1ODFA

Structure of ygr205w protein.
Total Genus 96
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
96
sequence length
286
structure length
280
Chain Sequence
SKTVLDYTIEFLDKYIPEWFETGNKCPLFIFFSGPQGSGKSFTSIQIYNHLMEKYGGEKSIGYASIDDFYLTHEDQLKLNEQFKNNKLLQGRGLPGTHDMKLLQEVLNTIFNQDTVVLPKYDKSQFKGEGDRCPTGQKIKLPVDIFILEGWFLGFNPILQGIENNDLLTGDMVDVNAKLFFYSDLLWRNPEIKSLGIVFTTDNINNVYGWRLQQEHELISKVGKGMTDEQVHAFVDRYMPSYKLYLNDFVRSESLGSIATLTLGIDSNRNVYSTKTRCIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HYPOTHETICAL 33.3 KDA PROTEIN IN ADE3-SER2 INTERGENIC REGION
publication title Crystal Structure of the Ygr205W Protein from Saccharomyces Cerevisiae: Close Structural Resemblance to E.Coli Pantothenate Kinase
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Yeast protein
total genus 96
structure length 280
sequence length 286
ec nomenclature
pdb deposition date 2003-02-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1odfA00
1KYIA 3N2IA 2JCSA 3SYLA 3VNUA 1CKEA 1J99A 1M7HA 5CJ2A 3DL0A 3OE7A 2IYRA 3GFPA 4LI0A 3TKLA 3B1XA 3GJ0A 4JS0A 4NCIA 1NN5A 4XD7A 5AJVB 4JLVA 2P6RA 1U0LA 1RRFA 4M9QA 3LH5A 4M2LA 5CB8A 2QMHA 1OPXA 4YMWA 2O8DA 2PMDA 1P3JA 2W00A 1EX7A 4ZI3A 2NO6A 1W44A 1DELA 4MUBA 4PXAA 2QI9C 4ARZA 2GESA 1FNNA 2EFHB 1H65A 3A1TA 4UKDA 2FSFA 1UAAA 1RIFA 4TYQA 5D3MA 4Z1MA 2A5YB 5SZJA 1DAIA 2J46A 5C4MA 1S3GA 2DFLA 3QKRA 1DVRA 1G7RA 1QHIA 4XIGS 3F0TA 1Z6AA 2RGNA 1E79A 2OCYC 4Q4LA 4D2IA 2VYFA 3GLIE 3L43A 4LHZA 3RS2A 2ZE8A 4CEHA 4NKRA 4L9SA 4IFEA 5LDDC 1GRQA 1KI4A 4UNSA 1ZNXA 3ZH9B 2W6JA 1QVRA 2O8DB 2HT6A 1MRNA 4NBSA 1EESA 1DEKA 1EG7A 4U00A 3B85A 3U4QA 3KFVA 2Q0HA 1J70A 4R2IA 2ONJA 4GP7A 4LSGA 5FI0B 3NBZC 2CJWB 1P6XA 1A2BA 2ZRDA 2VQSA 3FB4A 5EUMA 1E3MA 4B75A 2F1JA 4KFUA 2QT1A 3M0EA 4PC2A 1SVLA 4PPFA 2DPXA 1NP6A 1FQKA 2N42A 3A1SA 421PA 1GILA 2W2VA 1KMHB 1FTSA 2R8RA 1MO6A 1R8SA 1S9DA 2NO9A 3BIFA 4JKIA 1ANKA 1C9KA 1J8YF 5DHFA 2XX3A 4Q4HA 4C30A 2IYUA 2H8KA 2DWPA 4C4PA 2CNWA 4TT3D 5SZKB 1Q1QA 4EJSB 2AFIE 2FSIA 4OJKA 5J40A 1IN5A 1SZPA 2ZSDA 1SVOA 2DWQA 3DHWC 5CK4A 4EJSC 2QAGC 2WSSD 3GCGA 2PL3A 4PO9A 2F9LA 4C0BA 4Z51A 2WJHA 4O3MA 2ORVA 2BM0A 1JEEA 3V9PA 1S4QA 3FKQA 4LJYA 3AV0B 1FP6A 1KDTA 1Z0IA 3HU2A 4B2IA 1GKIA 5BW8A 4P3YA 3TNFA 3Q72A 5CB6A 3AVUA 1UBGA 2G3YA 3CH5A 1CJVC 1P9NA 1CU1A 3KQNA 1E4VA 2IXEA 1FUKA 1JR3D 2XOKD 3WNBA 3IEVA 4BFUA 1PUIA 1N5KA 1MO4A 5BWMA 3GLGE 4PZZA 1CRPA 4OK5A 2YWGA 1ZD1A 3AVPA 3THWA 5C46F 1N6RA 4B3CA 1W5SA 3NBXX 4DSOA 3NHBA 2W0SA 3FWYA 2VEDA 2QZ4A 2NPFA 4JL6A 2P6NA 4QNRA 1W2HA 5CLLA 1II9A 4GBMA 1MH1A 2WJGA 1E2EA 1ZMXA 3VHLB 1UKVY 3X1ZA 2IXGA 3CIOA 1LNZA 1GTVA 4RD4A 3OEHD 1NSFA 3QKSB 3SI7A 3U3RA 2OBLA 2BHRA 2QBYB 2IYWA 4EPYA 3KXKA 1XMSA 2QMEA 2CL6X 4JYCA 4AKHA 4DLYA 1Q3TA 5AJWA 3KQHA 3KTAB 5B58C 3M6AA 2NPIA 1Z83A 2ZANA 4Y0VA 3WXMA 4XSGA 1NIJA 2I1VB 2CK3D 1DBSA 2IYYA 1XWIA 1H8HA 4PHTA 4EPVA 5BN4A 1Z63A 4D81A 2O52A 4M21A 1HT1E 1YZUA 1LS6A 2GZAA 3RC3A 5L3QA 4HSEA 3U3KA 4LJ8A 4ESVA 3LRPA 2A30A 4PR0A 1PVOA 3O8DA 2QRZA 1E2QA 2OM2A 4BFXA 3T5DA 4P4SA 4HLCA 1QHSA 1GZSA 2W2TA 4W7SA 1CP2A 4Q4JA 4HEJA 1G1MA 3SFVA 1OXXK 3LQQA 4HLQB 3UMFA 1FOEB 1G6HA 1T0JB 4EPWA 4EUNA 4QL3A 2C98A 1OE0A 4NDZA 4TQ9A 1I2MA 3QJYA 4B48A 4TSFD 3I4LA 3EIQA 2E1RA 2OBNA 1E0AA 4LBVA 5TMPA 1VYUA 5EE0A 3GPLA 2XTZA 5LD2C 3R9WA 4RZ2A 2ZRIA 3FFBA 3I8XA 3Q3JB 3RS0A 3LBHA 3ADBA 5EE9A 4D26A 3UXMA 3U7FB 3TE6A 4JZKA 2QP3A 2R9VA 3KFXA 4Q00A 1Q20A 2AX4A 1G20E 2BBSA 2F6RA 1RPZA 3K53A 4FMBB 3B7GA 1NG9A 2AKYA 2WMOB 2WSSA 3MCAA 3EXAA 2ZJOA 1T6NA 2BMFA 2OAQ1 1TL7C 4YC7A 1P4SA 5FBRB 5EE3A 3LO5A 3UANA 3QIAA 2OFOA 5FTNA 4ABYA 2VHJA 3WMGA 1OXUA 1XXHA 3U6KA 5FR1A 4Q4AB 2ZE5A 4DVGA 4LYJA 1SKYE 3CRW1 1E9EA 3FGNA 4AIIA 3ZLJA 3ND8A 3SYNA 3GLGB 3M4YA 1GNPA 1XTRA 5DE3A 2G83A 5FR2A 1NKTA 3TUIC 1DAFA 3SU8A 4BZQA 4ERNA 3ETLA 2R6FA 2GRJA 3ADKA 3RVBA 2XXAB 4Q4HB 2OCBA 1G8GA 4Q48A 2F43A 2CE2X 2BWJA 2QY9A 4OQXA 3BH7A 4IDOA 1OT3A 2IS4A 5B30A 3CRMA 4HI0E 1DAKA 1E98A 2PLRA 3N2EA 1ZD9A 4A0FA 4FMDF 2FPLA 4ARZB 1AS3A 2V9PA 5G41A 4AWXA 1WB9A 1MT0A 1YHNA 1ZU4A 2ZUDA 3K0FB 2XTMA 5L3RA 3TMKA 3QVUA 4DB4A 2BJVA 4JVLA 2V55B 2HXSA 1IM2A 2JGNA 3KL4A 4FCTA 4HAZA 2AKAB 1QVAA 2HLDD 5L3VA 4IHQA 1S1MA 3AVTA 1NVVQ 2ZRLA 5FOXA 5FPHA 3CRRA 4L9WA 1NLYA 3QXJA 4GRAA 4LJ9A 1L7VC 1P5ZB 2RGDA 1CRQA 3GJXC 4B3XA 2IA5A 1T8UA 1KMQA 2XEXA 2NZJA 1CLUA 2R62A 1F2UA 3QG1A 4WZBE 5KHOC 5ELXA 1IXZA 4CT5A 2NG1A 2WBLC 1D2EA 3P20A 5GJBA 2GAAA 3TW4A 4JLJA 3MGCA 5LB2A 4M1KA 3UIEA 5FBVB 5EXPA 1NNEA 1QHXA 4TL7A 1G291 3R9IA 4Q7KA 2QROA 3KJEA 3P26A 3AVXA 2XJ9A 4RZUA 4CEHB 2JATA 2REXB 4JBXA 1KY2A 1YZGA 2DFTA 1KSHA 2RCNA 2ZVQX 3FTQA 5JJLA 2I3BA 1KI7A 2F1HA 3IIJA 5JS7A 3GLHA 1DG3A 1G8HA 2FV8A 4P33A 3C15C 3NH9A 4OQFA 1X6VA 4TLDA 2VP2A 5JSZB 2FF7A 4FIDA 2D3WA 3NKVA 1S3SA 4HZIA 4L15A 5DLQC 1W4BA 4B33A 1W46A 2ZRFA 4PQFA 3LVQE 2FEMA 1AA9A 4HUQA 4URVR 5K8UA 2GILA 1OB2A 3UKDA 2HJGA 2ZI4A 3D6TB 2D06A 3K0SA 4HLUA 3WBJA 1QHHB 3SE0A 4BECA 2RHDA 1IONA 4KLNA 4EJSA 3V4RA 1UEIA 1Z22A 2NOAA 3B78A 4PHGA 4W5HA 2FU5C 4I4LA 2Z4SA 3UWKA 1N5IA 3AUYA 3B1YA 4IDQA 4MYTA 1ZAKA 2WJVA 1ZCAA 4NCKA 3DZ8A 4TYPA 4QKQA 3IQXA 3QI2A 5DGXA 