1I32A 3T8YA 2F55A 1CQWA 5IUNC 4TL9A 3T0FA 3MWLA 4PLWA 3KQHA 1RS0A 4HKTA 4BQFA 1EIWA 4OHKA 4X3OA 1RBQA 4MKXA 4R05A 3L6CA 1ADBA 4GM1A 3VMMA 1DHRA 1YACA 1NURA 4JI8B 3VSEA 2JLRA 4M83A 4R0NA 1THTA 1ZN2A 3M4ZA 3IHWA 3PGXA 5FBRB 1FP6A 2C1ZA 3JTMA 3JD3A 5FPYA 4TZ6A 2R1VB 1C30A 1LQ2A 3DW1X 4KYVA 5F9HA 3J7AC 2CXNA 2VWHA 4WLNA 1RZRA 1Q12A 1T2FA 3OLVA 3AUAA 2RHJA 4Q9NA 2Q0HA 1I3KA 1Q20A 2JBAA 3DULA 3IVGA 3NBMA 4IGFA 2G88A 5DN6D 5CB4B 3WYNA 5IMSA 4EZBA 1SCJA 1QC5B 3SEAA 1HFEL 1Y3IA 3ZQUA 1I6WA 1TLFA 2ZCVA 4ZCRA 2OCGA 3IPAA 1LK5A 2V1XA 2QR5A 1NFRA 4E32A 2DHEA 5ALNA 1P2DA 5G4LA 3S28A 1PEKE 2RH9B 4A8TA 3T3DA 4D02A 1NNSA 2XYRA 4DV5B 1ZH4A 4L1KA 1FVFA 5EVCA 2ID8A 3OJLA 3LH5A 5DLPA 3CZAA 1RIIA 3HN2A 4CNQA 1YZ3A 4WEOA 4FN5A 1LGYA 3IQXA 2JVKA 1AA9A 1T5OA 2XKJE 3TAHA 3TN7A 4NK5A 1XDGA 4G2TA 1W4RA 3OT4A 4DNFA 2AFIB 3F6BX 3WJ7A 5G1NA 4KI0A 4Q7EA 3NUZA 4DLUA 3CXUA 1U8FO 2GZHA 1OU0A 1MAAA 5FTJA 4BN5A 3SYKA 2NU8A 1S3GA 3WFIA 3N0WA 1TZCA 1HE4A 1Z0DA 4AB1A 4L51A 3UY4A 5GWXA 1Z3CA 2BKUA 4Y2UA 1PE0A 3PD7A 5FA5A 3EF3A 1V8BA 2GHRA 4NLLA 3E48A 3BMCB 3AKYA 1TUBB 3LTEA 3UICA 1J2YA 2HEIA 4G0PA 2V6IA 3DOFA 4MARA 2W4MA 4AF7A 2C5GA 3WLOA 2OBLA 2XUOA 5JQGA 1CE8B 2ZSJA 1AT1A 2NPIA 2EKLA 3RIEA 3K8YA 4I5IA 1WHTA 1J0EA 2X5NA 1A98A 3CZMA 3EOAI 4R1SA 3TQIA 3VHRA 4D97A 1AMOA 5LNK1 2W42A 3IO5A 4H0NA 3AO0B 2IOFK 3ONDA 4O29A 2PFSA 1MXFA 1S3IA 5IBRA 3RYFA 3VHQA 4KPUB 3NPAA 1NL3A 3TLBA 2RH5A 1UPXA 4ZDWA 4S1VA 3CTMA 4Q6WA 4IIXA 1Q7GA 1CZOA 3OY7A 4CMEA 5EFZA 1F7UA 4TWRA 5H83A 4YPFA 3PHGA 4WJKB 1ZS9A 4RPLA 4DXHA 1T0BA 2C2HA 1T36B 1W1WA 2V65A 2YWDA 1WX1A 4NU6A 1CJCA 5GP1A 3SIPA 4UTPA 4YMHA 2ORWA 1NVMB 3RHZA 1MJGM 3PEVA 4CEJB 3AKEA 2O0JA 2MSWA 3VPHA 1EVZA 2DXIA 3R40A 1SC4A 2F1OA 4HL6A 4PC7A 2ZT7A 4IICA 2H7CA 4PICA 1PWXA 4DG9A 4E5SA 1XE3A 3PXUA 1H05A 3G5AA 2JHAA 4NSNA 1LSSA 5E7JA 1LK7A 4J4TA 4KPEC 4WVLA 5A2GA 2Q49A 4RV9A 1O0BA 3TLEA 1IK6A 2FPXA 1H2FA 1XDBA 1HDIA 4C30A 3JWGA 1GNTA 4D0GA 1XCLA 5DYYA 3AERB 4C3UA 3EJ6A 5JBNA 2XB2A 2JFHA 4CIBA 5J1TB 2PIDA 3UUWA 1HFWA 3IXLA 4ZVKA 3TZBA 3DR5A 3COVA 5KHLB 1OROA 1ZW6A 3A06A 3C14C 5EJFA 5CA1B 3JZDA 5AHKA 1PEDA 1V47A 2CLCX 3C6ZA 4PO9A 3QYAA 1TVKA 5ER9A 3TSWA 4AICA 1P3Y1 2FQYA 1QZTA 2ZUDA 4XYBA 2C4HA 4OQDA 3TMYA 3NV7A 5KCMA 3EGOA 3UJ8A 5JWHA 3CW8X 4DQUA 4IEIA 4EG4A 1J22A 3FB1A 2CV1A 2JLCA 3NM6B 4MLZA 1EZZA 4MR9B 2O2IA 2P2NA 3EFHA 2RHOA 1V5WA 1Z4NA 3JVUA 4XM0A 4EVQA 3NIDB 2YY6A 4XIGS 2UU9B 2ONCA 2JDIA 2WIGA 4R16A 4TXMA 2C20A 2X1VA 1Z68A 2Y66A 3MTQA 1ZJZA 2ZB8A 1IMJA 1XEWY 4BMVA 4C2AA 3DT6A 5KYWB 4EOGA 1DJMA 1H4VB 4ND5A 1L5RA 1UADA 3WLHA 3A8TA 1Z0UA 4AO8A 3T15A 1BVYF 3UXMA 4E94A 2RCYA 3A04A 3A0UA 2MMGA 3AC0A 1E4EA 4LZLA 4OI2A 3WHIA 2NUTB 5EJ9A 1P1IA 1R00A 3BD8A 5IYZB 2OCLA 4CMHA 3ZLBA 3SQNA 4HDRB 1X7ZA 1RZVA 4MPRA 2CHUA 5F2NA 1KDVA 1O6ZA 2XQVA 1T9KA 4AYTA 3C6MA 4OLJA 4AP9A 4ARAA 1DKPA 2K5UA 1FQWA 1YQTA 2BFFB 4A7PA 4CIYA 3ZLJA 3L49A 2QWXA 5DLEA 2NU9A 3E27A 2WM9B 2Q0XA 3GOHA 1DBSA 5G0WA 4C7KA 5ALVA 5KYUB 4MA5A 5EXEA 3U4QB 4B6EA 2JCXA 2GAJA 5JS7A 1VKJA 5DYTA 2OV1A 4HZUA 3WAJA 4I7EA 3SZOA 3U19A 4KDCA 1HXHA 2WYVA 1Y8CA 2NW6A 5DM2A 2RGRA 4UCFA 1BXRA 