1OKKD

Homo-heterodimeric complex of the srp gtpases
Total Genus 94
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
94
sequence length
283
structure length
265
Chain Sequence
AIPWGGNLEEVLEELEMALLAADVGLSATEEILQEVRASGRKDLKEAVKEKLVGMLEPPVEPKGRVVLVVGVNGVGKTTTIAKLGRYYQNLGKKVMFCAGDTFRAAGGTQLSEWGKRLSIPVIQGPEGTDPAALAYDAVQAMKARGYDLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKEVWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLDGTAKGGVLIPIVRTLKVPIKFVGVGEGPDDLQPFDPEAFVEALLE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SIGNAL RECOGNITION PARTICLE PROTEIN
publication title Heterodimeric Gtpase Core of the Srp Targeting Complex
pubmed doi rcsb
source organism Thermus aquaticus
molecule tags Cell cycle
total genus 94
structure length 265
sequence length 283
ec nomenclature
pdb deposition date 2003-07-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
D PF00448 SRP54 SRP54-type protein, GTPase domain
D PF02881 SRP54_N SRP54-type protein, helical bundle domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.140 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 1okkD01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1okkD02
4LV6A 3IKJA 2KJQA 4V0NA 3PJRA 3O8BA 1T5LA 4IW3B 4PO8A 3VFDA 5FBRB 1EGAA 1LY1A 3C16C 4DXAA 3OIUA 4UJ5A 2WVJA 3AP1A 5GVSA 1FX0B 3B60A 3S1AA 1U81A 4GOXA 1ZM9A 1H8HD 1VECA 3Q8XB 1OXUA 2ZR0A 1XP8A 5BYKA 4MRPA 1GSIA 2AWOA 4U00A 1XPRA 3QENA 4HAZA 3GPLA 3KJGA 1G4AE 2KBFA 4UXHA 4OHZA 4LHXA 3IILA 1W4RA 1RRCA 2ZU6A 4ZDKA 4JYBA 4URUR 2YOGA 3UK6A 2AD5A 1E2MA 4LV8B 4BLTA 3K53A 4HZUB 4O2RA 4URZR 5EXSA 1COWA 4B6FA 3KTAB 1ZM2A 2ZS9A 1KDPA 4X8LA 3RC8A 1FW6A 4YMWA 2OLJA 3WHKA 3BB1A 3VKHA 3TE6A 3AVOA 4N0DA 4NP6A 2CMKA 3VAAA 5L8VA 4TZ0A 2KSQA 4DLYA 4OK5A 2FJUA 4BFUA 1NY5A 3QQ5A 1W7AA 1MABB 2G0NA 2OFXA 4MH0R 4MA4A 4DSUA 3QNUA 2O52A 1CBUA 5HE9A 2HCBA 2NPIA 3UKDA 2GBLC 1AM4D 4LWZA 5KYKA 2FDCA 4JLKA 1IXRC 4MRVA 4JVNA 4MKIA 4D0GA 5CM8B 1DADA 1UJ2A 3KXIA 2G0TA 4G3XA 4W9MC 4IOMA 4CEIA 2BCJQ 4HLDA 2XX3A 3Q9LA 3PQCA 3DOFA 1E9AA 4JMPA 2J46A 5P21A 3MSXA 4EAQA 4FWIB 1E2GA 3UG7A 3M4YA 4ERNA 2C9YA 2ORIA 4B74A 5HZKA 3U2QA 4ZIRB 4TLDA 1XCGB 5FOSA 2VHTA 1Q57A 1E2LA 3NC1C 2H18A 3BH6A 3L0OA 3ADBA 1UKVY 5K8IA 5CDFA 3CWZA 2J41A 3OAAD 4U7DA 4QM7A 4WOPA 4QJ3A 2NIPA 3B8HA 1G3MA 