2J5XA 3DDCA 4TZ0A 5CJPA 1A5TA 4FD2A 1TU4A 4A6XA 5DI3A 2P0EA 4DC9A 1NSTA 4RFVA 1LF0A 3THOA 1NBMA 3I73A 3PUWA 3SJBA 1E2HA 3GMTA 5J4KA 1N2CE 3VTKA 1QF9A 1F2TB 2D2EA 3OEHA 3FMFA 1D2MA 2Q3HA 3AF2A 4R9UC 2EWVA 1GDDA 2IWRA 1OIWA 2R6AA 1ETUA 1YZNA 4FXPA 4LPKA 1FNMA 3EA0A 4JLAA 2J45A 2GNOA 4D25A 3IQWA 5JECA 1JPJA 5IHPA 2J0UA 2C9YA 1N6OA 4XJXA 2JJ2A 1P2TA 1OF1A 4P4SB 1D6JA 2XITA 3HPQA 4GSYA 3THYB 2J0SA 1W0JD 1E2KA 2AHOA 3TR5A 1LB1B 5DN6D 2OESA 4GNKA 1KY3A 4LPSA 3WNCA 4F93B 1Z0JA 4UNQA 4IVPA 3C5CA 4B3BA 3Q85A 1CTQA 2ZQ5A 4ZPXA 3VR5A 1XFAA 3QF4A 3Q7PA 4I1VA 4U5XA 3QG5A 2YOHA 4C2UA 1Z29A 5D3MB 5F9FA 1G5PA 2EYUA 3D3QA 3PXGA 5C1BA 3MAAC 3TGPA 1IY2A 4CT4B 2RKOA 2DCUA 1Q1ZA 4Q66C 1XEXB 5DYIA 4E03A 2AWNA 2IW3A 4EKDA 5F98A 2O8EA 4R71A 3QUSA 2FNAA 2WWGA 4BLRA 5EZ6B 3QKTA 2BKEA 1HT2E 4Y0AA 2BEKA 4NCNA 3VX3A 1HE1C 3KB2A 1I4LD 5DO9A 1PLLA 1XXHE 2XNSA 1HYQA 2B8WA 2C96A 2JASA 2Q9CA 3CX6A 3PCRB 5TVKA 2ZEJA 2XZLA 3SJCA 2CLDX 4OBEA 1R0XA 3D31A 4C0KA 1Z0FA 4F4CA 2AL7A 4G5SA 2ZR7A 4BFYA 1FMLA 3ZIAA 2VP9A 3ZDQA 4DCSA 2ZSBA 2J0QA 4CEJA 4A36A 5BYJA 1DTSA 3LBIA 4BLOA 1UBEA 4LJ6A 3OIUA 4CVNA 4BWYA 1IN8A 2JEOA 2AXPA 2Z5FA 2IF2A 1G64A 1KDRA 1ZIPA 2GJ8A 2H18A 1TX4B 3A4LA 1BH2A 3BORA 1GFIA 3QVVA 5KPDA 3RRZA 2WOJA 1SVIA 2NQ2C 4IOLA 3U2QA 1JI0A 3T61A 1S9HA 4IJMA 1D8TA 1XJQA 4EQ6B 2NO7A 2DBYA 5CLQA 3VKGA 4DHEA 1KI6A 4ZCMA 4MH0R 1KHTA 2GF0A 1N0UA 4TMVA 2CNWD 4FCWA 3WRXC 1E9BA 1DOAA 4DLZA 2IYLD 1NKSA 1BIFA 1IXRC 4HZUB 4KBGA 5FUYA 2ODEA 3AEZA 2ZI3A 4DUGD 1YU9A 3CM0A 1T0HB 4LOAA 1YZKA 3NVAA 4ZIRB 4DLSA 3SJAA 1VIYA 3E5HA 3TLXA 2CL0X 2QP9X 3RHFA 3PUZA 3PFIA 4B47A 1AJEA 1E2GA 1UJ2A 5D3QA 2DR3A 3AP1A 5KSOA 3EARA 4Q21A 2OXCA 2REBA 4B6EA 1XPRA 2BBOA 3T1VA 1E9FA 4JVSB 1IBRA 4TL8A 1WBBA 1HV8A 1BMFA 3K9NA 4QNMA 4GP6A 3U3JA 1G7TA 5KDOA 2G6BA 4DJTA 3K0FA 5KYKA 4NP6A 2ZJ8A 4G5QA 1J90A 1U8YA 5TDHA 2QU8A 5JRZA 4I1OA 1ELOA 5DSZA 3ECCA 4XVUA 1OH5A 1QHNA 4LJ5A 2F43B 3A1UA 4FINA 4Q1AA 3A8TA 3AGPA 1EFHA 4KXFB 4B76A 1NVVR 1VHLA 1SHZA 3QEOA 2O8BA 1KKMA 5G3YA 1GL6A 4EPXA 3NDBB 1E0JA 1LTQA 3KB1A 2WIAA 1SKQA 1IN6A 4QGHA 4GPTA 4MYCA 2VA8A 1D2NA 2QSZA 3LVRE 3KQLA 4DXAA 4WA7A 1GVNB 5CK5A 3A1WA 3SOPA 3UK6A 5FPYA 1OFIA 5JMTA 3IKJA 1S2MA 1AS2A 3E2IA 521PA 5AJZA 5LB4A 1E94E 3CNNA 2O8CB 1COWA 1H8ED 2QMUA 1FL9A 1FP7A 3IHWA 5IRCD 1R10A 1Z6GA 2V6JA 3EPLA 1BKDR 4UXIA 4LDJA 1RZ3A 4C0QC 4JLPA 2YWEA 4MUAA 4RCYA 1KI8A 5CM9C 2GK7A 3ZZUA 4WVFA 4BE7B 1KDOA 5A0FA 4M1SA 5EXSA 2KE5A 2ZPTX 3ZVMA 1JBKA 3AP2A 1OH8A 4QFMA 4RJLA 2NZ8A 2Y8EA 3PUXA 3VNVA 5UKDA 4BZXA 3W6NA 5KUTA 1X8LA 4M9XA 1AZSC 4RZ3A 2QM7A 1FPMA 1Q0UA 4S2EA 1W5TA 3IGFA 2YHSA 3DOEA 1L4UA 2D7DA 3GJ6A 1ZIOA 1TQDA 5AR1A 1KO7A 3T15A 3B8HA 3NG1A 2PH1A 2H92A 1UM8A 4IFBA 3G0HA 4Q1FA 2PJRA 3ADCA 2ZRJA 4IOKA 4QBHA 4QJ5A 1UKZA 2WAYA 1W36C 1E1RD 821PA 2P3SA 3PVSA 3I3SR 1ZNYA 3K1JA 4QRHA 3D7MA 4JLNA 1G9XA 2YZ2A 4V0MA 5HZKA 1B23P 3LAWA 2AK3A 2C2HA 2O8CA 4RD2A 2QN6A 4TTRA 1VYVA 1S1CA 2Q21A 3I32A 4GOKA 4KV9A 3VMFA 2OBMA 4DZZA 1S8FA 2WWIA 2WHXA 1OKKD 2ANCA 3H84A 4LYHA 4TT3A 2FFBA 3NIBA 3FMOB 1XCPA 2ERYA 4M9ZA 2GF9A 2JJ8A 4RD0A 3UPUA 4DCVA 1W49A 2VP0A 4B3FX 4DWJA 1VPLA 5JBQA 4LHXA 4N0DA 5G3ZA 4D80A 2Q9AA 1VHTA 2QENA 1NY5A 2A9KA 5EP4A 1OIVA 1TQ6A 2YJTD 5HE8A 1LF5A 4Z1MD 2QGNA 1XX6A 3PUYA 1ZD8A 4GFDA 2XAUA 1V43A 4IVQA 1E2DA 1NVXQ 2R6GA 4JVNA 2E87A 3ICQB 3BERA 5CITA 1XTQA 1KO1A 3RS5A 3U3OA 2QA5A 1Z8FA 2MSCB 5KSZA 3ZZTA 1ODFA 2QQ0A 4NTZA 3HR7A 4TTPA 1GM5A 1GUAA 5GVRA 1JQLB 1G16A 1FFHA 4DB2A 2QTVB 1SHKA 4A4DA 3LLMA 1IOZA 3KKOA 1K8RA 4URWR 3GLIA 2ZYTX 1J7KA 2GXQA 4C0AC 3NEJA 4I1SA 2AFHE 3LW7A 3BB4A 3ICEA 3W3AA 3QBVA 2N1BA 1VG1A 4QGFA 5BQ5A 2H17A 3TBKA 4F91B 2FX3A 2AK2A 3VR6A 2GAOA 4V03A 3R7WB 4JKYA 1LS1A 5B64A 1E69A 1M6NA 4NHOA 3NEYA 3BBPA 2QPTA 4C0JA 4W5WA 2WJIA 4DLRA 3FMIA 4L5BA 4CRWB 4QJ3A 3K70D 1XD9A 3REFA 1P9WA 1K6MA 4UQOA 2Z83A 2PX0A 3EIHA 2AD5A 2ZROA 4DLVA 1KMHA 2OV2A 2XB4A 3GJ3A 3BFXA 5L3QB 4LYFA 2UKDA 1NBMD 3CPJB 3I62A 4A15A 4A1FA 4HAWA 4R7ZA 1JAIA 1GIAA 1COWD 3ZD6A 4PPQA 3BB3A 1AN0A 3KUCA 2C9CA 4Q5IA 1N3BA 1W4CA 4DRZA 1Q22A 1IXSB 1US8B 3WNDA 2ZJZA 5H70A 4X8HA 2GJKA 3ZS8A 2WWFA 5JZVA 4LX0A 1RC8A 2MSEB 2OT3B 4QHSA 1TF7A 3EC2A 4AURA 3KDSE 1ESMA 2FA9A 1WF3A 4BFWA 5JS8A 5KTYA 5JI2E 4XTCS 2ZRHA 5GJWC 1MO5A 4O2RA 5IK2D 3CF0A 4LJ7A 4OK6A 3RDPA 3THXA 3EPKA 3DEFA 2F3RA 4KFSA 3BXZA 2O8EB 4C0LA 2ODWA 2MMGA 2CE7A 2WKRA 4PO1A 5F9HA 3BFVA 2F3TA 1G3IA 4TMTA 2IUTA 2ZI7A 5KNCA 3PEVA 4V02A 2PX3A 3BWDD 1XRJA 4H1VA 4YXWA 4AG5A 1TEVA 3QKRB 2HYDA 4B3DA 4MGYR 1JR3E 4F92B 1UPTA 4TWZA 1S96A 4D82A 3TK1A 4LV6A 4TMWA 2J3EA 4L8GA 2D74A 1II0A 3MJHA 4UXHA 2OFWA 2IL1A 1M7BA 2ZVPX 3AVOA 4XTRA 2EFEB 1XU4A 4H1UA 2OCPA 1PLJA 4JT2A 3C5HA 4QOSA 3GJ7A 4PC3A 4PPGA 1P60A 3A36A 4JLOA 3SR0A 4CEIA 3P32A 3W5IA 1HE8B 5A4JA 2VP5A 3HWSA 4OHVA 5FPKA 2CXXA 4HDCA 4LYAA 1J2JA 5E7MA 3RLFA 1CJTC 1NG1A 2JLYA 4TLEA 5FUVA 3CPHA 3U7EB 4Z8XA 1VCMA 2ZJAA 3I1FA 1DAHA 1X1RA 2ZRBA 3EZ6A 4IDNA 4Q1EA 1U0JA 3GD7A 5FPSA 2V1XA 1SKYB 4F38A 3LXXA 4NU0A 4PAMA 2P65A 5HZHA 3H4MA 3OHMA 2XZPA 2QE7D 5DIFA 1ZUNB 2JLSA 2GBLC 1N6PA 2F1RA 5DI3B 2J87A 1OHHD 5H1YA 3JVUA 4DIEA 4K46A 3BRWD 3D8BA 2FDCA 4DDUA 