3ZWNA 4GBJA 4N3CA 4EGJA 5AW4A 1FYFA 2OVBA 3UMMA 2JLXA 4L8YA 1W36C 4Q4JA 4UTZA 2XTAA 3L0BA 1XRNA 5LWHA 3MCVA 3NP7A 1GLNA 4Y30A 1SQ6A 2GYYA 1A96A 1UBOS 2GLTA 3B6EA 3PXGA 2BSAA 4REQB 2QMEA 4JUAA 4DMUB 2ZRGA 1T6YA 1GQSA 4QJ5A 1ACLA 5F4ZA 1U7ZA 1GGJA 3IUSA 2ONJA 2WILA 5JVDA 3KQQA 1I9CA 1CR4A 3BTOA 1YQ9A 3LVFO 1AG9A 2HF8A 3EPJA 4B6JA 1RKUA 3BULA 2TMYA 1EJ0A 5LYYA 4CQMB 3B3QA 1U3WA 4DIKA 3L92A 3NP9A 1OZ0A 3AW8A 3L8MA 3FKJA 3FPGA 4YEDA 1GUAA 1DKMA 1OXMA 1RAHA 4FPXA 1K8QA 3FUVA 1RWKA 4HZUB 3G6KA 3VU1A 4BQQA 1C9KA 4H27A 5BN4A 1U7PA 4F4IA 5LDGA 2V7EA 1OFTA 4GPZA 4HLCA 3C3MA 3EIFA 4RA9A 3DDSA 4AFNA 1YR9A 1N57A 2N46A 3IGFA 2AN4A 1RJFA 4BMSA 5DYGA 3U4AA 4UBLA 2NP6A 1XTPA 1KFEB 4CDGA 3I0NA 1GPYA 5KYXB 1QMPA 2CDNA 2Z43A 1O77A 1JQ3A 3O47A 2OXEA 1F9AA 1NUPA 4Z5XA 5I7WA 4NCXA 2ZJ8A 3PFFA 4FNMA 4KWEA 1L8LA 2F00A 2AI2A 2IHUA 3K35A 4TT3D 3VHXB 2A5GA 4BAZA 5KNBH 1FSFA 4X8HA 2YXEA 1W9MA 4FX2A 3PSHA 4M1WA 3O4HA 2ZB3A 3KU1A 4QFBA 1YXMA 3ENKA 1VDZA 3CPSA 3TRFA 3Q8WA 1E3DA 1T9HA 4UEKA 3TQOA 5JDCA 4G1VA 1LTHR 2HF9A 2XA2A 3W2GA 3O2SB 2I6TA 5HBRA 4IL5A 1W29A 3LPCA 4IO1A 421PA 3RSSA 1ADCA 2CE7A 3QSYA 1KK1A 4CEIB 3AG6A 4B09A 1MU0A 2PR7A 4B3CA 4CJXA 4S1NA 1EI9A 1EM8A 3RH0A 4CCWA 1WLYA 1WE2A 1GGFA 4TN1A 2WAOA 1D09A 3RS3A 1VLZA 5CB0A 2H3EA 5DXJA 1XF1A 2BMDA 3RLFA 1JU4A 1IAQA 1K6JA 1SU4A 4BLOA 1UZMA 4RIEA 1J8VA 1VL8A 5LQNA 1Z26A 3AM4A 1JHUA 2PMCA 2JIPA 1SVOA 1VYTA 3B6KA 3QP9A 2JARA 2QU7A 4J7CA 4OIFA 3TAUA 2VPIA 1ZMRA 1GKYA 4WZBE 5EQJB 2OY0A 5LKRA 3A32A 2FFQA 3OFSA 1WHSB 3QNUA 3G2NA 4R2WA 5FPPA 4Z49A 1O6GA 1D7AA 1D6NA 2X6QA 3JQ9A 1FUKA 1HK7A 1GNVA 1CRPA 1PG0A 5JQGF 4LXGA 2OV4A 4WGGA 5DXFA 4DABA 4QUGA 1MHTA 2QG9A 4XE5A 2JVJA 2TRSB 3DCYA 4RMNA 4WKGA 1PFKA 4LFCB 4HH1A 5JY6A 3DZKA 2Y0BA 2W9XA 1C8VB 3ERCA 3KPJA 4HLNA 3E3LA 4U2GA 1ACMA 4XPIA 3FOEC 3IALA 2EFHB 1THMA 1WXEA 1M5TA 1H1LA 3G7NA 4YRLA 5EEHA 3OBIA 1MIOA 2GSDA 3QVSA 4N6OA 1BS9A 3CRVA 3AEKB 2R1UA 1G55A 2Y4NA 3K4QA 4IUBS 3BX1A 2PQ0A 3IBGA 4QJBA 4Y1GA 4FK8A 4NXNB 1N1GA 1C0LA 2YN0A 2ZLBA 3U3JA 1P91A 4R81A 3HDVA 5JC1A 1RQNA 4K2HA 2J5XA 1ESNA 4C05A 4EJSC 4P35A 1RR6A 2LV8A 3SSNA 3E9EA 3QPWA 5BN4B 4EJSB 4NMWA 3MINA 1Z34A 2ZR0A 5BURA 1GKLA 4N3GA 1QQ7A 3GW8A 1RM0A 3U16A 4OLBA 4K9QA 3P27A 3QIAA 4NBNA 2VLIA 4L16A 1P2VA 1T0PA 1WNTA 1Y6RA 4I4LA 2JI6A 4H59A 2H63A 5AVKA 2YV1A 1DRUA 2FJUA 3CNOA 4OHXA 3WLMA 1M2FA 4JI3B 1O95A 1IEWA 4A6XA 1YA4A 2VXOA 4K86A 4BO5A 5CA1A 1K86A 5SZJA 1ONNA 4N01A 3WS7A 1VLLA 2W6NA 4RAOA 3I58A 1GNPA 2VHYA 1S96A 1U02A 1JA9A 2JCGA 1LRKA 2G36A 1FDSA 3MEQA 4MIEA 4AS3A 3AEXA 2OFWA 1L4NA 3UT5A 4BUZA 3OP4A 621PA 2JFVA 3KJQA 4HUJA 2E4UA 1IWOA 3M5CA 4R68A 2VUHB 4KGDA 3U2QA 2V6JA 4AXBA 1VYVA 1NA5A 2Q21A 1T9DA 1ZAKA 4IHJB 4WN9B 5NLLA 1QUEA 2CHEA 2RI0A 4NJEB 2H2HA 2EG5A 2G0NA 2R7MA 2Q5CA 4A8JC 3K6SA 1SVLA 1KEUA 3K2BA 4RD1A 2PGOA 4CMEC 1YGYA 3A1EA 2ZUEA 1U0HC 1BWSA 4U0KA 2OAQ1 4N03A 1OBCA 4URHA 2ACVA 4ZJZA 1G8MA 4BO9A 4QOHA 4QGBA 5E4JA 3SEFA 3QUQA 4JU9A 4H2DA 4JFAA 2I0FA 4RXTA 3AY7A 2VRCD 1U3DA 2ZVJA 5I5GA 1NN3A 4QL3A 2G17A 3ND8A 4AROA 4M21A 1A77A 2RIPA 4BMOB 1QRRA 1CRZA 5B2FA 4MJLA 5BQFA 4G5GA 2ZYWX 3C6XA 1EGQA 