4DB4A 3SBEA 2JIZA 2XJ4A 4PANA 2AFIE 1T3HA 1E94E 4A8JC 3KQLA 1N0WA 1WDTA 3C8UA 3Q7PA 1OIWA 2ZROA 1Z22A 3QXXA 1II8B 3NEJA 2RKOA 5KOYA 1FNNA 1BYIA 4RSGA 4Q00A 5TB5A 3QJYA 3DDCA 2E9SA 3GJ4A 1T0HB 2ZS7A 3GLHE 4BWYA 2GILA 3VR1A 1RKBA 1X6VA 2J7PA 4Q7KA 4Z54A 3CKLA 2BBOA 3HYTA 3HP1A 3RVBA 1DG1G 1SVKA 2JJ8A 4LBZA 1RC8A 1DEKA 3B85A 2WM9B 3VTKA 3AVXA 5SZJA 1CIPA 2JLSA 1Z29A 4FIDA 1KDOA 4KJZA 4Q48A 4Z1MA 1XCPA 3QF7A 4Q18A 5DN6D 4RD6A 3WXMA 1EWQA 3TSWA 3KKNA 2VF7A 2MSCB 4YMVA 1TAGA 4NMMA 1IJFA 1IY0A 2H7VA 821PA 2B7CA 1YZLA 2Z43A 5JHHB 2I3BA 1ZNWA 2GJAA 2J5XA 1H65A 4LHZA 5FL3A 5J4KA 4KBFA 4PQFA 1HE1C 3MG9A 3ONWA 3RS5A 3V4FA 4UXIA 4S35A 2BMJA 3QY0A 4Q1DA 3UATA 1LS1A 2KE5A 3AV0B 3KJHA 4NYIR 4X8MA 1GTVA 3T12A 4Q1CA 3W34A 4W5JA 5EE0A 1PV4A 1U90A 1GUAA 3GD7A 2WHXA 5JECA 3MD0A 3QVVA 1NJGA 3N2IA 3IEUA 5B30A 5GJCA 3EA5A 4L15A 2EWVA 2BIFA 4P4TA 4B3XA 4E09A 3LRPA 3B1WA 3FHCB 1XXHB 1HT2E 2QMUA 1HY3A 1US8B 4A0RA 2HF8A 4YXWD 4FWTA 2GDJA 2PZFA 3QXJA 4XD7D 1E3MA 1NVWQ 1ODFA 4IOKA 5CB8A 2R62A 1E2QA 1O3YA 3FHTA 2P65A 4EJSC 3CRVA 3RWMB 2N1BA 1L4UA 3VKGA 1XMJA 1NG9A 3B1VA 2IYXA 1GKIA 3BC1A 3OIYA 3SOPA 4LJ8A 4KBGA 5EP2A 2FE4A 5DI3B 2ZI5A 4HB0A 1G8PA 3B1ZA 4JL5A 1KO1A 3MRSA 2CNWD 4BEJA 3RLFA 2F1IA 3AVVA 2GRJA 1EFCA 2AKAB 3ZLJA 4C2UA 4AKHA 4Z51A 2ZRPA 1ZVQA 2WWXA 3L8ZA 4Q1BA 3TW8B 2XOKD 2ZR9A 3QE0A 2GXSA 4FMBB 3OEEA 4Q1FA 5AJZA 4YONB 4DVGA 2O8BB 4PZLA 3SFVA 2YWGA 4RZ3A 4ASUD 1F3OA 1FL9A 2RH5A 4DLXA 3ZQ6A 4GRAA 1OH6A 2VIIA 4M1KA 5KTYA 1N5IA 4DCUA 2N42A 3QBVA 5HKKD 4TLAA 1OYWA 3UANA 2GAAA 2BWJA 4MRRA 3N5CA 1Z6AA 1G7RA 3TSOA 3W8NA 4DEYA 1FFHA 4HUTA 2WTUA 4KFTA 1RIFA 3PENA 4BE7B 1QHIA 1ANKA 1T6NA 4LYFA 3T1OA 3Q5EA 4DT1A 5H1YA 2QG6A 2ZJBA 2E1RA 2IYVA 4D25A 3QG5A 2F3TA 3N2EA 3TKLA 4JKYA 2PMDA 2FSIA 4V0LA 1JR3D 1W2HA 4GBMA 5FBWB 1Q44A 2BBTA 3WYGA 2EYUA 1ZUHA 2RGNC 1ZNXA 2JIZD 2QP4A 3D3QA 4MDFA 2QE7A 2V4ZA 3IIKA 1M34E 2WAXA 5DE3A 2PZGA 1XTSA 3DZDA 4AKGA 2V7QD 1JQLB 2H17A 2ZU0C 2NO7A 2OG2A 4HAYA 1E9EA 4V0ME 2QA5A 4CT5A 4EKDA 2C95A 2ODWA 2V9PA 1X8LA 2MMCA 4M1TA 4DIDA 3CF6R 1NSFA 2FG5A 4URYR 1XJQA 4NBSA 2JEOA 4Q9LA 5KSPA 4PXAA 1GWNA 3EASA 3TJZA 2HYIC 3IIJA 5JS8A 4KSCA 1G6OA 1OE0A 2ERXA 4NYJR 1KI3A 4EPYA 2FPMA 4KVGA 1MO5A 1ZM4A 2O8EB 4TMKA 3LAWA 1OPXA 1Q0UA 3OZXA 2AFHE 3KB1A 1ZU4A 2MMGA 1NBME 3R8FA 3ZD6A 1E2JA 1QG2A 