3RRMA 1SXJD 2QUZA 4OQLA 4P4TA 1G19A 3LA6A 1JECA 1OFTA 2CMKA 3IO5A 3OEEA 5J4YA 3L0OA 4JSYA 1OXSC 4QBFA 5FOVA 2W0MA 4QM6A 1PUJA 1CULC 1E99A 1L4YA 1Z3IX 2J7PD 2C78A 2ZR0A 3IILA 5CDFA 1W0KA 3U44A 1Y3AA 3UMRA 3ZVRA 3TUZC 3Q8XB 5E7IA 5K8IA 1VG9B 1X8KA 1NL3A 2FSGA 2RAPA 2KBFA 3TSOA 1ZUHA 3W90A 1CR2A 4PSKA 2EFDB 1U94A 4QG7A 5JWRA 2RGCA 1LV7A 4E22A 3AGQA 5FH9A 3U61B 3TAUA 1ZC3A 2OSBA 1RW4A 3NHAA 4N1AA 3B82A 2O8FA 1E2PA 4WAUA 2QEQA 2E9SA 2FWRA 4NL4H 1TMKA 2HEIA 1W1WA 4Q9HA 1ZJ6A 4L16A 4EPTA 3KXIA 2OHFA 2OLKA 2XNDD 3KZ1E 1G5RA 1XB2A 2PCLA 4LHYA 3ZVLA 1X3SA 1G8PA 4CDGA 3L8YA 4D0GA 3AVWA 4AI6A 4ZDWA 1E32A 4O0MA 3WHKA 3A58B 4DCUA 1SXJA 1U8ZA 1E79D 3T1OA 1GG2A 1RYHA 2ZJ2A 2ANBA 3CZQA 1Q3HA 3H0KA 3Q5EA 4LWZA 3WYAA 1L2TA 4OJQA 3WP1B 1SVKA 5E7JA 3VX4A 2QP4A 4ZDIA 3FHTA 4JJZA 2G1KA 1CR4A 1OFUX 3K0AB 3QKSA 5EXTA 3VR1A 3PQCA 3AM1A 2HUPA 2REOA 2B8TA 2XJ4A 3B2EA 4IXMA 3CX7A 5GADl 2ORIA 2ZJYA 3T35A 1WBDA 2QT0A 1OXTA 3G82C 3LFUA 1GP2A 3RABA 1UDXA 3HP1A 1W0JA 1R7RA 4LV5B 4B73A 3I72A 3LX5A 4TSFA 3ASZA 5LPNA 3CH4B 4C7OA 4DLUA 4ON9A 3U60B 1JR6A 3B9QA 2V1UA 4IRUB 1BOFA 2X1VA 3EA5A 2IS1A 3VQTA 3BAFA 4HAUA 1XZPA 3TSZA 1A82A 2ZAOA 1T9HA 3FFAA 3P4YA 3QY0A 2VH5R 4KSCA 3CR8A 3FHCB 5FPTA 3IIKA 1XPOA 1WXQA 1AZTA 2G77B 4Q7MB 1OXVA 4A2PA 3OESA 1SULA 4LCBA 1YR9A 1DARA 3B13B 2XZOA 2FGKA 2I1QA 3B1WA 4CZ2A 3CB4A 1EFUA 5GVSA 1GSIA 3O8BA 2CJWA 2FN4A 4YLGA 2NIPA 4E09A 1AM4D 2QG6A 5M04A 2DHRA 2G0TA 4PC1A 3GEEA 2C9OA 2IYQA 1FX0A 1AKEA 2GKSA 1BS1A 1WMSA 3O47A 5G40A 4RY2A 2JLRA 4M1WA 2OEPA 1F48A 1NLFA 4PAQA 5FL7D 3B9PA 1KK0A 3AF4A 3WMFA 4GL2A 3SZRA 1E2MA 1R0ZA 4QBGB 1XTJA 4GMXA 1ZC4A 4M53A 1E2LA 1GAJA 3IO3A 3ZJYA 5H8WA 2ZYVX 1F6BA 3WRYC 3QXXA 1U9IA 2DYKA 3CONA 2RGGA 1DPFA 3GLIB 3SBDA 2ZITA 4YMUA 2L0XA 3VU9B 2ZRNA 2HDNB 4KLZA 1ZW6A 2QM8A 4A2WA 2J59A 4B44A 2JA1A 5FOWA 4AKGA 4OQNA 1X1SA 4FWIB 2OCAA 4JL5A 1E9SA 1Z0DA 3IEUA 1W47A 4R2HA 3IPXA 1IJFA 2A3RA 4TMKA 1JPNA 3BGWA 4CW7A 3UG6A 3A6PC 3OIYA 3TQFA 4RKFA 2GJAA 1N0VC 1HUQA 2A5DA 2RHMA 1QDEA 1WRBA 5KPJA 5CM8B 2IHYA 4WW0A 3DMNA 2ZSFA 3MUFA 4TQUS 1G3RA 4Z54A 2FFAA 1GKUB 4OI2A 4BLQA 2VHTA 4O25A 4QHYA 3PEWA 2O0KA 3QF7A 1VG8A 1GL7A 3GLHE 1P2UA 3L0PA 5C2JB 2A5JA 3PENA 1JEDA 3PUVA 4IEIA 5TY0A 5KSPA 1KGDA 1E1QA 2D2FA 4IOMA 4I99A 1LY1A 3HDTA 3QXHA 4PPNA 3W6OA 4OHWA 5JFGA 4TYWA 2WIBA 2Z4RA 1M74A 4Z8YA 1OW3B 2A5FA 4BRWA 3KXLA 2GEUA 4B6FA 5J4HA 2ZXUA 3TIFA 3BS4A 5LD2B 4LBZA 1LW7A 1TUEA 4QGAA 2VSOA 3DPUA 3QBTA 1UF9A 4IVRA 3TAHA 1YR7A 1C4OA 4MITA 5BYKA 2BCGY 2ECKA 3SHFA 5LBIA 4BUJA 3QSYA 4DDVA 3HJNA 2H16A 1YE8A 2HLDA 1CS4C 3TVDA 5HCIA 5EQTA 2WICA 2WWYA 4BFZA 5FOSA 2WTUA 3REGA 2BVNA 2NMVA 3LNCA 2QGZA 4NYIR 1V5WA 1WE2A 4OQMA 4OHYA 1N6NA 5FI1B 1Z47A 3LQRA 5FTKA 3THYA 4JT4A 4DUGA 5JHHB 2RH5A 2GTPA 5EP2A 3QPWA 4FN5A 1K5GA 4B74A 4KBFA 1G4AE 2AWOA 2J41A 3OF5A 1IY1A 1T3HA 5J47A 1KKLA 4XVRA 4D4LA 1NN1A 2VP4A 5HPYB 4MRVA 3K9LA 4AKEA 3KJHA 1T91A 2PZGA 1G41A 1AQYA 1Q44A 2R44A 2YC4C 1R0YA 1AGRA 2HT1A 5FFMA 3AKDA 5AUPB 1QBKC 3IDQA 2H7VA 5KDDA 4OI1A 4DBLC 1G4UR 1UADA 2CCJA 2VLIA 3RANA 4ZI2A 1BMFD 1G5TA 1KZ7B 3L8ZA 1QHYA 2WWXA 2YOFA 4NYMR 4TTQA 4D4MA 3OZXA 1II8A 4HDOB 1KJZA 1FQJA 2NGRA 3OIWA 4DT1B 5L3SB 1TF5A 4PHHA 2IBMA 4LJ4A 4IDPA 3MRSA 4WXRA 3ZYCA 2DY1A 1OLOA 2NO1A 3LY5A 5AUNB 4PX9A 5JWHA 3CWZA 3X1YA 1TF2A 1A2KC 4MRRA 4DSNA 1J8MF 1RJ9B 2HCJB 1ESNA 4URUR 1T3SA 2ZRPA 4C3ZA 4OI4A 1RKBA 4HDQB 1XEFA 2BOVA 2ODBA 2KSQA 2D62A 2GZHA 1GKYA 3DZDA 1US8A 3MFYA 4Q19A 4U02A 5AWFC 4PANA 3W34A 1VECA 2OXRA 1JB1A 3GJ4A 3N70A 1JQJC 4HUQB 2ZAMA 2V7QD 3EX7C 2O8BB 3GFTA 3MMPA 5JRJA 5DI9A 4LV8B 1AK2A 4LHVA 1JJVA 2EQBA 2GZDA 5AJYA 2HF8A 4JBYA 1TQ4A 1EK0A 2F1IA 2JDID 2G0NA 4HB2A 4BLPA 2VP6A 1HURA 5F3WB 1KI6B 2FEOA 2AD1A 3MSXA 3A37A 4DT1A 3BJIC 4MGKR 2XTNA 3MD0A 3NXSA 4BASA 5EP3A 5A5GA 2X19A 2ODNA 2VHCA 2ZRKA 3T34A 3R8FA 3GJ5A 2VF8A 2JLZA 1ZRHA 2P2LA 2J1LA 3FPAA 1CJKC 1CR1A 4MRSA 2PEYA 5P21A 3FE2A 3KJGA 1AIPA 3LW8A 3B6EA 4KYIB 1HY3A 5JI3E 3C16C 4WBSA 3UG7A 3EG5A 3X2SA 1R5BA 1RYFA 3UWOA 5F2EA 2PZFA 2WM9B 1ZVQA 3AH8A 1U98A 4GMDA 2Z6VA 1OYYA 3T12A 4DDTA 4PHFA 5IF9A 2JIZA 1TTTA 3CRVA 4KHZA 1P2VA 1OFHA 4XD7D 4IKEA 721PA 3GP8A 1A4RA 1BYUA 2FPMA 3KJIA 2H5EA 4KAXA 3RS7A 4TQAA 1HQCA 2B92A 1U90A 5CYPA 2RMKA 1OV4A 4CYMA 5DNYB 1IY0A 1ZBDA 4WXPA 3W3ZB 1OSNA 3GLFA 1KO8A 2J9RA 1M7GA 1XBTA 4OKSA 4UNPA 1VCIA 4W9MC 3SFZA 1NJFA 3HYRA 4XH9B 5TXGA 3MJRA 2VPPA 3ONWA 4RD6A 1DG1G 1ZM3A 2QL6A 2W2XA 1U9IC 4DCTA 2ATXA 3EW9A 3QOFA 4EPRA 5KNDA 3K9GA 4AYXA 3LV8A 4POAA 2J7KA 2R2AA 2RGBA 2GWHA 2ZI9A 4DLXA 1UFQA 1G3UA 2WKPA 4CEJB 2VL7A 4MDEA 1XXHB 1KAOA 4RFSB 1EWRA 4C0HA 2ZYWX 121PA 1CR0A 2HYIC 2IYTA 3FKSA 2P5TB 2PBRA 2V7QA 3RNLA 3WBKA 2ZU6A 1RE0A 1G3MA 2QAJA 4HB4A 4TLCA 4FWTA 1EFRD 3ZGXA 2EW1A 4NCJA 5FBQB 5DYGA 2P6UA 5BN3A 3MWKA 3C41J 3ADDA 4NYJQ 3QEJA 1N6KA 3TSWA 1MABA 2WZQA 4FMCF 2JLXA 2Q9BA 5EE5B 4ZCLA 4Q9KA 1XTKA 1DAMA 1HH4A 1CIPA 1ZUIA 2P5SA 1A7JA 2JJ1A 3HYTA 4JBWA 4P31A 3DMDA 1M34E 4FCVA 4EIWA 5JWOA 1R4AA 1ZU5A 4MDFA 3DO6A 3RSLA 3AF3A 2GETA 5E95A 3EZFA 3I5YA 4A2QA 5AUOB 3DKPA 2X2FA 1NI3A 3WMEA 2K5UA 3PV0A 1TEXA 2GCOB 2QRNA 4ZO4A 2X8AA 2O0JA 4ASUA 4AYTA 2QAGA 3SJZA 