821PA 5AVXA 2GN2A 4QNRA 3I61A 2GPSA 2I29A 1EUQA 1E3SA 2QVLA 2UYGA 5DDIP 1E4EB 1Y4SA 1ZUD1 2D62A 3IUQA 3WGJA 4TVSA 1U2EA 4PYIA 5CH8A 4B3XA 2Q3DA 5L53A 1Z45A 3WA7A 3OC0A 2TS1A 3BXOA 3EISA 1CDDA 3RVMA 4ZANA 3IHKA 4PY2A 2GUWA 1JFRA 1HNNA 5IXYA 2Y27A 1Z5UA 4OYLA 5ENZA 2F1RA 3R3HA 4MS3A 4XRGA 2R6ZA 2P5YA 1CQJA 5BMOA 1N2JA 4KLZA 1S8NA 1MNAA 3ZHSA 2VDVE 4FONA 2QXTA 4G85A 4UASA 1IXYA 5K6AC 1FDIA 1NF9A 3VYTB 3B82A 4BXOB 1W30A 5CW1A 3GEEA 5JNWA 1M2NA 4IILA 1MX9A 2H00A 3V42A 3R44A 2PS0A 2J7PD 2VDPB 3I2KA 4HSEA 1F8GA 1M1XB 1H6AA 2V5AA 4D9KA 3I4FA 4B3BA 1Y82A 4G3XA 2IYOA 2WK1A 2I78A 3LECA 4ND4A 1X9HA 1WL8A 2GLXA 2HLDD 4H15A 1ISIA 1QG0A 2O1EA 4WECA 3V4ZA 4W9MC 1KJWA 5F2KA 2OMKA 3NCHA 4A92A 2W2TA 4JNCA 1PJAA 5JHHB 4RS4A 3AONB 1YIOA 2HX1A 2I3BA 5AW6A 3T7EA 2ZULA 3BB4A 2C59A 5FOUA 3R8XA 3HXOA 3ZGZA 3MGKA 1DFIA 4A2CA 4F5DA 2DWCA 3NS7A 3SFZA 1PTJA 1T13A 3ZPXA 1U80A 2AWOA 4MVJM 1AXGA 2W5UA 1CZKA 1OBOA 3KEGA 2CCKA 4CIWA 5HGXA 4AZ3B 2P9FA 4FBMA 2YWHA 1E9FA 4MRMA 3FFWA 4AW9A 1UT6A 2Q5EA 3D7NA 4FKBA 2CD7A 3OCXA 2BUBA 5SY4A 2VHVA 1XLWA 2O8DB 2WYUA 5DMXA 1FFBA 3DBRB 3HCNA 5IDWA 4NENA 3OG9A 2IYWA 3DV0A 3V48A 2F8TA 3LCMA 1T36A 4A5SA 2XBUA 3NYWA 3DJYA 5HJ7A 1QMGA 3JZIA 1QHHA 2C7PA 4MCIA 3T3HA 4MJXA 4AJKA 3ACCA 5D6OA 1M8FA 2JIZA 2XWPA 4TMZA 3KYDB 2ZRAA 1K88A 3LM8A 4A8PA 2SHKA 2C5SA 4MV4A 3DXFA 4GC9A 4QGHA 3RFFA 1PDOA 1P8JA 3DEHA 3OIWA 2O6HA 3O8QB 4BNFA 2P0YA 2BW0A 4V0RA 3TM5A 1T9GS 3DZFA 4K28A 2ZJFA 5C8DA 5AI4A 1DAGA 3A4TA 5ALWA 3ZD7A 1CJVC 1Z5ZA 2FFBA 2HV8A 3EZ2A 2CV2A 2XMQA 4C2BA 4KVZA 4YRGA 1NNLA 2QRNA 5FAKA 2GD1O 3FDFA 1NVBA 1Y9DA 2V4UA 2WMOB 2YZNA 3D6FA 2H1CA 2RE8A 4U8HA 3LIIA 5LM3A 3VU3A 5DZSA 1KVQA 2OFOA 1G66A 4RPIA 3RSHA 3KPWA 5AYVA 1EGMB 3U17A 1NC1A 4ENQA 1OOEA 2NMVA 2WHPB 5A06A 2PL5A 4IZ6A 5LA6B 2ZETA 2RHWA 3CZCA 2G04A 3SF0A 2IYXA 2QD2A 2UXCB 5K2MA 1FU4A 2JJ1D 4RCZA 4A16A 2B7BA 5K03A 4DDMA 5CK4A 1SBQA 5DEOA 1SHJA 3R7BA 3DAHA 3CM0A 2VYVD 1QLJA 4B2LA 1DC8A 4KRGA 1ULHA 3TCXB 2IF0A 1V25A 3EJWA 1U5CA 1NQTA 4YDHB 1KYYA 2ZIFA 4LZZA 4MO2A 4U63A 4BV3A 4QD3A 3UJHA 3TCNA 3CPJB 2RD2A 4PWYA 2AG8A 3ANSA 4HRVA 1CP2A 4F8EA 4OBWA 2JLSA 2OQRA 3IHLA 1T1GA 3R24A 5KYNA 7ABPA 3TIFA 1W94A 2N1MA 1DHTA 3G88A 4ROTA 2MU1A 3KKQA 3DEYX 4J07A 1ZM4A 2R6HA 3KPVA 1T9GR 1U65A 3HJRA 1L7DA 3SYMA 3JQBA 1XDZA 3KB2A 3S70A 4WBNB 3L43A 5J23A 4OQ4A 1RU3A 2L19A 3OA2A 3RFVA 1QDLB 2A9QA 1MCZA 4YRQA 3BXFA 3FGOA 5IZCA 1V5EA 3W9SA 2OYCA 4HDSA 1QFZA 1XDDA 1PR1A 2YIDA 2X40A 1C0KA 3TS1A 4HDNA 3L4JA 1H2WA 2OD9A 1U81A 3GJ6A 4JV5B 1EFRA 2YWJA 4LF7B 5IT4A 4KLRA 4E51A 1BMTA 1U2DA 3HP1A 1WP9A 3MTBA 1JLSA 2PL1A 3LY8A 1UWKA 3LLUA 4ROSA 5L3ZA 4E7OA 3PWKA 5BNWA 1SOVA 2FU5C 5K01A 2WHEA 4RHYA 3GRAA 5FTKA 1V2HE 5C8VA 1UKVY 3TVTA 2R7LA 5JXWA 3K9LA 4Q18A 4M89A 4S2EA 5JXGA 5SZIA 5MGBA 3FBWA 3SYNA 3ILHA 4U9IS 2IEIA 2C0QA 1ECCA 5KVAA 3G0BA 4HQNA 4XEUA 4DNXA 1Z4JA 4ZAFA 4DIBA 5KNCH 1DOHA 1V1JA 3DFFA 4ZO6A 1L1RA 2V58A 1TM5E 1TT5B 1X87A 4CU2A 1F48A 3BRWA 4O08A 2JI4A 5KO2A 2HRCA 1LBEA 2DLDA 3Q9UA 4NNJA 2QMOA 1GGMA 3OX2A 3WMGA 1C2YA 4L5BA 1K89A 4TWBA 5J4YA 2BGGA 1SA0A 3H5VA 1G20E 4UHEA 4LJRA 4N41A 5K4HA 2G06A 6REQA 