3MLEA 2IF0A 4Q66C 2ANBA 3NDBB 4KSBA 3P1JA 4JSTA 2GK6A 3TAHA 1KO5A 1PUIA 1N5KA 2ZRDA 3I8XA 3I4LA 1GRQA 4PPFA 4R71A 3GFOA 4PHGA 1R0WA 3KKPA 2OILA 1G8FA 2ZSBA 4TTRA 5AJXA 3T5GA 3CB4A 4ZIRA 5KDOA 5FFMA 2BCGY 5FBQB 2O8DB 4M1YA 1FQKA 2CK3D 2BMDA 2RHDA 5JHGB 4J0QA 4R9UC 2PEZA 3CH5A 1XXHA 3MWKA 1Z83A 3AQ4A 5FOXA 2O8BA 1R8QA 4P4UA 2J0UB 4OI2A 2CBZA 2JJ2D 2CEAA 3RDPA 1R5NA 3AUYA 3WY9A 1QF9A 5JS7A 3AF1A 1QHGA 4XWKA 4Q5IA 2WMOB 4IFEA 3ZGXA 4GL2A 2O8FB 2ZRKA 4G0NA 2LKCA 1Z0AA 4BQSA 4C7OB 2B6HA 2QQ0A 2OBNA 4MITA 3OAAA 2O8DA 3R7WB 2JJ1D 2IW3A 2YC2C 3JVUA 3T1QA 3KKOA 5JRJA 3L0IB 1VPLA 3ZZUA 2R6DA 3G5UA 1Q1BA 2O8CB 3ZH9B 3ZVNA 1T4GA 3TQFA 3PFIA 3AF3A 4Q9HA 3THWA 2GF9A 4LYHA 4FCTA 3VQTA 2ONKA 2UZIR 4XTRA 1FTSA 2A30A 3EZ2A 3NIBA 4OHYA 3DKPA 4TL6A 2QZ4A 1YR6A 3BB3A 4KFSA 2ZRNA 4B75A 4KHZA 4MGYR 3GJ5A 2BBWA 1HYQA 4LY6A 2R6AA 4P33A 1JXOA 4TZ6A 2CL0X 2DWOA 3EZ7A 4BGDA 4LCBA 5KO2A 3BOSA 1UADA 3K0CA 1N6KA 4OJKA 4JKIA 2GCOB 2GJ8A 1UM8A 3PIRA 4A0GA 2PBRA 3CM0A 2Q9AA 1R8SA 2DFLA 3PUWA 3I62A 4DBLC 4WZBE 2ONJA 1F6BA 1EK0A 1WCV1 1Y3AA 2GEVA 3PEUA 1W0JA 1XPUA 2FZLA 5FBVB 1EXMA 3ZD7A 1IXSB 4NONA 221PA 2P3SA 3A4MA 2ZJOA 1BO6A 5E7IA 4IDNA 1JJ7A 3JZAA 1KK0A 2DFKB 3DMNA 2BMFA 3H84A 1NF3A 4IVRA 1PJRA 2PEYA 1U9IA 2QM7A 2G88A 1ZD1A 2ZITA 2AWNA 2PT5A 1LS6A 1Z6TA 1L2TA 1X1SA 3AUXA 1M8PA 2L0XA 1KI6A 5DI3A 1KNXA 1WF3A 2FMXA 2BHRA 3QF4A 4JT2A 3WMEA 3GLHB 3I61A 3VR3A 4CGZA 2EFCB 3I92A 3PCRB 1N0VC 1TF7A 3AVUA 2C96A 4F4JA 4DLVA 2V54A 2A5FA 2FA9A 1R7RA 3LLMA 4IDQA 3UWOA 1A5TA 2H8KA 2GEDA 2ATVA 3ZZTA 2FOLA 4DCVA 5L3QA 5JMTA 2OZEA 2YNMA 1HUQA 3A1VA 2RCNA 1GP2A 3CX8A 4QHTA 4QGFA 2J0VA 1IJEA 1P60A 3NHAA 1W0KD 2KB0A 1PVOA 3TUJC 2NO9A 1KI6B 2ZTSA 4IEIA 5A4JA 4I4LA 3LDAA 2VP4A 3LWNA 8OHMA 2XXAB 5G3ZA 5FTLA 1G17A 2ODNA 5HR5A 4OI1A 1MABA 1DE0A 2P5SA 1D5CA 2OAQ1 3NBXX 1T91A 2QAGB 1A4RA 2CDNA 5EZ6B 3TRFA 1E9RA 3THOA 3ZIAD 3RABA 1ZC4A 4Z1MD 4RD0A 1KSJA 4WBSA 2RMKA 4A92A 4LHYA 1AIPA 1DO0A 4O25A 3DHWC 4D2IA 4M2LA 3U7FB 2J0QA 1G41A 4A8JB 2QTFA 1OKKD 1X8KA 5F9HA 2O0KA 1Z0KA 1W49A 1T9HA 2AK2A 2RGCA 4TMWA 2W6IA 2F7SA 1E1RD 2G6BA 3LD9A 1VTKA 4RKEA 3T34A 3T35A 1BMFD 1JPJA 4ACAA 1OXTA 1G3IA 5CDFE 2A2ZA 3GFTA 3B6EA 1XTIA 2FSGA 5FL7A 3W3ZB 1GVNB 1W44A 2BM0A 4DDVA 4QBFA 3PITA 2CL6X 2KWIA 2NMVA 4TYQA 1CKEA 3EARA 4AD8A 3PEYA 3TMKA 1I4DD 2GESA 2ORWA 