2W6JD 3K70B 4P32A 4C9BA 3R9XA 2ZI5A 3SS8A 3F8TA 1YRAA 1XZQA 1NRJB 2V3CC 3U3MA 5FL3A 2LKDA 1NBME 1T5LA 4Q9JA 5JEEA 4EDHA 2YNMA 4RFSA 3J81k 4GI7A 3X1DA 4M1TA 2UZIR 1T5IA 3R8CA 2WAXA 2YVUA 5EJEA 1Z28A 1E2JA 5K8LA 4GZLA 4ZKDA 4G01B 1FW6A 3ZD7A 2RGNC 5HE9A 2GDJA 5JSZA 3VR2A 2R6CA 4ZKEA 1AQUA 1SVWA 1SVSA 4MKHA 2O0HA 1OHHA 2GVDC 2ZRMA 3E1SA 4Q1BA 1ZINA 1XEWX 5JCPA 2WKQA 2HJVA 4PO8A 5EZ5A 2Q3MA 2IEYA 1R8QA 3AKYA 5FUWA 3CWQA 1S0UA 3UMSA 1M8PA 1Z2CA 2ONKA 1ZM9A 1JALA 1R6BX 3DKVA 3THXB 4AC9A 5DN6A 3IUYA 1E0SA 4HLUC 4EAQA 1Z0KA 5IK2A 4US0R 4HLDA 2DFNA 4JYBA 1CBUA 2YWHA 2UVQA 4HB0A 1XEXA 1IHUA 2O5VA 3RWOA 1CF4A 1GWNA 3PEUA 2GCNA 5FUXA 5DISB 4G5GA 3CLVA 4JSTA 4LBYA 3THWB 1CXZA 1O87A 1G17A 1MR3F 3KKNA 5H68A 1E9AA 1NMZA 2J0VA 1SXJB 4N0EA 2FE4A 5J5CA 3CUEF 5G53C 1ZM4A 4GT1A 2AN9A 5JHGB 3NBYC 1FMJA 1NIPA 3EWAA 4LC0A 4NZYA 4DKXA 3PG5A 3ZS9A 1JAHA 4YXWD 2OLJA 3H1TA 3V00A 1KDPA 4YONB 2Z0MA 1H8EA 1HA3A 1N25A 3HPRA 4QC2A 1JXMA 3VKHA 3A4NA 4HZUA 2OE2A 3AKCA 4CIDA 1FX0B 3VFDA 2BIFA 1MOZA 3Q5DA 4RVCA 4YDSA 2KI5A 2LKCA 2QPOA 1E9DA 1K5DA 1U8AA 4URXR 1GNRA 4FMCB 3RYTC 3O8CA 2WPDA 4EQ6A 1KSGA 3OE7D 2EWWA 3IPYA 2G88A 1Z2AA 5FTJA 4EFMA 2I4IA 1NY6A 1PLKA 1KI3A 1EFCA 1XD8A 1I4TD 4Q7LA 4YMVA 2CK3A 1IJEA 5FOTA 2ZREA 3EZ9A 4LC1A 3WY9A 4XWAA 1DAGA 2OUKA 3O8RA 2YC2C 4G1UC 1NN3A 1VKJA 3BFKA 3DOFA 2Q6TA 5FTLA 1XP8A 1NMXA 3B1ZA 4GOXA 1KI1A 2VIIA 5CDFE 1P73A 4QM7A 5E3HA 2JAQA 3U4QB 1QHHA 3GQBA 2VHQA 5ANRB 4ZDJA 1FZQA 1XPUA 1T4GA 4OK3A 4L4UA 2VSFA 4MYUA 2D4HA 5TV2A 1E2NA 3FMPB 1XMVA 3P27A 2GJ9A 3A1VA 4MRPA 1UBFA 3LDAA 2IX3A 4A8JB 3EPHA 4D0LB 1ZP6A 3U6BA 4AY2A 1AKYA 3AVVA 5E4FA 3AP3A 1QRAA 4V0NA 2FJUA 5B57C 4ESHA 4PZYA 1KNXA 3EASA 4ZV4A 3GLFB 2FZ4A 4YMTA 2B21A 1P62B 3CF6R 3K0CA 1BYIA 1MO3A 1XJCA 3QENA 4WZ6A 1VCOA 1UKYA 2DWOA 5KU1A 4ACAA 1U0HC 4DCNA 2GK6A 4DIDA 5GJCA 1SQ5A 3WHLA 2GXUA 2ZSEA 1VTKA 2Z43A 4JL8A 3OFND 4PC6A 4D0NA 3L2OB 5TB5A 3K0EA 5C4GB 2J0UB 3MWYW 4A92A 1YR6A 3RRYA 2IYSA 4E5UA 5SZHB 3U7GA 3K09C 4IEEA 1P2SA 5FBWB 3QE0A 2XSZD 5JCZA 4XSHA 4URYR 1G8FA 4XWKA 2PEZA 1ZM7A 2A7QA 2BV3A 4M1OA 2MMCA 4DDWA 3TW8B 4HAXA 3ZIAD 4TYNA 4Q9IA 4TYYA 2GCPA 4JJKA 3RS3A 1QHGA 1DO0A 1YKSA 1YZQA 3CBQA 4US2R 2RGAA 1XMJA 1M1YE 2DFKB 2CDNA 1EXMA 2FZLA 1YZTA 1VG0B 3QNUA 4HB3A 5C18A 4NONA 2JDIA 3GLFE 2WWWA 4ASUD 1UBCA 3C4JA 3OEED 1EFRA 2SHKA 2UZ3A 3OFNA 4U7DA 2HCBA 2ZS9A 4LGMA 3B60A 2HV8A 4Q47A 4A82A 2VBCA 3RRNA 4US1R 4BPBA 1F3OA 4AD8A 3TRFA 2ZU0C 1UEJA 4HYYA 2QE7A 2PCJA 1E9CA 1Z07A 1KI9A 4KFTA 2JJ1D 3GLGA 2BDTA 4CEIB 3I8SA 2PT5A 1U99A 4UJ3A 4H9GA 3RWMB 1XD2A 3WP0A 1XTSA 1TAGA 2C5LA 4HUTA 3GEHA 3BOSA 4LRWA 4LBWA 2WMNB 4PAOA 1YQTA 1P7CA 1OB5A 5BN5A 2BBTA 4MA4A 5AUQA 1X86B 1QG4A 4AKIA 2JJ2D 2IK8A 1OIXA 4B71A 4DSTA 1R5NA 3KQUA 1HEIA 4BZPA 6Q21A 2H1LA 1H8HD 1P72A 4K81B 3VR4A 2IC5A 2F7SA 1KTVA 4TL9A 4EFLA 1AGPA 2C95A 2ZJBA 2JLUA 1VDZA 4MKFA 1RRPA 3JZMA 4B3GA 3SEAA 1NJGA 4PQYA 3T1QA 2C77A 4BFSA 4YDHB 1F2UB 4B32A 2CCKA 3CX8A 3JVVA 3K9HA 1MV5A 2WSMA 5JJIA 3EAQA 4KODA 1ZNZA 3EZ7A 1KOFA 4BRUA 3AQ4A 3VR3A 4TZ6A 2VRWA 2IHBA 5JLJA 4C7OB 3Q7QA 4BFVA 3QPUA 3CKLA 3MWLA 4HAVA 2VO1A 1M2OB 1SVMA 1MKYA 4B35A 4QBIA 1EFTA 2OAP1 3GFOA 5DH9A 1ZCBA 4ILEA 3CO5A 2VTKA 3EPJA 3K0AA 1NLZA 4TL6A 3LX8A 3TJZA 2X2EA 4MYHA 1GOTA 1U2RA 3FDIA 1KK3A 4IXNA 1CEEA 5IT5A 4DSUA 1DADA 2GCOA 1GRRA 5KDLA 1W2GA 3RC8A 4RZXA 3W8RA 3C14C 3CR7A 1O3YA 4LUCA 1KK1A 1PZNA 3CRQA 1QZXA 2VSXA 2MSDB 2IWHA 1TNDA 3ND9A 3C7KA 1YZLA 3X1XA 1KIMA 5JEDA 4D6PA 2OO7A 1F60A 2GA8A 5EE1A 3G5UA 4JMPA 2FGJA 2HXYA 1KJWA 1OH6A 1RRGA 4KU4A 3S1AA 1WP9A 5GJVC 4KVAA 1GL9B 3SBEA 3R20A 3PR1A 4DEXA 1G18A 1BO6A 2CLCX 2WJJA 4JLBA 1Z5ZA 3IIMA 4KSBA 3U44B 2GEVA 4QJ4A 4TLBA 4F4JA 4MQBA 1JR3A 2C03A 2WJYA 4NCHA 1PV4A 1Q21A 1HTWA 3JZAA 2A78A 4B2PA 1ONBA 1WCV1 1Z6YA 3DM9B 4D4KA 3K0CC 2V54A 3I5XA 1DAEA 3N5CA 3TUJC 1LVGA 4G5RA 3AVYA 2IUSA 4PC7A 3BB1A 1N6HA 3LBNA 1ZYUA 4M1YA 3BD9A 4XOIA 4I81A 1NMYA 4XWOA 2CL7X 5HTKA 2B6HA 3QXCA 4UJ5A 4V0LA 4F4IA 3L0IB 1A1VA 5FL7A 4ZDKA 1KJYA 2W6IA 4JVMA 4A8JA 1KSFX 1EGAA 1G3QA 1G7SA 1PJRA 3L0SA 2OZEA 4FMDB 4Q7JB 3ZVNA 3WYGA 3HU3A 3R7WA 3FOZA 5B2ZA 3U5ZB 1XNJA 1WDTA 4Q4JB 3ZZ0A 2YINC 4RD1A 5KNBA 1LFDB 4R98A 2V8OA 4KO8A 2V4ZA 1XCMA 1D5CA 2A2ZA 4M1MA 1R2QA 4A9AA 2GVZC 4PQRA 5CIWA 3U7HB 2XGJA 5JJKA 1U81A 1Z6TA 2G1JA 1TQ2A 4TMXA 4OYHA 1XJ0A 1Z06A 3A4MA 3IBGA 3LWNA 2B7CA 4M8NE 2ZR9A 4RCZA 5K8TA 4I1UA 3M1IA 3NBFA 3BE4A 2EFCB 2NO0A 1D9ZA 4B2LA 1T8TA 2PT7A 3BK7A 4KFRA 5CIQA 3T1TA 2IEZA 4LZZA 1MABB 4A0HA 2V6IA 1EWQA 4NE2A 3CF2A 2ZE7A 4JLMA 5FOUA 3TQCA 2ZM5A 3AUXA 1W7AA 1Q1BA 4PZLA 1XMIA 2LCFA 4WZAE 4BFTA 1DE0A 3B1VA 4B43A 1VYTA 3KKPA 1TU3A 4RSGA 4PFSA 2BKUA 2GEDA 3AB3A 2CEAA 4A8JC 1IN4A 2RGXA 1FUUA 3CNLA 3AF0A 2IS2A 1CJUC 2BCJQ 4NYJR 1W48A 4A6PA 1E2IA 1P61B 4P4UA 1KI2A 1DS6A 3IHLA 4M0LA 3SHWA 1G7CA 2ORWA 3QQ5A 1KZGB 2YOGA 3L82B 2BM1A 2EYQA 2IXFA 2WVJA 3H2YA 4MGIR 1CJMA 4GOJA 1E0KA 3W6PA 2O8FB 2GJSA 2XB2A 2ZS7A 3W5JA 4M9SA 3K8YA 3CW2A 3LLUA 3FYHA 4IDHA 2OILA 2C99A 3K70C 3VAAA 1RVDA 4XVQA 3T5GA 4C0SA 4Q1DA 621PA 4NH0A 4EFNA 3W9YA 2ERXA 2R6DA 2BMDA 2LWIA 2WV9A 2ZYUX 2YYZA 2IUUA 3EIEA 3P4XA 2FSHA 1KO5A 1OYWA 4YMSA 