The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
20
|
sequence length |
77
|
structure length |
77
|
Chain Sequence |
DRVKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSETEKRPFIDEAKRLRALHMKEHPDYKYRPRRK
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Transcription/dna
|
| molecule keywords |
5'-D(*TP*GP*TP*CP*TP*TP*TP*GP*TP*CP*AP*TP*GP*CP*TP*AP*AP*TP*
|
| publication title |
Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
pubmed doi rcsb |
| source organism |
Homo sapiens
|
| total genus |
20
|
| structure length |
77
|
| sequence length |
77
|
| ec nomenclature | |
| pdb deposition date | 2003-07-17 |
| chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
|---|---|---|---|
| B | PF00505 | HMG_box | HMG (high mobility group) box |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Mainly Alpha | Orthogonal Bundle | DNA Binding (I), subunit A | High mobility group box domain |
#chains in the Genus database with same CATH superfamily 2YQI A; 3FGH A; 4NOD A; 1E7J A; 1J3C A; 2CTO A; 1HMF A; 1WXL A; 3TQ6 A; 4NNU A; 1J3X A; 1I11 A; 4EUW A; 2HDZ A; 1V63 A; 1WGF A; 2D7L A; 2CRJ A; 2LEF A; 1J46 A; 2GZK A; 2YUK A; 2E6O A; 4QR9 A; 1L8Y A; 2CO9 A; 1J47 A; 3NM9 A; 1J3D A; 1WZ6 A; 1CKT A; 1HRZ A; 1HME A; 4S2Q D; 1LWM A; 1HSM A; 1V64 A; 3F27 D; 1QRV A; 2YUL A; 2EQZ A; 1L8Z A; 1NHM A; 2LY4 A; 2LE4 A; 2LHJ A; 1AAB A; 1GT0 D; 1J5N A; 3TMM A; 1O4X B; 4Y60 C; 1NHN A; 2YRQ A; 4A3N A; 1K99 A; 1HRY A; 1CG7 A; 2CS1 A; 1HSN A; 2RTU A; 3U2B C; 1HMA A; #chains in the Genus database with same CATH topology 5H8W A; 2YQI A; 3ABS B; 3FGH A; 4NOD A; 1E7J A; 1J3C A; 2CTO A; 3AO0 B; 1WXL A; 3TQ6 A; 4NNU A; 1J3X A; 1HMF A; 4EUW A; 1I11 A; 2HDZ A; 3ABR B; 1V63 A; 1WGF A; 2D7L A; 2CRJ A; 2LEF A; 1J46 A; 2GZK A; 2YUK A; 2E6O A; 4QR9 A; 1L8Y A; 2CO9 A; 1J47 A; 3NM9 A; 1J3D A; 1WZ6 A; 3ANY B; 1CKT A; 1HRZ A; 1HME A; 4S2Q D; 1LWM A; 1HSM A; 1V64 A; 3F27 D; 1QRV A; 2YUL A; 2EQZ A; 1L8Z A; 1NHM A; 2LY4 A; 2LE4 A; 2LHJ A; 4A15 A; 1GT0 D; 1J5N A; 1AAB A; 3TMM A; 1O4X B; 4KQE A; 4Y60 C; 1NHN A; 2YRQ A; 4A3N A; 1K99 A; 1HRY A; 1CG7 A; 2CS1 A; 2VSF A; 2RTU A; 3U2B C; 1HSN A; 3ABO B; 1HMA A; #chains in the Genus database with same CATH homology 2YQI A; 3FGH A; 4NOD A; 1E7J A; 1J3C A; 2CTO A; 1HMF A; 1WXL A; 3TQ6 A; 4NNU A; 1J3X A; 1I11 A; 4EUW A; 2HDZ A; 1V63 A; 1WGF A; 2D7L A; 2CRJ A; 2LEF A; 1J46 A; 2GZK A; 2YUK A; 2E6O A; 4QR9 A; 1L8Y A; 2CO9 A; 1J47 A; 3NM9 A; 1J3D A; 1WZ6 A; 1CKT A; 1HRZ A; 1HME A; 4S2Q D; 1LWM A; 1HSM A; 1V64 A; 3F27 D; 1QRV A; 2YUL A; 2EQZ A; 1L8Z A; 1NHM A; 2LY4 A; 2LE4 A; 2LHJ A; 1AAB A; 1GT0 D; 1J5N A; 3TMM A; 1O4X B; 4Y60 C; 1NHN A; 2YRQ A; 4A3N A; 1K99 A; 1HRY A; 1CG7 A; 2CS1 A; 1HSN A; 2RTU A; 3U2B C; 1HMA A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