4GPTA 2JLWA 1W0KA 4Q4LA 3OEHD 1T8UA 1LF5A 4MKFA 4MUAA 4M1OA 2DR3A 3KJEA 2QPTA 4JVLA 3LW8A 2ORVA 3H0KA 2QT1A 1W0JD 2IXFA 5JWOA 1XTQA 3E5HA 1OXSC 4OQXA 1JJVA 1FUKA 2HJGA 6Q21A 2WAYA 2AXPA 1G8HA 2VSFA 3QXCA 2P5TB 4MGIR 2NGRA 4YC7A 3LLUA 3SE0A 4ESVA 3PUYA 1NBMD 3GJ3A 4JLMA 4A6PA 1W5TA 3NC0C 4FXPA 3K70D 3OIWA 1R5OA 4KFRA 2AD1A 2G1JA 3FFAA 1X3SA 4WAUA 4JJKA 4BRWA 4QOSA 2A5DA 4HEJA 3X1WA 4C0LA 2ZYUX 1E1RA 2D7CA 5H8WA 3OFNA 2J7PD 4YMUA 1SXJB 5HTKA 1KMQA 1KK1A 1FNMA 3IDQA 4IXMA 4TSFA 1TPZA 4YDHB 3EIEA 4M8NE 3T06B 3U60B 1RVDA 1XTRA 1UFQA 2H57A 1TU3A 2IK8A 3RRZA 5C46F 4LJAA 4LI0A 3B9QA 3DVLA 1MT0A 1PZNA 4W5WA 3KXLA 3OEHA 3CX6A 3VNVA 1L8QA 3L43A 3MAAC 3AF0A 2VBCA 3I5YA 2GZHA 4Y0AA 4LHVA 4XWAA 2CJWA 2JLYA 5CK4A 1NY6A 4B3DA 4DHEA 4PSAA 2IYSA 2IEYA 3OFND 4Q47A 3F0TA 3CR7A 4C30A 1EWRA 4DLRA 4RFSB 5B58C 1P72A 3CR8A 5E7MA 2IL1A 4S2EA 1AN0A 4BLQA 4DEXA 2PX0A 1NL3A 4MYHA 5L3QB 1ZW6A 3PVSA 4BUJA 4BECA 4RZXA 2WPDA 2XSZA 2I4IA 2W0MA 2OSBA 5F2EA 5IHPA 3RSLA 3GMTA 4BRUA 1BKDR 2OO7A 4TQAA 4RD3A 4DSTA 1J2JA 3CRMA 5K8LA 3U44B 2XNSA 1ELOA 5FPHA 1UF9A 4WA7A 1JR3E 2FGKA 2XTNA 1KGDA 1U0LA 2GBLA 4UNNA 4MQBA 1Q12A 4RD1A 3AVTA 1NN1A 1CRPA 3QKRA 4FMCF 1E0KA 3CO5A 1QRAA 4ARZB 1UEJA 1U0JA 4PC1A 2D06A 3EPKA 1EG7A 2Q9BA 3AKCA 1CRQA 2A7QA 2J87A 5H70A 1G8GA 1TEXA 4RY2A 3KDSE 2AHOA 2FU5C 1S1CA 2FGJA 5CK5A 4Q1EA 4A2WA 1VIAA 1QDEA 3AP3A 4F93B 3WNCA 2QY9A 3FDIA 4HB4A 3TK1A 1AZTA 4F92B 1MRSA 4V03A 4GP6A 1E0SA 2DCUA 1WXQA 4BLRA 3E1SA 1M1YE 4TTPA 4URVR 2ZUBA 3GLGE 3QI2A 2IUTA 1VCIA 1BS1A 2ODBA 4DT1B 4HB2A 3WP0A 1QVAA 2IYLD 5J4VA 1XEWY 5TMPA 4LBWA 4PSVA 1Z8FA 2WPDD 2XSZD 5DNYB 1ZJ6A 2LWIA 4B34A 3K09A 3CF2A 4YMSA 1N6IA 1VCMA 1KY3A 1NIPA 3RWOA 3IEVA 2IYUA 3JVVA 1G4UR 5DO9A 3VX4A 1DTSA 1KI1A 3A4LA 3ADKA 3FMIA 5AJWA 4TN1A 3ZJYA 4IEEA 1K5GA 1P2TA 1YVDA 3LNCA 4ILEA 2F55A 4OK3A 1UKYA 2ZE8A 4NCKA 4R98A 1MV5A 2IF2A 4HLQB 4DDTA 1P9NA 1I4TD 1TTTA 3UMSA 2C8VA 4TLEA 2OXCA 3FFBA 1G9XA 1TMKA 1KMHA 121PA 4OBEA 4EFNA 5JBQA 2KBEA 2BM1A 4QNMA 4MDEA 5FR1A 1EESA 4RZ2A 1AA9A 4TMTA 1KAOA 4QL3A 4A82A 5FPSA 3QEOA 4AWXA 2ZJ5A 1HQYE 3FKSA 1SXJA 2X19A 1FOEB 3RRMA 4CW7A 4WVFA 1D2MA 5TVKA 3A58B 1GG2A 4A9AA 1RE0A 3QXHA 1VIYA 4Q21A 2C98A 1KKMA 1R0XA 2YWHA 4KLNA 3B78A 1JEDA 3DL0A 2YWEA 4B71A 5KUTA 4ON9A 1Q1EA 1NVVQ 3P20A 4DLSA 1Q22A 2Z83A 1E2FA 2QGZA 3BK7A 