1TPZA 1VCNA 2ASEA 4QGGA 4IOJA 1TADA 1N5JA 4X8MA 2G9NA 5EXXA 3WYFA 4UNRA 2QTFA 1YJ5A 1XEWY 4V0ME 4ACBA 1NN0A 2Q3FA 1KAGA 1N0WA 2KB0A 4Q01A 4UNNA 1F5NA 3PIRA 4AG6A 2N46A 5TARA 2FFHA 1VIAA 2PMKA 1NVUQ 1L8QA 2IYZA 3I92A 4BGDA 2AR7A 3SDZA 3LXRA 4LY6A 2JIZD 1Y63A 3IBYA 2ZUBA 2ZETA 4WIAA 4CF7A 4BQSA 4HAYA 2KWIA 3NC1C 1MRSA 2IYVA 3NWJA 2JLWA 1P9RA 2VHUA 4Q1CA 3GJ8A 2EFGA 2ZTSA 3KX2A 3VHXA 4X8LA 5SZIA 4KYUA 3PITA 3FVQA 2R65A 4NYIQ 1EX6A 1E96A 3F3YA 2QAGB 3SQWA 4LHWA 1Z08A 3QXSA 4BEJA 2BC9A 1T3LA 1E9RA 5HKKD 2QTHA 3KKMA 2YKGA 3OIVA 1AS0A 4HATA 1WQ1R 3PJRA 2QORA 4Q4AA 3H86A 1SXJC 3KUDA 3NDPA 4B34A 4G5OA 2QQEA 4ZCIA 1RRCA 3EZ2A 4RD3A 5KOYA 2XNDA 3RS4A 1W36B 2QSYA 4Q03A 3SC3A 1UDWA 3CZPA 1DO2A 4E07A 2CVFA 5FTMA 4OHZA 3SNHA 1NVWQ 1Z6XA 2ZS8A 2AXNA 2PJZA 3B5JA 4IW3B 1R0WA 2IT1A 4LJAA 3NTUA 3UATA 2DB3A 2WOOA 2GXAA 1SXJE 1D9XA 4TN1A 5L8VA 2C04A 2KBEA 1I2DA 1Q57A 3RAPR 1II8B 3OAAD 1W36D 3BH6A 2ZI6A 5J4VA 3TVTA 1KNQA 2F55A 4AK9A 2ATVA 4KI0A 4UXJA 1QG2A 3T06B 1GITA 2W6ID 8OHMA 2FPKA 3MWJA 3S1AB 2PZEA 4F7WA 3OAAA 4OHXA 4LK2A 3FHOA 4Q18A 4D4JA 3I61A 4NPHA 3BH0A 4BLSA 1X8JA 2QPAA 3Q9LA 2YV5A 4KJZA 4X8OA 2ZRCA 2P67A 4V0KA 1E2FA 3K09A 1G21E 2GBLA 3QPVA 2ZRAA 2FH5B 1KK2A 3C8UA 1GRNA 1JNYA 3QF4B 5FBLB 5EUQB 3NC0C 1XF9A 1JXOA 3KKQA 2BMJA 2B7BA 2IF0A 3QKUA 4A0GA 4C2TA 2KJQA 3CNOA 4NMMA 4PSVA 3SN6A 1E4YA 2VF7A 4G3XA 3TH5A 1NF3A 4DLTA 1W4RA 5BXQC 2ZRGA 1N6IA 4N3NA 2ZUCA 4KITB 3P1JA 2H57A 2CHGA 2BBWA 2BMEA 3DM5A 3MG9A 3V4FA 1W0KD 4JLDA 3E70C 2J7PA 2JLVA 3EC1A 1C1YA 4G0NA 3KTAA 4URZR 5EP1A 2FOLA 1KSJA 2BEJA 4YQFA 5IDVA 4S35A 2EVWX 3F5FA 1IAQA 3HR8A 4QXAA 2CHQA 2D7CA 3FKSD 4PTLA 2QBYA 5HKKA 1OH7A 221PA 2CBZA 1HQYE 1WA5A 2GHIA 4BLTA 1XCGB 4GDFA 1Q12A 4WOPA 2XSZA 3NH6A 2QNRA 3AF1A 4ITRC 5AK0A 1SGWA 4RKEA 3W8NA 2F9MA 5L3SA 1ZNWA 1IN7A 1XTIA 4M22A 4M4SA 2W58A 4O2LA 4QHTA 3KQKA 2IS6A 1W4AA 3ZQ6A 1N5LA 4KVGA 4TLAA 3TR0A 1IQPA 1G6OA 2CLSA 3AKEA 5HCNA 2X77A 2W83A 4K8OA 4II7A 1Z0AA 2NTYC 2XXAA 1FTNA 4JIMA 4V0OA 4Q9LA 2WWHA 1GNQA 2BJWA 4KCGA 5KO2A 3VU9A 2XOKA 4FI3C 2OFXA 4OI0A 2QMOA 2C8VA 5HR5A 5CYOA 5KSYA 3EWSA 1RFLA 1XDBA 3CPEA 1ZM2A 4GZMA 4P0TA 1N6LA 2ZSAA 4BEBA 2RGEA 4ZIRA 1OKKA 2TMKA 2IYXA 1XD2B 4JLKA 3BC1A 4MRNA 1B0UA 5J4LA 1RJ9A 2WPDD 4NYMQ 4PSAA 1VMAA 1E1QD 3GEIA 3LD9A 4J0QA 2OG2A 1I4DD 4OL0A 4MGZR 2FFQA 2JLQA 4Q02A 5DHAA 2CHVA 3X1WA 4DEYA 2CVHA 2GXSA 2RB4A 2PLFA 3GLHB 2FG5A 1E1RA 2ZJ5A 3VKWA 3PEYA 2A5GA 2HF9A 4W5JA 1TUIA 1G8YA 4FW9A 5AJXA 3RSOA 1F2TA 1E6CA 4A0RA 1KO4A 2FMXA 2ZE6A 3SYKA 2YWFA 1UKEA 2EU8A 4CGZA 2ZIAA 1JJ7A 4MKIA 4DLWA 4TMZA 1Q1EA 1OJLA 1YR8A 2CCGA 3MLEA 3SQXA 3ASYA 4AYWA 1P75A 3ZQJA 1YVDA 1R5OA 3HU1A 3DVLA 4MKGA 3AVQA 1YRBA
chains in the Genus database with same CATH superfamily
1QCYA 5EZYB 4KNYA 2JCSA 3N7TA 3SYLA 1BZYA 3CUUA 3K5WA 1HQKA 3T3DA 5LXTB 4JR2A 1XZIA 4OX9B 1Y6QA 3QNWA 4L08A 3TKLA 3UMGA 5H59A 1KS9A 3GJ0A 5JXJA 2HWKA 2GLXA 5ARBA 1RHQA 2P9CA 1WB4A 2Y0DA 1R88A 4RVDA 3ZWVA 4H2DA 5LOVA 4WRRA 5FLKA 3FSGA 3TDKA 3W79A 2CJFA 3U1VA 1RRFA 4A27A 3F7NA 2C61A 2I03A 3LH5A 4M2LA 5K3BA 3ZY3A 4B82A 2W00A 1EX7A 3INNA 2J9XB 3ZEIA 1XTPA 2FPPA 2Z8YA 3NJ4A 3BKWA 2QI9C 4G36A 3QFTA 4Q9AA 1FNNA 1SC9A 3Q40A 5G4KA 4E7PA 5ULLA 2EFHB 3V34A 4UKDA 5JZMA 3FSEA 3AHIA 1USUA 4I50F 1F9AA 3OQVA 4TYMA 4TYQA 4U2FA 4YO8A 5CA0A 4A10A 3K72B 4DPLA 3IE1A 1RZUA 2A86A 3PBKA 1CZRA 1DXYA 5EC8A 2DFLA 2HCRA 4KOAA 1QHIA 3HN6A 2X9VA 2SICE 1Z6AA 2RGNA 1E79A 3F0TA 3H5WA 4Q4LA 2VYFA 4IDCA 3L8HA 1QHEA 2HHLA 2XUJA 3NBMA 1O94D 5CH8A 3CGGA 2Q5HA 2LXNA 3DONA 1EDBA 2JZNA 3ESZA 4JB3A 5IKMA 5JAUA 4BLWA 4N48A 1U1IA 5IM5A 2W6JA 1NA5A 1UBHS 1ZJYA 3MCWA 3STTA 2HT6A 1DPGA 1MRNA 4PO3X 2V96A 5EQDA 3F47A 1DEKA 1EESA 1TMYA 5E6UA 5KVSA 4F8EA 1NUUA 1XRQA 2J07A 4U00A 3L0CA 3P0JA 1B3RA 3U4QA 3BTSA 2ID8A 4N6OA 5LLSA 1LQUA 3N0VA 4FGLA 3VHRA 5D84A 4V1CB 4D9JA 1E7MA 5A6SA 1F14A 5A5VA 3H05A 3NCHA 3OJXA 5BRJA 3O73A 1FFYA 5EUMA 1O0CA 2P9YA 4BB6A 5CYGA 3IUQA 3DBOB 4JOCA 3A31A 2F1JA 4KNWA 4OYLA 4B75A 5IN4A 2BZ0A 4KFUA 3MWDB 1U7WA 1JMYA 3MW8A 1QE5A 5BPHA 2I87A 5E0KB 2XW6A 4AL4A 5A04A 4PPFA 2DPXA 3ZV6A 1EE2A 1SBYA 5H02A 2B3TA 421PA 3GFGA 4GX2A 5GINE 1KMHB 2QQ5A 2OVBA 2R11A 4Z4EA 1MO6A 1YKFA 1PV1A 1XZHA 2NO9A 5EINA 2WIGA 3A1CA 1TK3A 3H3JA 3B3FA 1ANKA 3IJRA 5U4QA 4BJHB 2XX3A 2QVGA 4MVJP 1KORA 4AFNA 5HKAA 1ZKDA 1ZOIA 1UIRA 2UUOA 5TMDA 4TT3D 3T5PA 1O08A 1PZHA 2AFIE 3PHIA 3CE9A 2FRXA 1IN5A 4FR2A 2DSTA 1T4MA 2ZSDA 3DHWC 3NTQA 3AHDA 1G98A 3F3SA 5DX0A 3SLKA 4CMBA 5HJEA 1UC5B 3PEEA 2WSSD 3GCGA 1ABEA 3CSDA 4PO9A 2O1XA 4C0BA 2WJHA 4FYIA 4O3MA 2ORVA 3WQBA 3V9PA 1UK9A 1JHOA 1S4QA 3I42A 4TRNA 4MQUA 4WFQA 1YQWA 5EOVA 1KDTA 1Z0IA 1ZMTA 1XP5A 2CNNA 3DCNA 3HU2A 2HA7A 4X97A 4ZI7F 5BW8A 1BJKA 2JFUA 4P3YA 2EJCA 5GWXA 3ONEA 1QYIA 4C22A 3CH5A 1MF7A 1P9NA 2O57A 3KQNA 2EF0A 3FF4A 1A5BB 4PYLA 4Y2TA 3OJOA 2QL9A 3WNBA 2P2GA 4ETNA 4GE3A 4J8PA 4R8KA 4NEHB 5GOTA 2DQ4A 1W52X 4Z9AA 5ALGA 1GCGA 1GQRA 2AYXA 2XMPA 3C87A 4DQ0A 1MO4A 4MV7A 2VT7A 2F3QA 5IZCA 4NY1A 5B2FA 3S1SA 2VT2A 4R2WA 5C46F 2WWTA 2K87A 3PSAA 1FYVA 1G8KA 4JK3A 3FWYA 4EG8A 2VEDA 4I9NA 2QZ4A 2P68A 4MQMA 5ALWA 3CJQA 3IP7A 4GBMA 3SMQA 1UKVY 3X1ZA 2Q4TA 