2MYPA 2UUPA 4HY3A 4AJNA 3THWB 3OAAD 1MO3A 3PNVA 1QPZA 1RAGA 5FLYA 1U6IA 2V5UA 5E2BA 4MWBA 4D4GA 3RS9A 3P19A 3P97A 1KDOA 3SM9A 4FCWA 1DO8A 2ORED 1JE0A 4HNTA 2YZMA 2EG9A 2ZBRA 3GPDG 3CNNA 2PXXA 9LDBA 2C04A 2QM3A 4TL7A 3CF4A 2D8MA 1GU7A 4INAA 3UK1A 5HTOA 4JXXA 4DMRA 1JKMA 1Y3AA 3FCSB 3JR3A 3IOMA 3CNQS 4CG3A 5PGMA 2D6FA 1VOTA 2XB6A 4Z1MA 3CB4A 3ZGYA 2ZRMA 1A7UA 4U5XA 1G5HA 1E96A 1XZLA 1AY0A 1IXSB 1AF4A 2AG1A 1AUOA 2B99A 2HIMA 2Y9PB 1V16A 1P72A 3GP3A 1ZHHA 3H4IA 4NJMA 4TUYF 3SC6A 3OEHD 3K1ZA 4CR7A 1Y42X 2AFHB 1FRQA 4P53A 2NVUB 2YASA 3QVTA 4NDAA 5BOSB 1IBLB 1KAHA 3AUTA 1IUKA 3QZUA 4QLOA 2IZ6A 2QL5A 3M6AA 4F4HA 1O2DA 1UBJS 2J3DA 2H4YA 3WB9A 1RKBA 1DO0A 2FXIA 4QEZA 2WAXA 4TTTS 2V74B 3N3BC 5T64A 5KHOC 4FT4A 2Z3WA 1QBKC 5I9SA 5AJWA 3FDXA 3QBTA 4MUJA 3H4MA 1YVDA 9ATCA 5HKBA 4MQFA 3JATA 1M1NB 1PKXA 2VKQA 4X7PA 3IOEA 3AFOA 5E95A 2R97A 3QELA 2XD9A 1BJKA 1KAMA 4CM4B 5I4KA 3PDWA 1Z7GA 4EHHA 1CVIA 1US8A 2I6UA 3FKQA 4K3VA 5AK6A 5AVRA 4NEQA 5KTKA 3MRXA 5JAOA 3LBYA 1XK7A 1JHOA 4AJIA 4V1CA 2GF9A 1BHO1 4PIMA 2XAUA 4BE4A 3DUFA 1RHJA 4PR3A 2I76A 4OATA 3WQSB 1E3MA 4EFMA 1ZDMA 5DBGA 2ZQZA 1E3LA 1J1UA 2P2DA 3G89A 3TXYA 2VZ9A 2IOHA 1B6TA 2VDUE 3ELBA 3NPMA 4MGEA 5BUQA 5I6DA 5EUQB 3VR3A 1FXWF 4KO8A 5HIMA 1E9AA 2J41A 4GE0A 4LZWA 5TSDA 3T9AA 4C3OB 1HRKA 3A1TA 1XQWA 4M87A 1DEKA 3UUGA 1QS0A 4FR2A 1PNTA 3DFIA 4ESOA 3IT1A 1Y8RA 2QRJA 3W3AA 4DIUA 1KQFA 4OSEA 1MX3A 3DPUA 3H97A 5ITWA 1I2DA 1TCVA 3IXQA 2VT7A 5IM4F 5H9VA 3KVVA 1EK2A 1X7YB 2GJAA 3HWSA 4G67A 2ZZMA 2FMIA 5EHNA 2IU3A 2N47A 3CMMA 3K9CA 3UGKA 5I7EA 5BSTA 4KP7A 2PZLA 1U0JA 2JC3A 3SVZA 3NHKA 1XRLA 4QECA 1W48A 4JJ8A 3FVVA 3M3PA 5IKEA 4DBZA 1T10A 3NWOA 4HI0E 2G4VA 4PHCA 1KP2A 1VRVA 1XP5A 2H7YA 5EE1A 1CX9B 1Q6ZA 1SVSA 3HKCA 3U4GA 5ESDA 4L27A 3BTUA 1GZHB 5IT5A 2R8OA 5ELXA 1OFUA 2P2GA 4R7ZA 5J63A 1J70A 2QMQA 3A6KA 3SKVA 2JZOA 1P9LA 1TM7E 1W88A 4QU5A 4RF2A 5AK3A 5DNVA 5GONA 3RHTA 3ZHXA 2D3WA 2OFFA 4XVCA 3WP0A 3O31A 4F92B 2XA1A 4Q3DA 4ETWA 1UAGA 2J4FA 3CIOA 3HCCA 3VTFA 1L4BA 3TLJA 3RUFA 3QHPA 4P0TA 3H8VA 2HI0A 3T9BA 2EU8A 3FYCA 3I3SR 4KE8A 2Z9BA 3D0OA 4KUGA 4ZOLA 5BNTA 2FEXA 2XQGA 3QIVA 1J97A 2AK3A 3R3XA 2PZMA 3IPRA 4QBGB 3TTYA 1RYYA 2JGFA 4S12A 5JY1A 4PX5A 4YAJA 2OLKA 3ZJUA 3A36A 2H18A 3Q3EA 1RPZA 1YC5A 2R86A 3OQPA 2WNIA 4HNAB 5JBQA 4BGVA 2J07A 5EWJB 4EFLA 2WPNA 4AY4A 1QE0A 1B0AA 1XHLA 1QRAA 4YA6A 4FWIB 1CQIA 3FWPA 1CB7A 2XMBA 1R9MA 5TY0A 3UN1A 3WKDA 1KZ9A 1RRKA 4BWYA 4ETIA 2VK1A 4CKBA 1KO8A 2XLCA 4X7BA 4UM8B 3VI4B 3UGJA 1MO5A 5DNYB 1JKIA 2OTCA 2JGAA 3AL3A 4R98A 3I28A 2P69A 2V8BA 2ZAMA 5I8WA 4Y0NA 4C7MA 2XGMA 3FIJA 3HY4A 3FI0A 3P7MA 2B0JA 3IP6A 3RARA 4KOAA 4LDPA 5IK2D 4PZLA 3GGOA 2RK3A 5EMKA 4C4RA 3N2YA 4ZT5A 2HU8A 3PV0A 2DY0A 3UYLA 2SECE 5BNIA 1AGXA 3GFSA 1I3MA 3O4VA 3RD5A 3FIUA 3KK0A 4PG7A 2ROQA 3WLRA 4W6QA 2O5CA 4LI0A 3PNYA 4GSLA 2PUFA 4TTAA 4Y2YA 2BFCB 5HMLA 5TLSA 3MMPA 1MP0A 3TI9A 5LDHA 4ZTUB 2C5FA 1PJBA 2JZNA 3AVPA 4MWSA 4RJIA 2BFEB 2BI7A 1QH8B 1X8XA 2UAGA 3FAKA 5HZHA 3V7WA 4ZARA 3HA2A 4O02B 2MINB 1AHIA 2PPVA 2YNMA 4XFKA 2HA3A 1BVUA 1YI0A 1EP2B 2I7VA 2VTBB 2VEOA 4OHCA 3BT7A 5I9BA 1F20A 2R4QA 3LAWA 3RLIA 