3LVQE 2X1VA 4PTLA 3T1VA 2QBYB 1ZMXA 5KHOC 3PUZA 4B2PA 2F1RA 3K9HA 4D6PA 1FX0A 3DPUA 1KO4A 2WWGA 4LOAA 3THXA 2FZ4A 1DO2A 5KSOA 1A2BA 4G5RA 3TIFA 4BPBA 1HA3A 4QJ4A 1YZKA 4PAQA 4D4JA 3EPLA 2O0HA 2XZOA 1IONA 4LPSA 3FKQA 3H1TA 4DB2A 4NYMR 4MRSA 1H8EA 2EU8A 2HT6A 3WMFA 3ADCA 1U0HC 4M22A 1Y63A 2OCBA 3OESA 4NYMQ 4NL4H 4CIDA 4BLOA 3SC3A 3LFUA 2GTPA 4QNRA 3EXAA 1W46A 2GETA 3AKYA 1UDXA 1COWD 2XEXA 1RRPA 3NTUA 1CS4C 3THXB 1KI2A 4L4UA 1CR1A 4URXR 4HB3A 2UKDA 2C04A 3DM9B 2QAGA 4Q9JA 3UPUA 1WBBA 4BZPA 4B44A 1ZNZA 5TXGA 1XPOA 4C0JA 2I1QA 2PJZA 3B1YA 5DYGA 1K8RA 3SJAA 1XJ0A 2DWPA 4BZXA 2RAPA 3Q7QA 1ZRHA 5B2ZA 1XMVA 2A5JA 4HAUA 3THWB 1KAGA 2FH5B 1DAFA 2NOAA 2VP0A 2Q21A 3OE7A 4PAOA 2ZI9A 5FTMA 2ZRFA 1XD2A 3BWDD 1GKYA 5JSZB 1Z0FA 1II0A 4OQLA 5J5CA 2XNDD 3ZVRA 2DFTA 3BGWA 5M04A 1CLUA 2GK7A 3ZVLA 2DBYA 2W6JD 5FUVA 4IDOA 1P62B 3SYLA 3CUEF 3CRQA 2PMKA 5BN3A 4B47A 4ZI3A 4RD2A 2V7QA 3QEJA 3U7EB 4DDWA 2XZPA 2RGEA 3KQUA 2DB3A 1RPZA 2ZUCA 1D2EA 1ZM7A 2RGNA 3GLFA 3X1DA 3U3KA 5CLQA 3VR6A 1G3UA 4YQFA 4B3GA 2YINC 4OI0A 3HU3A 1DAMA 2HXSA 3IUYA 5ELXA 2WIAA 4U02A 4ZCMA 4PX9A 3LVRE 1TX4B 1UDWA 3EG5A 4DKXA 3P4YA 5EE5B 1M2OB 1R10A 1E1QD 1XZQA 5EUQB 1OFUX 1YR7A 4QJ5A 5EE1A 4B48A 1SULA 1W47A 2V55B 4EUNA 4PQYA 2R9VA 4UXJA 3X1YA 2IC5A 2GNOA 3HR7A 3IGFA 1YQTA 5CM9C 4US1R 1G64A 2EFEB 3EIHA 1JECA 1QHHB 1UPTA 1VHLA 5J4LA 2EQBA 5FTKA 1RYFA 3Q5DA 4BFVA 1GNPA 3QIAA 3U3JA 5DLQC 4D0LB 1SKQA 3N70A 4ARZA 2IX3A 1S3GA 3CZPA 3PR1A 3AVWA 3ASZA 5DN6A 2VL7A 1OYYA 3BBPA 4P4SA 4F91B 4PHTA 2G9NA 1EFRD 3EWAA 2VP2A 3NXSA 1KZ7B 4M1MA 5TARA 3LX8A 5H68A 1E2KA 5JCPA 3SBDA 3GLIA 4YDSA 1TL7C 5L3SA 3OIVA 3SS8A 2QBYA 1N6LA 3S1AB 4MYTA 1VYVA 4UNSA 3QSYA 4C7OA 2W0SA 2QT0A 3U6BA 1XX6A 3I1FA 4JLDA 1T8TA 2GVDC 1B0UA 521PA 5E95A 3TVTA 4E5UA 2IHBA 1K5DA 3C4JA 2BC9A 1AQUA 4RFSA 4MKGA 2H5EA 1TQDA 4TT3A 3W8RA 3LBIA 4LC0A 3LXXA 5LPNA 4GSYA 3BFXA 4DDUA 1U99A 3SU8A 4LV5B 4DWJA 2FFQA 2OFOA 3GJ6A 3A1TA 2QM8A 2IXGA 2IYZA 3C7KA 4A8JA 4C0SA 4HLUA 4UKDA 3U6KA 3FE2A 4WZAE 2VA8A 1OFHA 3KB2A 1E2PA 4KYUA 4C9BA 3KQNA 4M21A 2GF0A 1F60A 5JCZA 1R0YA 1Z5ZA 1XEXA 3NDPA 4URWR 1DG3A 3U4QA 4AG5A 4JT4A 1XRJA 2XB2A 3T5DA 3D6TB 3I32A 2IS1A 4MRNA 2I1VB 3ZYCA 4C0BA 2CJWB 4DRZA 2J59A 3B7GA 2O0JA 2XNDA 3ZS8A 3KFVA 4PPGA 2HEIA 3QPVA 1T3LA 4NTZA 4QBGB 5EXXA 2B7BA 2OT3B 3CH4B 2ZE6A 3MMPA 