2J9FB 3N8IA 3U0BA 1GTVA 4IIFA 4EJ0A 4EVIA 1HETA 1SD2A 3ADOA 3DAHA 5CX4A 2QBYB 1NW6A 3ZIUA 5DXJA 4I5FA 3C6BA 4EPYA 4WKPA 5AKIA 1T9BA 2EL9A 4M0DA 2BSXA 2CZCA 4JYCA 1Z7YA 4FYWA 1NV9A 1MEOA 3KTAB 2RE8A 3H6HA 1Z83A 3PXAA 4Y0VA 4YCLA 3KVVA 2RG1A 4GVLA 1C3EA 1J6UA 3E2MA 3HGTA 1XVLA 3GLQA 4P7JA 4EPVA 1U0NA 2OCXA 3GEDA 1AZWA 2CNOA 3QMWA 3PPIA 3WLKX 2FSVA 1KRHA 3RC3A 5L3QA 4HSEA 3U3KA 4X65B 2FZEA 4ESVA 2GKGA 4S05A 3BXGA 3OPVA 2JRCA 1UIMA 3UYKA 5K0SA 2GM3A 2YV1A 3JYHA 4P4SA 3QE9Y 1GZSA 1JJFA 1LPPA 2CNLA 2GN6A 3GRKA 4Q4JA 4GICA 1G1MA 4RNCA 3RUDA 1GTZA 4WXMA 1ZNQO 2OGWA 2X0JA 4PZCA 1ZH0A 1DZIA 3H1BA 4G65A 3UWSA 2B35A 1MDFA 3JQ9A 2QQGA 3W2EA 3HDVA 1XVTA 2HA4A 4EUNA 4CLXA 2VPWA 2QRQA 4ED9A 1Q84A 1RWBA 2W6ZA 1MCZA 2P75A 3ENKA 4B48A 1IEWA 2XZTA 2ATIA 1X1DA 4TSFD 1MB3A 5AOAA 1PFGA 1NU6A 4BRZA 1PCXA 1H1TA 5E9JA 1E0AA 1VYUA 5EE0A 4AKSA 7MDHA 3EIWA 3A9UA 2TSYB 2W9XA 2PX8A 4RZ2A 2GFQA 2I78A 4QUEA 3HFGA 5HZGA 4MEAA 3GZJA 6REQB 3LBHA 5AVXA 3OZEA 1PDVA 3TLEA 5I7FA 3K20A 5EIOA 3UB3A 1PJ2A 4JUFA 4Y18A 3UXMA 2ZIGA 3HL0A 3CVJA 3TE6A 4JZKA 2MR6A 2RBEA 3NRCA 5CFMA 1PQUA 2QP3A 4J7CA 4Q00A 5BURA 1FFEA 2H65A 4H4EA 2F6RA 4I2VA 1FS6A 3ETJA 4DR1B 2NW6A 3N6RA 3UKOA 2FPOA 2IEGA 3PJFA 1XZAA 1Q0LA 1SELA 4YAKA 2YHAA 4J1NA 4CI9A 4DNPA 3QTLA 1UZAA 1PT9A 2BMFA 3BIXA 3DP9A 4EB3A 2PUJA 4DGQA 1X38A 1E1LA 5EE3A 4F21A 1B4DA 3HMKA 1YD7A 3ZXXA 2XDYA 3EXEA 3UANA 3NIDB 3MT8A 3ANXA 3DBLB 4H7FA 1M2NA 3TBHA 4ABYA 2O0LA 3B38A 2RFLA 3WMGA 1ULSA 3EYWA 2GRAA 3R5HA 3IBFA 2PTGA 1SKYE 3CRW1 1OC2A 3FGNA 1PJ8A 1GRVA 5I7AA 3SYNA 2I2AA 4AWAA 1EUZA 3VR6D 3GLGB 2ZXFA 1VSUA 5B58T 3IT0A 1NMQA 1JE1A 4OHMA 2XDAA 5I7RA 5KC8A 3DZCA 1NSYA 3JPYA 2OHJA 5KQGA 1G8MA 1NI4A 2GRJA 1XDSA 3JYNA 3OCWA 3WLHA 2XXAB 3QBDA 1Q92A 1TYDE 3STUA 1G8GA 2J67A 4Q48A 1KVUA 2F43A 4ZQFA 2HD4A 3FYUC 4W8GA 5I3CA 1OT3A 2YN4A 3LQ2A 4UREA 2X42A 3CRMA 3VNRA 1DEAA 5DW3A 5BVGA 4AY6A 1Y42X 3IUEA 1J2EA 4Q12A 5DNVA 2H4WA 4FMDF 4A0FA 1XYYA 2FPLA 1AS3A 3C5EA 5G41A 4D9EA 4B4WA 2FPPB 1ZU4A 2BFCB 4KDFA 4BNFA 3K0FB 4RLFA 5JSYA 1J1UA 1JFFB 1R12A 1CUSA 1UUFA 2CVOA 2QUBA 1BROA 1C9NA 3KV3O 1C0EA 2V55B 2D5CA 2F67A 1RJEA 3WGNA 4A8TA 5IAGA 4BGUA 1U11A 5T41A 2HLDD 5L3VA 1Y9DA 5AM4A 1NVVQ 1MU0A 1NURA 1Y5LA 5FOXA 3CRZA 3C6KA 3H2KA 2DTXA 4GRAA 4Y8VA 4LJ9A 2BH9A 2QLMA 4B3XA 1D2HA 4XJVA 1T8UA 3L7MA 3N6VA 1VJTA 4FJ2A 1ESDA 1CLUA 4ZREA 4ZQBA 5JAIA 2R62A 3BD6A 4RELA 5KHOC 5ELXA 1LLCA 4CT5A 2NG1A 5GJBA 2FMIA 4Q16A 5FLYA 4JLJA 1J8QA 2FETA 4L3OA 5ILGA 5IT4A 1FYFA 1YCDA 3DLAA 1Z73A 3AVXA 1GUZA 3Q3IA 2XJ9A 4JP2A 2X6TA 4QU0A 1NAHA 1YDMA 4UM5A 4C7MA 4DFDA 2CYCA 1M2KA 2Y4NA 4UUAA 1KY2A 2DFTA 2ZVQX 1C7FA 1KSHA 3FTQA 3GPBA 3TW6A 2I3BA 3E9NA 1QCCA 2A9FA 1E58A 3GLHA 2X40A 1BGWA 1VPEA 3T4PA 3PDIB 3C15C 3GW8A 3Q3CA 5AVSA 2LGJA 2VP2A 2W2OA 2FF7A 1L5OA 1I5EA 3LXUX 3QTBA 4FIDA 4NR0A 5GAJA 5CFZA 3P2KA 1E5VA 4EY6A 4QREA 4HZIA 3COPA 3DV0B 4GGPA 2VQDA 1GUBA 2AOTB 4BIMA 5C3MA 3DQPA 5GTDA 3WOVA 3LHSA 2DHDA 4FX5A 1CUEA 4ZC1A 2CDAA 5TF0A 3ZJ4A 3ZWDA 4EEKA 4RU1A 2GK4A 1DUSA 4YHHB 1M66A 4CKYA 2GHRA 5DB4A 2P11A 3D6TB 4HH4A 1QHHB 1KQOA 2PGIA 3LWDA 4RPKA 3FSRA 3WBJA 3ZWOA 5JASA 5JH7B 2RHDA 4UE6A 4PNHA 2Q1XA 4EJSA 4L78A 1ODCA 1FU8A 3AI2A 2I7DA 2COUA 3ACCA 2Z4SA 3UWKA 2VBIA 3AUYA 1LPMA 5HBGA 3RIHA 2PWPA 2D1TA 1SK9A 5HSGA 5IXSA 4MS3B 2BGWA 2Z3ZA 3RKRA 2L42A 4UUPA 4WHMA 2AV6A 1QO7A 1IY8A 3JRXA 5DGXA 5L4SA 3DDCA 1AKUA 1ZUWA 2I3DA 4KAFA 2OUIA 2YDXA 4Q7EA 1YI0A 1TU4A 1B0PA 4XGNA 4QTTB 1SU7A 4CM8B 3A70A 4DC9A 2P0EA 1NSTA 2F8SA 2JBWA 2V7XA 3BGVA 3BIWA 3PUWA 4ZO9A 3VYRB 5J4KA 1H66A 3VTKA 2NU6B 1QF9A 4MVWA 4BNJA 3KYCA 3A0UA 2D2EA 1MXFA 4DA4A 3SQOA 1G4HA 4YREA 1HLFA 2HNAA 2XY4A 1JMKC 5GP1A 2BDEA 5GZ3A 1CR6A 4YJ2A 1D0VA 2VJBA 4CKBB 1FNMA 4XB2A 5BN3B 2IOFA 2VXYA 3TCXB 4G07A 5CHYA 1GGMA 3IQWA 2BRUA 1SB8A 4J0FA 5CLJA 3DHYA 4TRJA 1JEJA 1EA5A 2NU9A 1ETHA 4KO2S 1CE8A 4X3PA 1H4VB 4P4SB 1OF1A 2HA0A 1OI4A 1VBMA 3AEYA 3HPQA 1X77A 3THYB 5DK4A 2VRNA 3H3XA 5BY2A 1T34A 1IUOA 4MS4B 2AHOA 2QZJA 4OJYA 3S2YA 2OESA 1P80A 1W1UA 2EQAA 3HBLA 3WNCA 1J25A 3TB6A 2WABA 2R8XA 1K8QA 1ODIA 1QJ4A 5JPIA 3RU2A 5KX5F 3OJLA 3HBNA 4ZPXA 2ZQ5A 1AQ6A 2D59A 3Q1KA 1XFAA 2NZYA 1BHSA 1VIMA 2CL5A 3PIDA 4ZTZB 3VU1A 3FKJA 3E53A 4KX3A 4IAOA 3JD4A 3LO8A 4GD3Q 1SB9A 1VM6A 3N3AC 3PXGA 5BQFA 3M81A 4RQBA 2QT9A 4YRLA 4ENRA 3QV1A 3REOA 4HPXB 4CT4B 2EHJA 1QR2A 2DCUA 2RKOA 1TD1A 4Q66C 5H0IA 3URMA 2CZGA 2IW3A 4TTSA 5DOVA 3WISA 2H31A 4CF4A 1T8SA 2FNAA 4ETMA 4BLRA 2QZ9A 3QKTA 4C2BA 2BKEA 2FI1A 4MTCA 4OMFG 4R6XA 3Q6IA 5B7NA 1HE1C 5DHRA 2Q45A 4KUGA 3ZCQA 5DO9A 4MARA 4YRJA 5DP1A 1YIDA 1XXHE 1QGAA 2OXEA 5C8ZA 2C96A 2B8WA 2JASA 2JLCA 3O84A 3PCRB 5COBA 5TVKA 2ZEJA 1RWVA 5LKRA 2CLDX 3BQ9A 1R0XA 3BWCA 4OMCA 1Z0FA 4UAJA 1UR5A 3EY4A 3UCXA 4Z86A 2AL7A 3IE2A 4F4CA 3HXOA 2HCFA 2ZR7A 4BFYA 1JVBA 4TV9B 4G0WA 2VP9A 2PXCA 3H5OA 2ZSBA 2J0QA 1PHPA 5TF4A 4A36A 1R4NB 2VJOA 4WK0B 4EUFA 2R8YA 4BLOA 1UBEA 3HVUA 3IOYA 1VCHA 3U13A 3U31A 1SU8A 3NAMA 5JDIC 2JEOA 1XRMA 1LUAA 1WXDA 3FNHA 4HTAA 4ZOBA 2ZBFA 2ZUTA 1G64A 2XD4A 4JNCA 2YY7A 1TX4B 3DL7A 1N1MA 2W90A 3E3LA 3BREA 1O96A 4AJLA 2W37A 3ZV5A 4OUDB 4ID3A 1DV1A 5DT9A 5IVPA 1RD4A 2I6UA 4FGWA 