3KB8A 4C4AA 4EK9A 1FNNA 4IEEA 1ZPDA 1RI1A 4KWCA 4RY8A 1GTG1 2GEUA 2H9AA 2W2LA 1XKLA 2GCEA 3AKCA 2V5VA 3HZHA 3EEQA 4I4IA 3DD1A 3QXSA 3DGFC 3SDSA 2XTJA 4CKCA 3LGAA 5LQAA 4BU0A 1K2VN 1WEKA 2GRJA 1WP4A 2QVXX 2H5JA 2X0JA 3P2YA 5J58A 3V1LA 1W88B 4PQYA 5GONB 2EGUA 1H2HA 2NUAA 1LH0A 3TZCA 2JH9A 2LW7A 1P4AA 3LWZA 3O73A 3IRVA 1J33A 1M33A 4QPDA 3QLJA 1WXHA 1NF2A 5HDQA 3RS2A 2C7GA 4PXSA 3KZXA 1NQVA 5EHZA 3OWXA 3IUNA 3L6RA 2M6SA 5D86A 2C7RA 4OY3A 3EIUA 4ASUA 3AYZB 4ZICA 1JU3A 4ABTA 1DXHA 3LQRA 3N2EA 5E4YA 2PBZA 1KF0A 1J49A 2H06A 2UVDA 1DX4A 3KQWA 3M6XA 1JS1X 3R4VA 1J0AA 4WHMA 2AXPA 2Q4BA 3BE8A 2E85A 2ZSEA 5GAJA 4CDNA 4LRUA 4WRRA 1ONBA 3E03A 2PWPA 4DKJA 4F91B 1CUHA 3LK7A 4OJYA 1H8HD 3P2MA 2KB0A 3RC7A 2PLNA 4AF6A 4W1QA 3ADDA 3MQ2A 1XRQA 3T9DA 2VDKB 1KC1A 7YASA 3VVBA 2XNDD 3SZUA 3FHTA 1TW2A 3CWZA 2FPGA 1FW6A 3RIHA 4UPDA 3A6ZA 3ES9A 4NBUA 2EW1A 2QQ0A 2I7DA 3O1JC 2AH5A 1OHHA 2H3HA 3FR8A 1KYIA 3B1JA 3ONEA 1V7CA 4BB9A 3DWGA 4BUCA 5EESA 2XH8A 1ORWA 4HFNA 5IM4A 1ZN9A 4K05A 5A7GA 3A2KA 1T34A 1W96A 3PXDA 1V3UA 4RU1A 2VQFB 2C4VA 2DJ5A 3D1VA 2D54A 1DCFA 4M8IA 2CKDA 4LF5B 1EESA 4LOLA 4TWAA 4K6KA 3CW9A 5IH7A 2W8BB 3ZDCA 1JIVA 2GZRA 1A9YA 1RXSA 2IEZA 2WP8J 1QGOA 2DH6A 3GIWA 3KKNA 3DDHA 3NBKA 4G8BA 5CXQA 3LHIA 4XDZA 4JJ4A 4DMKA 2NZXA 4MKRA 3O7MA 3VSCA 1HDRA 4P3KA 1ZGGA 2BFBB 2C2ZA 2YMQA 2ZI3A 5TX7A 3R4CA 1YRAA 1AGYA 2C9CA 4KSYA 4QPPA 3VNUA 2CZCA 2QY6A 1SXJE 1BXGA 3SHQA 2OLJA 3QKRB 2ATEA 1FX1A 5F1OA 5FNVF 3O8LA 2P11A 3GFOA 2WSLA 3K09A 4M0FA 4YJGA 4Z4IA 2V7QD 4YJDA 3O82A 5ES4B 3ECCA 2R0QC 5TMEA 1W49A 4PG5A 3N74A 4CF6A 4TYWA 3N7TA 3ZNQA 5DM60 3CLVA 1GAQA 1PJLA 4ABYA 3L06A 1E77A 1GFIA 1QRTA 3A7EA 1RPAA 1BN7A 2YVAA 1XNHA 3JV7A 4NG4A 4R8SA 4RD6A 4CLXA 4XQGA 3JVEA 3U0BA 4OH7A 4KPYA 2WWRA 2GBGA 4H35A 5AO9A 3NLLA 1JDNA 1JG4A 3DXXA 4ONEA 3LF2A 5BW4A 5LWQA 1UOPA 1RWWA 2YQZA 3O9MA 5FBLB 2AN3A 4YHBA 4DYHA 3GG2A 6AT1A 4FMDB 4PZUA 3VXKA 2IYSA 3UPTA 4ZTZB 3RGGA 2DERA 3AVTA 1SVNA 4O1IA 2DQ4A 4M1EA 3HDGA 1Q95A 5ALDA 4KNVA 3C24A 1SXJA 4MW2A 4PNEA 1PGJA 2DBVO 4ZDIA 4IQ8A 4P32A 4EPXA 4XWWA 2VEDA 1DDGA 1U28A 5E7MA 4KIFA 4RH0A 3K9WA 1DQRA 5ECDA 4C0WA 1U7HA 4BNJA 4PLVA 3HHPA 5AUOB 4BGDA 4NP6A 3PHBE 5ALMA 4LGYA 1OYOA 4B7XA 3MMSA 4EPTA 3TGPA 5IT0A 1BXKA 1PT9A 1HL7A 2WT9A 4RYDA 3VR6H 3QXXA 1HTTA 1MOPA 2GNOA 2CDRA 2VTDA 5G41A 3UO8B 3CNBA 3BSFA 5CYPA 2JANA 4D1YA 1TM2A 4AKEA 2CC2A 2OGZA 5DSTA 1Y81A 5H3CA 5JJKA 3EA0A 5E0OA 2MDTA 2EJBA 2H29A 4ZVNA 1N2OA 2PX4A 4Q9JA 4DMLA 2XCTB 3OPYI 4B4DA 1VHWA 5HG0A 2HW8A 2JK1A 1WZ2A 1YR2A 1ID1A 2AC2A 5DGXA 5CEEA 3GARA 2B1QA 5JAQA 4Q21A 4B6SA 3RBZA 1CUJA 4AUEA 3LFUA 4G8DA 3HY6A 3E9QA 3GC6A 3A9WA 4WZ6A 4H3SA 4XA8A 3B8EA 1Y1TA 5JIBA 3IR5A 5TGZA 1KJZA 2EX0A 1WB5A 3OUUA 3LX4A 5HUHA 4HDSB 3OQ6A 1C3JA 4A6DA 3ABIA 1ADJA 1Q0PA 1R0SA 2BHSA 4OOEA 5IJZA 1P6UA 1FUEA 1MVNA 4YUAA 2YMLA 3R23A 4YK7A 5IG2A 3UFXB 3TZHA 3TZLA 3Q3GE 4EQ6A 3T4EA 1HUQA 3COPA 1KI3A 1FPQA 4E11A 1R3DA 3GI1A 1DC5A 4D3XA 5CT6A 2XT6A 4IQ0A 1LU9A 4PZ9A 2A1UA 2XVYA 4BZZA 4FW9A 3EZ7A 1BU5A 1JG6A 3ANXA 3TZQA 4DANA 4H1WA 4C14A 1Z0FA 1J09A 1NWHA 4H1HA 5I9NA 3DKPA 1LLQA 3RFTA 1XTJA 3H8WA 3UKOA 2C7BA 