3BJIC 4PAMA 4ZDIA 3IBYA 4ZCLA 4LJ9A 1Z2AA 1N6OA 2WIBA 3RANA 2R44A 1NJFA 2GXQA 1CXZA 1Z6YA 1AKEA 4RCYA 2PLRA 4TMZA 1XD9A 3BAFA 1HEIA 1XD2B 1X8JA 2WWFA 3FB4A 3UWKA 5JSZA 2QROA 2IA5A 4UQOA 4QXAA 1E9CA 3QKUA 4LDJA 1JQJC 2WSSA 5EJEA 3A1UA 1TUIA 4NDZA 4P32A 1DVRA 4G5OA 1CJUC 3QKSB 1MKYA 4IDHA 2RGBA 4CRWB 2JATA 4JJZA 4PQRA 3AM1A 3MGCA 4OHVA 5FTNA 1YZGA 2BMEA 1RJ9A 2CXXA 1CTQA 1NLZA 4LHWA 3PV0A 4C3ZA 2IWRA 3OF5A 1N5LA 4NYJQ 4TMXA 2GCNA 1ZC3A 4B6EA 4CEJB 1P5ZB 4BFZA 3IBGA 4P4SB 4HSEA 421PA 3ICQB 3UG6A 1MO3A 3SFZA 5DIFA 2R2AA 1OFTA 1IOZA 4KI0A 4ZV4A 2F1HA 2AXNA 1MO4A 4HDQB 4LBYA 2QMHA 4DC9A 2HT1A 4PHHA 1DBSA 1DOAA 1WB9A 4WW0A 1BIFA 1QHNA 1OW3B 3WRYC 4N0EA 3Q3JB 5A5GA 1G5RA 4QGHA 5CJPA 4V0KA 2PCJA 1ZUIA 3GQBA 1YRBA 3TNFA 1LV7A 2RGXA 3Q85A 4B35A 1IAQA 2IS6A 2ZS8A 2OEPA 4Q4HA 2BEKA 2CVFA 1DAGA 2XJ9A 1NVUQ 4HAVA 1DARA 1D9ZA 4OI4A 4LJ5A 1JR3A 1JXMA 4TTQA 2ZVPX 1II9A 1NN3A 4GI7A 4RD4A 5AUPB 1ZU5A 3GLIB 1CF4A 4WIAA 2NZJA 2GAOA 2Q3MA 3GEIA 1E6CA 1NVVR 3FOZA 1I2DA 3V00A 1NSTA 2A5YB 2GWHA 5SZKB 2VSXA 2ZRJA 3DOEA 4FD2A 1GNQA 4K46A 5SZHB 4F7WA 1W36B 1P3JA 2FFHA 2OCAA 4G01B 3LW7A 2IT1A 3KJIA 3QKRB 1Z47A 4G5GA 4KAXA 3W5JA 3WRXC 4AIIA 4NU0A 5KDDA 3HR8A 4D82A 4JL6A 4Q7LA 4JBYA 5TY0A 3LQRA 1ZP6A 2J7KA 1E9FA 1TF2A 2CK3A 5AWFC 1P75A 2J0UA 3CF0A 4M53A 2AKYA 1GNRA 1EFUA 4GNKA 5KSZA 2FNAA 4CEIB 2R65A 2AX4A 2ZYWX 4DCTA 1KJYA 1PLKA 2QMOA 1H8HA 1ZUNB 4Q02A 1Q1ZA 1AK2A 1EX6A 3LQQA 3U4QB 2VTKA 3CNLA 1CJKC 1XTKA 1ZCAA 3FGNA 3MWJA 4IKEA 5FPYA 1LW7A 4BZQA 1E4YA 4LJ4A 1S96A 3GJXC 1OIVA 2P6RA 4QKQA 4M1SA 4JLVA 1S2MA 1RFLA 1CJVC 1YJ5A 4FN5A 3R9XA 3KQKA 4O3MA 5DYIA 1S4QA 3BFVA 3K8YA 5KSYA 1AGRA 4NCIA 1DPFA 4Q9KA 4XH9B 2GA8A 3OHMA 3PXGA 3REGA 4LSGA 3AP2A 4R2HA 4US0R 3HPRA 3EZ9A 2F6RA 2XITA 1IQPA 1ZAKA 3MUFA 3QPWA 1LB1B 2VO1A 3U3MA 1SGWA 2D7DA 3QPUA 1R0ZA 4H9GA 1OHHD 1OSNA 3VR2A 3IPYA 2C78A 3HJNA 2QU8A 2DY1A 5E7JA 1IN8A 3RS7A 3NKVA 1NNEA 1XB2A 4DUGD 2IBMA 3TQCA 5KPDA 2XB4A 4DCNA 2ZJZA 1P61B 3T15A 1VCOA 1SVWA 2X77A 3B82A 2GCOA 4M9SA 2WWIA 4TT3D 1TADA 3K0AA 4JS0A 2VHQA 2IS2A 1UEIA 4QGGA 2VLIA 1CULC 4LGMA 4UNQA 3EPHA 3TVDA 5LDDC 2V1UA 3NH6A 5DHFA 5AJYA 5BWMA 1W4AA 3AH8A 1P2UA 3BERA 5FUXA 2ZRHA 3VR4A 2ATXA 1IN4A 2W2VA 1VYUA 2QPAA 4HZIA 4TLBA 1T3SA 3O8CA 5IT5A 3MJHA 1F48A 1GFIA 4TL9A 2Q9CA 1XDBA 1TQ2A 4O0MA 1QZXA 2IYWA 