4QOHA 2NQ2C 4U2BA 5JSQA 3IVGA 5K3AA 1TVMA 1DIGA 2XLBA 3CA8A 1LI7A 4DHEA 1ESEA 1XVIA 3DSRA 1GQQA 4FCWA 5KCMA 1E9BA 3K5IA 3NPAA 2C5SA 3UOWA 1NKSA 3OVMA 4LRYA 1WWKA 2ODEA 5DKFA 1TYBE 4FT4A 3RJ9A 1LXCA 3MIIA 3EOAI 3IELA 4Q3KA 4TKVB 3RUHA 1YU9A 1YS6A 5LR6A 3CM0A 1XDDA 4XUEA 1YZKA 1I36A 2JW5A 3PDWA 1HE3A 4DLSA 3AUAA 4ZIRB 3A6HA 1R0SA 5KYYB 5CDUA 1DJMA 1KARA 3S27A 3TLXA 9GPBA 3NWBA 1AQNA 4OQPA 2VTBA 5CA1B 2DR3A 2QG4A 2C7PA 1TD9A 3WWOA 4NK4A 2QX8A 4YRAA 3HM9A 1EXWA 3R77A 1SQFA 2P8SA 4EHIA 2BBOA 5AESA 1XPRA 3DLBA 2AJBA 4LJRA 3T1VA 4D7AA 3O3NB 1IBRA 3D6JA 1JDZA 4ZMSA 5IXJA 1WBBA 4ZYUA 1ZVKA 2BPOA 1BMFA 2UUCB 3GA7A 1FXWA 4QFBA 2YZ7A 3X1KA 5A3JA 2M6SA 2E0IA 4GEKA 4MTLA 5ALEA 2DF8A 5ALSA 3UENA 2OGZA 4LXYA 3VYVA 4CNQA 2QXYA 2PS3A 3MJSA 3PQFA 4QOIA 1CJSA 1QFSA 1MX3A 1X7DA 1SC3A 3HVJA 1U8YA 4PLVA 1KH3A 2IODA 2QU8A 4FFDA 4OHPA 1V1RB 3BHIA 3VPBA 4PLCA 4C14A 1P0FA 2NZ2A 4RHXA 5K09A 4UM9D 4L8LA 2F43B 4FOSA 1DINA 3T9FA 1RMTA 3AGPA 4KQIA 3M6VA 3PICA 3PYXA 3FG9A 4QPCA 4QX6A 1SHZA 4CLRB 5KQPA 3QUCA 3ZGLA 3AERA 5AMXA 3ZLUA 3H8WA 2AXQA 1KKMA 3N28A 3NS7A 4D8TA 3G7NA 3AXSA 4FC7A 3CY6A 1E0JA 5AKJA 3R5TA 1SKQA 3ES9A 1X7HA 3N2KB 4G84A 4GPTA 4TV8A 3LVRE 1CG6A 3GOHA 4UULA 3KQLA 4BNHA 4FJ0A 4AS1A 2O54A 2HI0A 2HPZA 3I76A 3CURA 4MSUA 3LPNA 4G6ZA 5CA0F 2LD4A 3OPYB 5JY6A 1H2YA 2WTXA 1JHRA 3RVKA 3W0LB 2E21A 521PA 4CLHA 5FCDA 1NZFA 3HUUA 1COWA 3VR4H 1YAJA 1FS4A 2QMUA 4A7PA 2X0RA 5IRCD 1GPKA 1MIOB 1R10A 1XAJA 1XLVA 1Z6GA 4HXGA 2PUCA 5EWLB 5U9CA 4LDJA 3HYLA 4FQ5A 2YWEA 3PZRA 4F04A 4DEVA 3KKLA 3PHLA 4M1SA 1CUWA 5EERA 4AQ7A 1WXHA 1OH8A 3FR7A 2JHCA 3HXPA 2Y8EA 3AI1A 3PUXA 4JLUA 5IARA 5UKDA 1J09A 2VK1A 2ZW9A 1ONNA 1I30A 4N5DA 5FXMA 3ROMA 4FGZA 4BZXA 3RYCA 3ZDAA 3GHHA 3LPCA 1AZSC 3HL4A 4UTVA 2OOKA 4I2NA 3DFZA 2QM7A 1Q0UA 4WV3A 3RFXA 4F9EA 4P53A 2PGOA 2XKBA 3DOEA 3VVCA 2KLHA 3BXXA 1Z4MA 3WFIA 3I1JA 3LNTA 4L5JA 1KO7A 3B8HA 3FPHA 2H92A 4XIIA 1EM8B 4ZO6A 1NFRA 1BH6A 3HZHA 2EL7A 3HY6A 4OGKA 2PAFA 4ZGBA 2WTNA 3G1UA 1HGXA 3G9TA 2ZUVA 1DT5A 2YDYA 3DB2A 1LX6A 3WBFA 4V24A 821PA 3RBXA 4QECA 1ZOOA 2PKEA 4N6GA 4D46A 3LAWA 1P33A 3TVYA 4HGYA 4MS3A 1WTAA 3WGMA 4YRNA 5IM4F 4AW9A 4ZOCA 4BMDA 1V6SA 4DR7B 2Q21A 3D7KA 3MQ4A 3N2LA 3DZFA 4BVHA 2WWIA 4RMNA 4FQ7A 3EE6A 3WK9A 2L2QA 3BM5A 1Z4OA 5IPFA 1XCPA 1P7WA 1JHVA 1MZPA 2I2DA 4RYDA 3CT4A 5C8YF 2H5IA 1IRXA 1B8PA 3D4IA 3I9V1 4HVTA 3NBKA 2NU7B 1PR9A 4EF6A 3UPUA 1QH9A 3G5TA 4DYVA 3EODA 2J5RA 2PRYA 3I2GA 3O2SB 4NFLA 5JBQA 4KWEA 2QX9A 1VHTA 5AFSA 4E0BA 2P9GA 3JZIA 3L6CA 4FDLA 1TQ6A 3QOXA 4KPYA 1L5HA 2YJTD 2Q41A 4AJKA 4ROTA 5FBZA 1I7QB 5FJIA 6CHYA 2QGNA 1V39A 4V1CI 3P45A 3VYWA 1EP3B 1U8CB 5J59A 4PXSA 2VF2A 4ZHQB 1ZOSA 5BWBA 3DT9A 5DLEA 2JAUA 1TM7E 4A0SA 3UBMA 3ONFA 5HBRA 3TO5A 4QLOA 3CISA 2XRMA 3E27A 2I7XA 1QLJA 2QR5A 2QTLA 2Y4OA 5AVJA 4NBLA 2MSCB 1N7HA 4L6IA 4IHJA 4PLYA 1J8VA 3CZ9A 4AY3A 4IYRA 2QQ0A 3GQVA 4NTZA 4DQLA 1PBTA 3HR7A 4WSOA 1PR6A 3SIPA 1G16A 1FFHA 1FA9A 2QTVB 5EUCA 1IOZA 1UOEA 5BN5B 1IJKA 5CVVA 3GRCA 1K8RA 4MQ4A 3VNBA 2AFIA 3SF8A 1Z5OA 4YMIA 3DCIA 1YJAA 1JEAA 3OH8A 5KMGB 1Z0UA 2CYBA 2GXQA 3LYAA 4YDRA 2Y9PB 2BDUA 3QVMA 4BP9A 2NP7A 1XZGA 3DTVD 1OY1A 2VYVD 3LW7A 4L85A 4X66B 4OQZA 5BQ5A 3BGSA 3HKCB 2H17A 4HQRA 3AR7A 3WGKA 4Z7JA 1PAUA 1XLUA 2QI9F 3ELWA 4FLFA 1QGOA 1E69A 2W11A 1W5FA 2Q2OA 2P6OA 3NBQA 5KNCD 3BBPA 3IMKA 2QPTA 3T3HA 3ICVA 1KZ1A 4Q82A 3FPLA 4L5BA 1TVKA 1U8FO 4CRWB 4QJ3A 1O8CA 3REFA 5JH7F 2W2LD 3LWBA 2Z83A 4AO7A 2B8NA 2PX0A 1WMEA 3IVAA 4GXNA 3EIHA 1ZJWA 2G08A 3MYRA 1L7RA 4MV1A 1KMHA 2OV2A 2O2SA 1QZUA 4DNQA 1Z8DA 1I5OA 2FW6A 4EKNB 2OVFA 1SIWA 2XNCA 3L04A 3OSUA 4GBGA 4KTVE 4U9UA 1N57A 4PPQA 3BB3A 3ZD6A 1C8BA 1EJBA 1V45E 3QEMB 2C9CA 1P19A 4UHDA 5AI5A 4YYZA 5MFPA 1WU7A 3U56A 2ZDGA 1OR8A 3X2FA 2CXPA 3EQ6A 4NQZA 1JFLA 3TG2A 2A7XA 3ZS8A 1SBQA 2ILTA 5HQ3A 1N3IA 3AT1A 3BJMA 3MERA 3AEKA 4J0IA 4CTNA 3K4HA 1U63A 1Q0QA 4K9DA 4REOA 5FV7A 5DNWA 2W4QA 3V33A 4CR7A 2ZTHA 4CUJA 4EH1A 2PWYA 1TF7A 3HKDB 1WF3A 1NBHA 3SIRA 5BR8B 3RSSA 4E5VA 4EATA 2WD8A 5GJWC 5IVHA 4O2RA 4ALIA 1PGJA 1WPGA 4LJ7A 1N5MA 2D0PB 1OWMA 2LUOA 2XVAA 4OK6A 3VC3A 1W88B 4EKEA 1WD5A 1K7FB 4C0LA 2OQRA 1OTHA 1WXWA 2BGLA 2ODWA 4WA8A 4PO1A 5COQA 3NTXA 3KELA 2COEA 1G3IA 2XUOA 4HYTA 2ZI7A 3OQHA 2GUGA 2II6A 3EZGA 5H4HA 5HEKA 1MAWA 1NP3A 3TJRA 4JH0A 2HM7A 4LQ4A 5L7YA 5D7NA 2I65A 2HYDA 3T4XA 4QLBA 4TWZA 5J23A 3G2PA 3TK1A 1CFZA 2AR0A 5B1HA 4DWWA 4E1VA 2PFSA 3N5KA 1WPRA 4AQDA 3LX4A 2HRDA 3MJHA 3RREA 3WLOA 1RBYA 2CMFA 4CFYA 2NTEA 2FKNA 1PJTA 1JW9B 5WRFA 2NXEA 2EFEB 1EA7A 4CKEA 5AW4A 1QMPA 1JKFA 5CU7A 2Z8ZA 1PLJA 3PD1A 4QOSA 4R5MA 4XD2A 2I8AA 3OZBA 3R3VA 2HKIA 1O4VA 1W94A 3D5EA 3FPSA 4CEIA 3P19A 3W5IA 3TEFA 1HE8B 3O83A 4XE5A 1JQEA 1N2CB 3AZOA 4O08A 1Z4IA 3DE0X 4X6LA 2P1DA 2CXXA 2HC9A 5E7MA 1BG6A 1GZ7A 4RV4A 1CJTC 2FUG1 2JLYA 3DF9A 5LXTA 5HKOA 1T15A 1T2EA 4K7JA 4Q3EA 2B3DA 4RK6A 4S1NA 5I9IA 1E7SA 4Z8XA 1VCMA 4GO1A 2WDPA 3EK2A 1SAYA 3WKDA 1BFDA 1XTZA 3AMVA 4UM7A 5EPUA 1PTJC 4Q1EA 1D2CA 5EESA 4KE7A 4KWTA 5LM3A 2FLKA 3HSYA 3H7IA 4OXRA 5C8YA 2V1XA 3D4NA 3VZRA 1YR1A 2Q0SA 1IBLB 5MFZA 4NU0A 4PAMA 3TG8A 3L8EA 1X74A 5CMLA 3OHMA 2XZPA 3UO8B 2JLSA 2QRMA 5ESWA 1ZD3A 