3OZIA 4EDFA 3BJRA 2RC6A 3I6BA 3PR3A 3R5SA 3A1CA 1DKUA 5CBPB 2WZQA 3KKLA 3U4MA 5L51A 3WGUA 3GP8A 2OZEA 1FP7A 3DCJA 1ZA1A 3KQMA 3I3OA 3R74A 5M3BA 3C1UA 5J2TB 1X7DA 1K6MA 1RC8A 2G09A 4RESA 4BLTA 3WZMA 1K08A 3HYSA 4XVUA 1TYCA 3V8MA 3P20A 4QXRA 4BZWA 4OCZA 1MFZA 2A78A 1RRMA 3C3PA 3I2IA 4JXKA 3ZIDA 2G7MC 4CM3A 3RFCA 4GO1A 3KLMX 3OZGA 4REOA 1U0SY 1JA0A 1UEJA 3K0BA 4G5FA 4MTLA 5GJWC 3WK7A 3ZIAD 3A9CA 1RQ7A 5DO9A 1JKJB 3VPXA 2N75A 5CVVA 2CMKA 1ZJ4A 1DB3A 2GD0A 3IR6A 3VX3A 4FUTA 1FFXA 1DCTA 1UK8A 5C0OE 4YJ3B 2IK8A 4C20A 3JQPA 1RJ9B 3JAMA 4H7DA 5KNCD 1G3RA 3BCRA 3IDQA 4NS1A 4PFSA 4GI5A 2Y0CA 1FX0B 1YRHA 1BEEA 1YULA 3ZU4A 4BWVA 2IS4A 1ZN7A 1I1OA 3EIOA 4KN5A 2ZT5A 4F45A 4TZ0A 4LHEA 1ILEA 2IPMA 4UNPA 2BPOA 5KCZA 1XROA 5CBKA 4JH0A 2IYLD 3EE6A 2QYHA 3KVYA 1NRXA 2NTJA 3W7AA 1JDZA 1QFXA 1T3HA 4JLUA 1BW9A 4GXNA 1MQ9A 2VNSA 3BILA 3QXHA 5I7HA 2P6PA 3E9ZA 2ZJZA 4PYOA 2J0SA 3R20A 1YR8A 2WJIA 1RZUA 3SX2A 2LD4A 3OJFA 1O9BA 1N6RA 3HLYA 4OJQA 3HNOA 4QUJA 3C3EA 3E22B 1E7QA 2IHVA 5JROA 1MO4A 1WKVA 4YDQA 1RC0A 3VOTA 1H65A 1YE8A 5BYAA 1E5TA 2V03A 4JDUA 4NBTA 2ZPAA 4OF4A 1V5GA 4OX9Y 4CMIB 1HNZB 5KDOA 2IXAA 2FDXA 2TYSB 3DC2A 5FNVA 3GLGB 3NW9A 3LO5A 4DV2B 1SUAA 2X13A 4K03A 2BFMA 1AIPA 2ZFUA 1GGEA 4N5HX 1E7YA 4F21A 4ZYLA 5KKCA 2EBFX 4D8VA 3KWFA 1E0SA 1Y1KE 3NWBA 4IRXA 3JALA 2H2AA 3JWEA 2FPIB 5G40A 2WWWA 3IB3A 3ZBTA 3T99A 3GEPA 4ERXA 4YV0A 2QORA 4YCAA 3FMVA 2ZTSA 1W0JD 1WPGA 1UH5A 2P5TB 2R65A 3A7DA 1M1YA 4WLOA 4YAEA 5A04A 1DG3A 3NBAA 3BE4A 1H4SA 4MVJE 4GHWA 2FPPA 4NE9A 3FNEA 5TQ0B 5DNCA 2ZSIA 5AXAA 2FOIA 3GGDA 4RVDA 2FWMX 5K5EA 2IRWA 4G5YA 3WLIA 3U48A 1OW3B 2FI1A 4LBWA 3M83A 1J5EB 3W6ZA 4BLVA 3ZH2A 3HJAA 4CTKA 4FFDA 1ZEMA 1A9SA 4C6HA 2PNJA 1DAOA 4MR7A 3KSAC 4GEGA 3ZCSA 3THYA 1XV5A 2WU1A 1VJ0A 2IYPA 4RPHA 4AMYA 2W6OA 2EEPA 3KXIA 2V8OA 4W8HA 1P9OA 3J81A 2QZZA 4D9MA 4CM5A 1SELA 3EPLA 1T5TA 4IDAA 5H59A 1A9XA 3PD0A 2KPOA 1YCHA 4L78A 5L3VA 4L8LA 2GX6A 2VJKA 3A2LA 4BNTA 1U90A 1DCMA 4ZEWA 1ORRA 3SQMA 2D0PB 2O2HA 1CLUA 3G9XA 2ORIA 3OUZA 3E35A 1TUGA 3LC2O 3OFVA 2C7OA 3IAXA 3DFUA 3ENQA 4OHUA 3RYHB 1E8NA 3THRA 5C81A 1PZHA 2PT5A 2PUAA 3CLHA 2ZM5A 3BDIA 3PXAA 3JQCA 4L4YA 5EP4A 3HO1A 5JSQA 1MRNA 1VSUA 2B8WA 3C8DA 3T41A 4DA0A 4IX9A 1E2IA 2A5YB 3EFBA 3PGMA 1QO0D 1HLDA 1MEEA 2J5QA 2Z58A 3FD8A 1EUCB 4INJA 1REQA 4K6OA 3VTAA 3C39A 4XUDA 3WK4A 2XI4A 3ZDAA 4PPGA 4FDMA 1GPDG 1OA0A 1A5BB 3TBFA 3DL0A 2E6UX 4Z9FA 1A2QA 5KNCA 3SYTA 2F43B 5JDIC 2Y0DA 1VBMA 4TMTA 2YL2A 5IRCD 2QT9A 3E0QA 1WDLA 3Q7RA 1JX6A 4V2UA 2QNRA 1GZUA 5AHOA 1JZSA 4ASUD 1STOA 4M8NE 3TJZA 2VDRB 3AR5A 2Z1MA 3ZIAA 4C89A 4J9UE 1BFUA 2WTAA 5AI6A 3CZQA 1DBRA 3TKYA 5KJ6A 3QFSA 2A0YA 1BOFA 1VL6A 2JIZD 1KZ6A 3DHWC 3P1JA 5BY2A 1NZJA 5I45A 1GCOA 3B1WA 4OHRA 1JVNA 4OXNA 3SHWA 4XH9B 5H3HA 2G70A 2G8NA 4RZ3A 2O3QA 2HRRA 4D6XA 2D7DA 4O4LB 2CFIA 1KFKB 3VFDA 4J9VA 5AVQA 1DRJA 1I4EB 5JDCC 3GCZA 1G6KA 4ZEXA 2FWJA 3L04A 1KNXA 3ZY5A 1E7MA 3I8SA 5FBHA 1Z6AA 3OQVA 3V46A 4AS2A 3Q2OA 2YCLA 3QKTA 5KWJA 3LCRA 3FMPB 4IMJB 3ETGA 3RVQA 2QT1A 2PTHA 3GDHA 3GEBA 1GP2A 4F6LA 2XE8A 3DTTA 3OLZA 9GPBA 2FPRA 2HQ1A 2JJQA 2IGBA 3NT2A 4Y2SA 1XYVA 5KYTA 2ZG6A 