3LBNA 3R9WA 2QAJA 3TLXA 3C5HA 4TL8A 3BH0A 1XJCA 4JBXA 1KDRA 4JYCA 5C18A 1YZTA 1S3SA 5DISB 4HDOB 2BDTA 3JZMA 3U44A 2YC4C 3SJZA 2BKUA 1SKYE 2PX3A 4EPVA 1G21E 3FWYA 4JLBA 1LFDB 1FMLA 4L5BA 3CLVA 3PUVA 1N6NA 2WKPA 2WWWA 1GL7A 2VP9A 3EZ6A 2QTVB 3BS4A 4TWZA 1IBRA 4CF7A 5LD2B 4ZDWA 3W9YA 1YHNA 2QENA 4EFLA 4PO1A 2QNRA 3B2EA 3CX7A 1VMAA 2A9KA 2QMEA 3A8TA 3H2YA 1F2UB 2WSSD 5GJVC 4XVQA 2ASEA 3ECCA 4HUQA 1OFIA 1VG1A 1E32A 4QRHA 4ESHA 3A6PC 2QUZA 1LNZA 2OCYC 4DCSA 3KKQA 1IM2A 2WWHA 4B73A 1GL9B 2B21A 5EP1A 2V3CC 1JPNA 3K70C 3KFXA 3NBFA 4EDHA 3C5CA 2N46A 3X1ZA 1DAIA 4YXWA 4V02A 1GKUB 4XVUA 3C14C 3EA0A 4JLOA 3M1IA 1E0JA 4QG7A 1NIJA 1OLOA 1XNJA 2D3WA 3ETLA 4DLUA 4TYNA 1D8TA 2W00A 3AVYA 5AUQA 4R7ZA 4N1AA 2OBMA 1J70A 5FOUA 3ZQJA 2ZAMA 4CZ2A 1XEXB 4GDFA 5L3SB 2AK3A 2ZI6A 4IDPA 1E4VA 4B3BA 5CITA 3GCGA 2A3RA 2HF9A 1W48A 2Q3HA 5L3VA 1OHHA 3CW2A 4CEHA 5JFGA 4TL7A 2F43A 5J40A 4GMXA 3W6PA 1OH5A 4A15A 4WZ6A 1QHXA 4CT4B 1KZGB 5CYOA 5LB2A 4RZUA 4FI3C 4E03A 3K9LA 1ZINA 4C0QC 1IXZA 5F98A 1IY2A 4I1OA 1WRBA 1XEFA 4LJ7A 2WV9A 4YMTA 3THYA 2C99A 1BYUA 3W3AA 4A0HA 5HZHA 5J4YA 2KI5A 1G7CA 4U5XA 1HE8B 1KNQA 3HU2A 2XAUA 1I2MA 2GZAA 2ZI4A 2DPXA 2NO6A 3U5ZB 4C2TA 1C9KA 2CL7X 3I73A 5B64A 4DLTA 3AKDA 4I1UA 3TUIC 2HLDA 2YZ2A 1E99A 3CWQA 2GHIA 2XOKA 2JDID 3NBZC 2VSOA 2DHRA 1UBCA 4HI0E 1G18A 4OJQA 3L82B 2HJVA 2V8OA 3MJRA 3GEEA 3IQWA 4JLPA 3QKTA 5EE9A 1QHHA 2FEOA 4UNPA 4IXNA 5LD2C 1W36C 3ICEA 2IYYA 5D3MA 1JNYA 3VMFA 5C2JB 5UKDA 1E69A 1E1QA 3B13B 4QM6A 2HCJB 4LC1A 3BFKA 1WE2A 3MWLA 2GKSA 1IN7A 3FVQA 2HDNB 1W2GA 1UBGA 2JJ2A 1U2RA 2JLQA 3RS0A 1F5NA 4XD7A 3W6OA 1AS3A 3ASYA 5AUOB 2VQSA 5TDHA 4LK2A 1CU1A 5C1BA 1G5TA 1NN5A 1VCNA 2DFNA 1ZIOA 5CIQA 2NZ8A 5JI3E 4QHSA 3TR5A 3WHLA 3SEAA 1OV4A 2QN6A 4AK9A 2BVNA 4MYCA 1NN0A 1TNDA 2DWQA 4M9ZA 4ZI2A 4FMDB 4JBWA 3WP1B 1E9BA 3D31A 4B32A 4A6XA 2GJKA 1X86B 3E2IA 2JASA 1K6MA 1CR0A 1P2VA 3FYHA 3H4MA 3L0PA 4HLUC 3I72A 3U3RA 3PEVA 3VR5A 1RRFA 1GDDA 1G5PA 1G7SA 2Z4RA 2ZR7A 1N3BA 2H1LA 4AC9A 5E3HA 1SVMA 1S9HA 2FPKA 3F8TA 2IHYA 1KI9A 1WA5A 2D62A 3DZ8A 3IO3A 1F2UA 4JVSB 3AEZA 1XFAA 2WJVA 3HPQA 1SQ5A 3V9PA 1J8YF 1HV8A 3A37A 1U98A 4MGZR 4B2IA 3AVQA 4M0LA 4ASUA 4EQ6B 3O8RA 4H1UA 2WKRA 1W5SA 1HT1E 4LYAA 1OH7A 2ZEJA 1KDTA 2A5GA 2ZAOA 2GEUA 3E70C 2YHSA 2H16A 4XSGA 3G82C 1UKEA 1IHUA 3BH7A 1S1MA 1OJLA 2ZXUA 