3O4JA 3QFHA 3RD5A 5L95A 3UJNA 2AFRA 4K46A 3GDFA 4IDGA 3R3JA 4WESB 1GD1O 3MC1A 1SXJD 4FNOA 5K3SA 3WRWA 5IJ0A 3MT7A 1OFTA 4HDKB 4QEKA 4ESOA 4ADSG 2I99A 1Z3IX 1CULC 1E99A 1L4YA 5JTUA 1PWXA 2DUJA 5JAQA 3U44A 1Y3AA 5T57A 5M2QA 3OLQA 3VNQA 5EIBC 5AW5A 4G0OA 3W2HA 4E5MA 5JFOA 5K8IA 3TUZC 3ZJ5A 1TU0A 1VG9B 1NL3A 4KRXA 2ZUEA 3W90A 2XAAA 4PSKA 2EFDB 1K4KA 1U94A 1BFUA 1EFVA 2DTDA 3B1JA 3U9SA 3EXG2 3GI1A 3NAGA 4I4CA 4E22A 3EIFA 5ALMA 3AGQA 4XEHA 1XZEA 1T2NA 2RGUA 4HLNA 1ZC3A 3NHAA 4N1AA 2O8FA 3I5AA 3DW3X 4HNAA 2FWRA 2NWQA 4NL4H 4ZOAA 2R6R1 1TMKA 3MYYA 1ZS9A 2VAWA 4ABTA 4D9BA 1ZJ6A 4L16A 1GEGA 3JRNA 2XNDD 3O38A 1TE2A 1U8EA 5IF3A 1XB2A 2O2XA 5AVZA 4EI7A 2VLBA 3COWA 4AI6A 4D0GA 1N7GA 2Q1YA 2AQHA 4LDPA 1E32A 1LC3A 4O0MA 2HIHA 1DWUA 2PLWA 2WG1A 3JQQA 2ZJ2A 3BJZA 1KEPA 2PX2A 1UT6A 3FGZA 1WLSA 4JQSA 4YWJA 3PGJA 1ENZA 4ZDIA 2PL1A 2VYVA 2G1KA 5FI5A 1CR4A 3QU4A 4IIXA 5K8JB 3K0AB 3KJZA 2X5KO 1Q16A 2IV7A 1AHIA 3KAPA 2HUPA 2REOA 2QKYA 5CJ2A 3SSMA 1SQGA 1NX6A 4IXMA 1PFQA 2I7CA 5HUJA 1XCOA 3OCVA 1JHZA 3KWFA 5DGHA 4HX2A 3O1IC 5B53A 4PIPA 3HP1A 1OLXB 4MVJA 3L4BA 2ZUFA 2ZIWB 2OO5A 5F73A 3PNVA 4TSFA 4EJ2A 3OU7A 3CH4B 3I6IA 4ON9A 1BOFA 2FLVA 5H9WA 4L5YA 2PGNA 4B81A 1A69A 3TSZA 4Y7DA 1A82A 2QJTA 2IZ5A 3AOEC 4DV5B 1QLHA 3FFAA 3QFFA 3FHCB 1M2VA 2F59A 5FPTA 2UUBB 1D4ZA 3EDCA 4J29A 1XPOA 1DKNA 3E4DA 4WGGA 5A2GA 3ESYA 2FVXA 2PZAA 1AK9A 1Y37A 2I1QA 5JZ9A 2HW8A 2W8BA 4CZ2A 1OWLA 2B25A 3PLNA 4M0UA 4BQQA 2JFHA 5GVSA 4ZN6A 5F77A 5LZ7A 3FDFA 3PNLA 4AF8A 4V1CA 3TTVA 5HHTA 2RB5A 3TN7A 3WLSA 4F86A 3IDSA 1ULUA 3U48A 1HDXA 1I9GA 5M04A 4B5KA 1X7GA 4GKJB 2DHRA 1XKXA 4PC1A 1AUOA 2IYQA 4EABA 2GKSA 2M9MA 3C0KA 3W5HA 3F4KA 4CU5A 1SUSA 4RY2A 5C5CA 4RH1A 3RIEA 2CLFB 5AHXA 1NLFA 2QIOA 2CWDA 3CVXA 3E7DA 5CJJA 3ZR4B 1YE5A 3WBBA 5CX1A 1Y81A 4S1WA 5CEJA 2X0DA 2D1RA 4WDQA 4GMXA 2FKAA 4HEQA 1E2LA 2VJMB 5H8WA 1BDMA 2W6OA 3IO3A 1F6BA 1WM1A 3CG4A 4MKXA 4J90A 3VNAA 4AO6A 4BVAA 2J3QA 2R1VA 1DPFA 2RGGA 3F97A 2ODTX 3K0BA 1IYZA 3NYWA 1Z33A 1LI5A 3JALA 4ND1A 1FIUA 3H1GA 4XLTA 1UBMS 1E1NA 4KLZA 3WWEA 5B7PA 5BSGA 4PG6A 4REQB 4TS3A 4YCBA 3CH6A 5JVDA 4AKGA 5FOWA 3MLBA 1UBTS 4EYGA 4PLWA 1O54A 4UMEA 2C1ZA 2O2ZA 2OCAA 3LPAA 4BAZA 1KE2A 1IJFA 4MV8A 1WBJB 4RV5A 1K0UA 3ZJVA 3RVOA 3FNIA 1N0VC 2GJAA 2QG9A 4X1YA 3AUTA 2AMJA 5AHWA 16PKA 1JKIA 2V7GA 5CM8B 1ZEMA 5CVCA 2IHYA 4Z7QB 5BNWA 3MUFA 1VI6A 1Y8RA 2VHEA 3W5CA 2YCLA 4EYSA 1NV8A 2FFAA 4U3JB 5D01A 4MEBA 1GG9A 2BFEB 3K8OE 3E84A 4O25A 2QE6A 4QHYA 4BLQA 3R9XB 4IS2A 3GLHE 1P2UA 1M0WA 1YMUA 3E18A 2A5JA 4H60A 2CFCA 3LFHA 4XGIA 3WB0A 2XYHA 1P4AA 3EG9A 1ZUD1 3PE3A 3BVPA 1P4GA 4I5GA 4IJQA 5EHIA 2D2FA 3TW0A 1UJMA 1G20A 3QXHA 5JFGA 4OHWA 4TYWA 2PMCA 4K9PA 1X0VA 2ZK7A 3MINB 3PKIA 3TIFA 1ZH8A 5LD2B 2JIDA 2R6ZA 4GYYA 5CXQA 5C8DA 5JV5A 1DGQA 4C6TB 3WGTA 1MNAA 4MK4A 4QGAA 2PZLA 4KVFA 4YEDA 4O6VA 1PGOA 1YL5A 4OMDA 1YR7A 3NVKI 3HI6A 4ALLA 2BCGY 1B26A 3ZHXA 1AQLA 3E61A 3HJNA 5LFAA 2H16A 2XVYA 3BD7A 3NOQA 3ED1A 1CS4C 4QUJA 2WICA 1BVYF 5HA5A 2WTUA 3P2YA 2QJFA 3KU4A 3UUWA 2IEIA 2WD7A 3REGA 5JD4A 2I7TA 3OPXA 3LNCA 4NYIR 1WE2A 3SC2A 4OQMA 4DG9A 1U6JA 1UC4B 1N6NA 3ESBA 3H18A 5A5FA 5FTKA 1A2OA 3THYA 3EVEA 1S3IA 5JHHB 2A84A 2GTPA 2ZUUA 1RP1A 2QLFA 3CLKA 2I4LA 1XAGA 3LZCA 3Q7SA 4FN5A 4Z9BA 1G4AE 2PA3A 2J41A 1IEVA 1T3HA 3ENZA 5J47A 2CF6A 2C7QA 1U2GA 5J1SB 1AO3A 2AFIB 4MRVA 3K9LA 3RIYA 3I6ZA 3QW4B 3LHKA 1E7QA 4Y1EA 2ZZNA 2YC4C 1AGRA 3DBRB 4HNSA 1I2BA 1L1QA 1Y4UA 3AKDA 3IDQA 1HT3A 2H7VA 4F7DA 2NUTB 4YV7A 5KBYA 4Y6OA 3PGMA 4OI1A 3SK0A 2CCJA 3VYSB 4FHZA 3RANA 5EIFA 4AWBA 3D2AA 3L8ZA 1KZ7B 4EECA 1QHYA 4D4MA 4DF3A 1IZ7A 4ZQEA 3OZTA 2QL5A 4RMHA 3VAYA 3PF8A 4Z3DA 2R47A 1KWGA 1QK4A 2GZ2A 2HADA 5JDIA 5E1OA 2NGRA 2VUTA 3QP9A 5EIWA 1DMRA 3GFSA 1JQ5A 4HWSA 5EMKA 4YYEA 3I05A 4FR0A 5EHNA 1BX1A 3FOWA 2IBMA 1C3VA 3LUGA 1USGA 4IDPA 4TLMB 3R7BA 4WXRA 3H8SA 3TEMA 1OLOA 3ZYCA 4C7KA 3E5MA 5C4IA 2VHVA 2Z9BA 3G2OA 3FBTA 5JYEA 4D1YA 3PYLA 1UBLS 1QONA 4TT8A 4IQ8A 4MRRA 1J8MF 4IUDS 4DSNA 2P9BA 2HCJB 2XA1A 2WUWE 4TZKA 1W1IA 2DQSA 3DO5A 2ZRPA 1YA4A 1K1EA 3B7PA 4WQMA 5JH7A 3THRA 3SAJA 1XEFA 3NALA 4Q19A 1US8A 2FXVA 3MFYA 5AWFC 2C84A 1JB9A 5CAEB 1VECA 3BSWA 3OC0A 5CT8A 3NCTA 1JQJC 1X7WA 1SKUA 1SURA 3VDRA 4OJTA 1P3Y1 2G9RA 4BQEA 1EGQA 2J32A 2VQ6A 3K30A 3LKDA 3EX7C 5AI4A 3K15A 1Z56C 3CT6A 4P92A 5DI9A 3HBFA 5AJYA 4M7RA 2EQBA 4HDNA 2QK4A 2VNKA 2TMDA 4JWKA 4D79A 4Z3OA 5EIAA 3RCBA 3L01A 2WUEA 3EDOA 4X7RA 3CXUA 5KTTA 4M9CA 1SOVA 2WVAA 4JEIA 4AP9A 1D09A 2FEOA 2NZVG 1WXFA 2AD1A 3HB5X 3MSXA 4RGQA 4YJ3B 3R7AA 3R5JA 3TTUA 1C1XA 2H5JA 1PD1A 1E59A 2XTNA 3MD0A 3NXSA 4K40A 4NCBA 2XDWA 5K99A 4MJLA 5CRIA 3ORYA 3ZG6A 4JI6B 3NP7A 2VF8A 4DJJA 3GJQA 4P4NA 3FPAA 1CR1A 4TVOA 3ECAA 3PHGA 4FMPA 3KJGA 1Z2PX 2A88A 5JNRA 2FRDC 4ZYWA 2X1MA 5TPZD 4L7QA 4ER6A 1MXHA 3MTIA 4M7WA 3N0WA 1H6CA 4WBSA 5LNK6 2E4ZA 1HZZC 2H63A 3G0GA 4QXMA 4A91A 3ROZA 1PK8A 3TLGA 1FLVA 4K9LA 4RPJA 2C97A 1QPZA 1Z74A 1BDJA 5P8WA 2BFFA 2PZFA 4HGQA 3BBLA 2WNSA 2WZDA 4LFBB 1C30B 1OYYA 1RIIA 2LCIA 1PT5A 2Y1GA 3DT8A 2AG1A 4KHZA 1H2BA 3IT3A 3SP1A 1P2VA 3PUHA 4BNGA 5K9ZA 3ESAA 4HDMA 4XD7D 1AN9A 4OA8A 5KWVA 2EGHA 4U7JA 1Q7EA 5DBEX 2PL9A 3MAGA