4JBWA 3W6NA 5FWDA 3DMTC 1A0OA 1MIOB 1UKAA 4G1BA 4E30A 3IPYA 2FE1A 4E14A 5C7IO 1GL7A 3BIOA 4ND8A 2RBGA 2WU3A 2J3JA 1PEYA 3U5TA 4U0JA 5HOEA 5CH3A 5K3CA 1NJ6A 3WVNA 3K8QA 2GQ0A 4QTXA 1SHKA 1TT7A 4MRNA 3ZX4A 4U1RA 4HJRA 1JI3A 3TZKA 4DR1B 4A5OA 5BMVB 4M1YA 2NSLA 3IVRA 1QDUA 2G1JA 1NLFA 3GH1A 2B8EA 4U7WA 4X5OA 3ZWPA 3AVWA 3OJOA 2BJHA 5JASA 4TV8A 3FZEA 4BVFA 3IX7A 1ZKDA 3QEKA 1RRVA 5B3JA 3T1YB 1A8QA 4GX5A 4REMA 3U3OA 4L4ZA 4FYPA 1XAHA 1GUZA 4ATNA 4CF7A 2DVMA 2UYOA 2YRWA 1QV9A 3Q1KA 4KR9A 3HABA 3H3JA 3NANA 1BZYA 4HNRA 1BIFA 2RHRA 3EWIA 1PO7A 2A1TS 2ZJBA 3IEMA 4DM7A 1HDEA 4IMIB 4ARSA 5CP8A 1RQ2A 3KZCA 3RDPA 3H1BA 7MHTA 3MD0A 5I7FA 4LJYA 4HLUA 4ENPA 2X9QA 1EM8B 2M2IA 2ODEA 3RBXA 3FF4A 4KR2A 4O4IA 3B7WA 4AMGA 1NM5C 1FFXB 4B0OA 4YQFA 2IIQA 1TC1A 1XMXA 2JAHA 3ISTA 4YH1A 3FPCA 2F6RA 4RNCA 4LJSA 2OB1A 2RMKA 4XWYA 5CVUA 4UM5A 1EGAA 2RHGB 3C3DA 3IA7A 2ZIVB 5COQA 1JTFA 5KTSA 1PZXA 1V3QE 1EQ2A 3R7SA 2Q29A 3ESXA 1QIFA 4DLVA 3EIHA 4IG9A 1O96B 1K63A 1T29A 2BN4A 4WERA 3MZ0A 2HMUA 1S7CA 2QRUA 2XDWA 5ERYA 4JLOA 4UUAA 2A2ZA 1YS6A 3ZWAA 1X1SA 5DM4A 3VU9B 5K8TA 4IGKA 1AV6A 3NJRA 3X1KA 1V39A 1RDFA 4FKMA 3PRJA 4OGWA 3UAXA 3EVTA 1QOQB 3J80A 3NC0C 2A4MA 4Z9YA 1J42A 4O0MA 5B30A 2Q5HA 2F62A 4AG3A 1T4CB 2C7VA 2AG6A 3KOXA 3U3KA 1LBIA 4B3FX 1WB4A 1CZUA 1U28C 4DLBA 1LA2A 1TLTA 2VTEA 4MP8A 1OH5A 1UMDB 2Y76A 3WQHA 1WW2A 5A4FS 2FX2A 2OCKA 5AVZA 2GERA 1M6WA 2OHGA 5ALZA 4OV6B 4RF4A 1UPAA 4KAXA 5ALGA 4CQJA 1E3EA 2II6A 4P3PA 3AL2A 1O95D 3ZV3A 4ENRA 1XZEA 5AVYA 4INPA 4E5PA 1II0A 3JAWB 1TUEA 3LHDA 4M1QA 2C94A 3VH2A 1W2HA 2WDPA 4JMLA 1GNSA 1ICEA 4L2IB 4Q15A 2OBMA 1X0XA 1JF8A 5DWVA 1MT0A 1D0IA 1QCCA 3OWHA 1ZISA 1ZBDA 1EZ4A 2D1TA 1ZGJA 2QMHA 2BFCA 2QUHA 4TL8A 3Q5EA 2Z4SA 2D5CA 3PGA1 2XJ4A 1FP2A 1QV6A 3JAKB 3ML1A 1GRRA 4MV5A 4Q03A 4PSAA 4GKKB 2CKMA 2H51A 2XZDA 4IWYA 5DI3B 2GCOA 3Q2KA 1W85B 4YI3A 3ZU5A 1BX1A 1P0FA 3G1UA 2B7LA 3AY0A 3PNLA 4R8VA 4YAOA 3T35A 5BPFA 3A6GA 4XQCA 1PR5A 3BWXA 3CX8A 3OIFA 4J91A 1TI7A 4I5FA 4QSHA 3S29A 4AN1A 5LJIA 2FPUA 1FY2A 3W78A 4P3OA 3BA6A 1MR3F 5IH3A 1Q91A 4PN7A 3T1TA 1NW5A 2CZQA 1XR3A 4GL4A 2XZLA 3QE2A 4N47A 3L0ZA 4KDEA 2XV1A 2XMCA 1O7JA 3HDHA 4IIEA 5HM6A 1YU6A 3SNHA 4QSMA 3QVOA 1YV9A 2J5BA 2PQ6A 3EYWA 4TTIA 4GI3A 4Y8VA 2Y0PA 3CNLA 1IZ0A 3MMNA 5EXPA 2PO7A 3ZNOA 4DQXA 1JQEA 2VWPA 4KZPA 3KX2A 2EBHX 5EWJA 3E7XA 3QF7A 4TMXA 3L7CA 3REGA 2WYWA 1IULA 2DOKA 2GRAA 4Q3LA 1BA3A 2WWTA 2BLLA 4NHOA 3VYVA 2HJSA 3MN1A 2G5TA 1PJTA 1CFJA 2H65A 1AN0A 2UZ1A 3TRIA 3WWEA 4CR6A 5K7SA 3BH7A 4V3BA 2ONKA 3AQIA 1NN1A 1GPNA 2BVNA 3BMOA 3LBFA 4HX2A 4ZOLB 3HDQA 4CCAA 2IV7A 1O08A 3FYTA 4QRDA 1Y1QA 2ZUBA 1SZPA 1XXHB 2HMVA 4K8OA 1UPTA 4XPZA 4OG2A 4C5CA 1DAPA 1ESMA 4R3UC 4UM7A 1EJBA 1OFHA 4EF6A 5KNDD 5KYWA 4GLFA 4LJ7A 1IEXA 1JQ5A 2JATA 2ET6A 3I6ZA 1QIHA 3PHJA 5ECGC 3EUAA 5F21A 4C0QC 4DR4B 4M8LA 4N3AA 1YVEI 2VI5A 4BQOA 3WTBA 1D07A 1N8NA 2I22A 3A2NA 4P58A 1OTXA 4PYNA 1P2FA 1UJ2A 4IXTA 4BO2A 3SVLA 1IUPA 2CNNA 1FU7A 3VJLA 2EVWX 1NBEA 2ENUA 5FYDA 4AYXA 3IERA 2VXCA 4RWEA 3UWSA 1NXWA 1Y5RA 2IUYA 3DEIA 3FBGA 3QRWA 3QKRA 1ZGAA 2JAPA 1NVGA 2FNAA 3JZAA 4Y9UA 4BAUA 2CB9A 1F2TB 4KAFA 5ANRB 1XYYA 3L9XA 2F67A 2ZYTX 3AOEC 3U40A 2AQ8A 4DRXB 4RDIA 3ZEIA 2VPQA 4DV3B 1Z3IX 3T5TA 4DA9A 2UUOA 3O8NA 1DIOB 2HV9A 1LSOA 4C88A 2CUNA 1Y8AA 3KQUA 2I67A 1JHMA 1L8OA 4NYJQ 5IUKC 1PIWA 4QREA 4KREA 3B7GA 3P9NA 4FGSA 3PB3A 3VX4A 3L7KA 3H7IA 1U7TA 2HSZA 2HA7A 2W8BA 1RQRA 2ZVQX 3L1IA 4HFRA 1YZQA 4BJ5A 1CU1A 1P1CA 1TCUA 4KU4A 2PZBA 3RM3A 4GOXA 4M0UA 1C1XA 3GDGA 1DS6A 3IKMB 1E61A 2C2OA 4AKSA 1IYZA 5KYYA 5TC4A 2R00C 2X19A 3H2HA 3HXLA 2VZ8A 3KNZA 3UMGA 3X1MA 1B2RA 1TAQA 2C4MA 4DXDA 1OAOC 5HEKA 1Z6GA 3HJBA 3Q7EA 5CB4F 2O2ZA 5AHXA 3VR5H 1OWMA 4IRUB 3A9RA 4XIYA 4XJVA 1BKYA 2NPOA 4L76A 1IATA 1C1XB 1RCFA 2JRCA 2A86A 4AZTA 3RYIA 3QX8A 2NTVA 4UCQA 1ESDA 5UKDA 4ZI7B 1S0UA 2A0XA 3KSMA 1P7CA 2WV7A 3U7HB 1PUXA 4M0KA 4BNMA 1EWQA 1RJEA 2C5BA 5D8DA 3GMSA 3WRYC 1XTBA 5IEJA 2FSSA 2WVJA 3D3WB 2SCUB 4KPUA 3TFOA 3SI7A 4KX3A 2JCSA 4WINA 4ZWNA 3RYFB 4B43A 3LQ2A 4HUTA 2W71A 4FCVA 3LDFA 3D6UA 3GGSA 3ZQJA 1KC3A 3FPEA 3KAQA 3R5FA 4Q3BA 2Z04A 4KR3A 2B4TO 1FJXA 1YA8A 3DPIA 4QXAA 5EE5B 4YMGA 4TMKA 1EK5A 1Z8NA 3CGWA 4PAGA 2VNKA 3QY9A 1Y1LA 4Q39A 4V0NA 5KWSA 3IT3A 1W5BA 4C7OA 3RSQA 4LGCA 2CCGA 1ZUNB 1R4NA 4ZQFA 4NCNA 1I14A 4CLOB 2D7CA 2AR0A 2RGUA 2I8CA 4Q66C 3FHOA 3FW1A 1NPTO 3IP5A 3LUGA 2VYNA 2PMWB 2PWAA 2G1AA 2RBEA 4R8RA 1WCWA 4BBPA 1INLA 1XXHA 5EY5B 2OKCA 1ICIA 2ZZKA 3F5FA 3IQWA 3Q87B 3N3AC 1JG2A 4ISCA 4NV1A 1BNCA 4Y9DA 1TPZA 1GEEA 3EGDB 3K9GA 2OENG 5ALUA 5A7HA 4YP1A 4YJKA 1G1AA 2GT1A 1O9HA 1TZMA 4JJZA 1SMKA 1VKHA 4KYUA 2P9BA 3CCFA 1D6MA 1R0CA 4Q4DA 3LDAA 5EXTA 5K3BA 2OFPA 1ZRNA 1BQ4A 3WLTA 1E3TA 3HRIA 3WNDA 4HFMA 2ASVA 3V6MA 2QTRA 1BDIA 4DL9A 2INGX 3HJUA 1ZNYA 5IAEA 1LDEA 5AUNB 4IUYA 3SKXA 5LD2B 1WD7A 1YJAA 5HF6A 1JTEA 2BTQB 4BCDA 2NZUG 3MTAA 3KJZA 4JUDX 1QOPB 1W6RA 1TD1A 4HB2A 3ZK8A 3SGLA 1JXMA 3AIKA 3V55A 1QC5A 1MN6A 3O2JA 4JX8A 4BVLA 2DHQA 2OHIA 3TAXA 3QGMA 1OBVA 2SKEA 3UZUA 4Z7JA 1N2BA 3L8YA 1MV8A 4GS5A 5CITA 4MYTA 4GI1A 4HH3C 5LQSA 2G72A 3OPYA 1C30B 5TNXA 3EG9A 1D6JA 2ZAGA 2LDXA 2WVHA 1MJFA 2XOXA 3Q8LA 4E4YA 1JKXA 2WQZA 3R09A 4R5MA 3ZN2A 2E4VA 3PFGA 3CJRA 5LP6C 2J48A 1O97C 5JG7A 2Q27A 1AKQA 2OG1A 5G53C 2JI8A 3ZQKA 2IEDA 3X2SA 3ODGA 3U7JA 1MX1A 1QTRA 3JD0A 1C41A 1A9RA 2FRXA 2Z2XA 3E58A 3JRNA 3QUSA 4GM0A 2X7JA 4NFHA 4WZAE 2HLNA 5T7BA 1KJ8A 3FOFC 5D3KA 3CG0A 4QZVA 4PLPA 3VJMA 1QR2A 1KI8A 2P4EA 4L95C 3UB4A 2OQVA 1QFSA 2MSCB 5KKNB 4I9NA 1NVVQ 5AVUA 4IDOA 4RY9A 1HZZA 4Q00A 1T35A 3R0JA 1ECBA 4JU8A 4ZVSA 4EFKA 3D81A 3C5WP 1I51A 4YDRA 1I2ZA 2CZGA 1DQPA 1P4RA 3C3AA 5LLSA 4RK6A 4PQRA 5T57A 5IKXA 1C29B 4CT5A 2O9JA 2R6CA 4UFPA 5EIWA 3CVVA 3SQWA 1HORA 2X4LA 1N8TA 1PGNA 3HKCB 4LVUA 2EQAA 3GH3A 1Z08A 5TGDA 2XYHA 1X7HA 4UHFA 2HN9A 3H84A 5L3RA 3UK7A 3AI3A 5AVVA 5A9TA 3O8CA 1HMPA 3H1GA 3VU9A 2FGJA 3F78A 2AT1A 2IELA 2X8BA 3NC1C 1QKKA 4DUGA 4QFMA 5MDHA 3U0VA 4RWZA 1EHYA 2GR9A 4CDRA 2PSFA 4PRZA 1T0HB 3OPQA 3GEMA 2NVBA 4A8HA 3VR1A 3E3OA 1D1PA 1X7YA 4B6FA 1KHTA 2XUGA 5D6NA 3DEFA 3PFIA 4OSOA 4HT3B 3KYBA 3L7MA 1NF8A 3CVUA 4RJKA 3OFND 3UA4A 4KX5A 2BZ1A 2HCRA 4YJ3F 1KQGA 5H80A 2CJWA 2IBMA 2J45A 1G5TA 1JMKC 1NJFA 2D00A 3AWIA 3B52X 3DE7X 3KU4A 3PWSA 3T52A 1B16A 2HK8A 4DB4A 2IX9A 2ZIZA