4Z8XA 1GL6A 3K09C 4HDCA 2WOJA 1KTVA 4H1VA 3IIMA 3MCAA 5JLJA 3RHFA 4II7A 1Z2CA 3EIQA 5HCNA 1GM5A 4B3CA 4Q03A 3EPJA 4JLJA 3CNNA 4C0AC 2JA1A 3K70B 5C4GB 2V6IA 3NG1A 3J81k 1A2KC 2REBA 1OB5A 4CEHB 1X1RA 2GCPA 3L8YA 1LVGA 3IHLA 5K8UA 2BOVA 4NCNA 4HLCA 1A1VA 2QE7D 1G16A 1YRAA 1XF9A 1OXVA 1FMJA 3ZVMA 4QFMA 4XTCS 3SZRA 5L3RA 3UMRA 3M0EA 3BE4A 4F4IA 3BD9A 2P2LA 4PO9A 4IVPA 3BXZA 2REOA 3QOFA 5FI1B 3W90A 1M7GA 1Q1QA 1TEVA 3U61B 3THYB 3CPJB 2X8AA 2ZSDA 2F9MA 2R6FA 5EZ5A 3EW9A 2CLSA 1C1YA 1HURA 1J8MF 1KO8A 2CLCX 3GJ8A 2OXRA 4CEJA 2VF8A 4GT1A 3TH5A 1Z08A 1OB2A 2B8WA 4Q4JA 4PZZA 1Z63A 4D26A 4XOIA 1XU4A 3SNHA 4NCHA 3AGPA 1J7KA 5GJWC 2BBSA 4JL8A 3NEYA 2C03A 2PL3A 3D7MA 4A2QA 4GOKA 3QF4B 4HATA 4G5QA 1NG1A 4A4DA 1Z0JA 5KNDA 4BFWA 2GXAA 4GMDA 1XCMA 4ZO4A 2HLDD 2R8RA 5BQ5A 2WICA 1N0UA 1CJTC 4RFVA 1F2TB 1PUJA 4XIGS 1SKYB 2NO1A 1Q21A 1WBDA 2ZJYA 3ND8A 1G20E 4IOLA 2R6GA 3CNOA 3K0EA 1FP7A 1XWIA 4A0FA 1VG0B 2TMKA 5JJIA 3P26A 5IDVA 1ONBA 4ABYA 5GJBA 2CNWA 2D4HA 3VHXA 2ZUDA 3LO5A 2RB4A 2IWHA 3R8CA 3RS2A 4NE2A 2Z4SA 4P3YA 2P6NA 2H92A 1A82A 1SHKA 3P32A 3LH5A 4ZDJA 1VDZA 5JWRA 3GLGA 1G291 2G77B 3OEED 1QBKC 4I1SA 1F2TA 2WJIA 4Y0VA 2ZRLA 4F38A 5EXTA 1KKLA 1OT3A 1WP9A 1Z07A 2ZQ5A 4OL0A 1TU4A 4EJSA 1MOZA 1AS0A 3Q72A 1L7VC 1XEWX 2VHCA 3FPAA 3VNUA 1DAKA 1NBMA 4BLSA 4AKEA 2EYQA 5C4MA 1FP6A 4TMVA 3BORA 5FI0B 3AF4A 4HZUA 4G5SA 1A7JA 4DSNA 3EWSA 3NVAA 1YZQA 4A36A 1GZSA 1E2NA 2QSZA 2P0EA 3FKSD 4CDGA 2CHQA 5FH9A 2IS4A 3CBQA 5TV2A 1GAJA 1CJMA 5BW8A 4MYUA 1JAHA 1HTWA 2EVWX 3SI7A 1M7BA 2B8TA 3NH9A 3SR0A 4OHXA 3A4NA 2IEZA 4LZZA 4FMCB 3I8SA 2JLZA 5KDLA 2XZLA 4EPXA 2RGAA 3UIEA 4P0TA 4A1FA 2OUKA 1TUEA 1KOFA 3DKVA 2GXUA 4ZKEA 3WBJA 1YKSA 3EC2A 2F9LA 3GP8A 2PT7A 1KSFX 1DELA 2JLVA 5HCIA 4Q19A 2JLRA 2WJYA 1VG9B 4M1WA 4TYWA 1E0AA 2WZQA 3GJ7A 1QHSA 1CP2A 2K5UA 3A1SA 3QXSA 4JLNA 2XGJA 5AK0A 2HXYA 2ODEA 2V1XA 4FINA 4Q7MB 4B3FX 4IVQA 3SN6A 1UKZA 1KJWA 5KNBA 5BN5A 2Q3FA 2W2XA 1VKJA 4LYJA 4QBIA 1NRJB 2AR7A 3PG5A 5EUMA 2ZI3A 1TF5A 2CHVA 2ZIAA 3HWSA 1SXJD 4PC7A 2YV5A 2W6JA 1P2SA 1YU9A 1UBEA 3TR0A 4YLGA 2WJHA 4XVRA 2QORA 4QBHA 3U7GA 3TW4A 4KU4A 1T0JB 2W6ID 3HU1A 1J90A 621PA 1G8YA 1OF1A 2ERYA 2Z6VA 5FUYA 3RC3A 2ZJ8A 4OKSA 1YE8A 4RVCA 3K0FA 3EX7C 1E98A 2V6JA 2QTHA 1US8A 1Z06A 4JLAA 5LBIA 1E79A 1U94A 3VU9B 721PA 1S9DA 3DMDA 4KO8A 3R20A 4LJYA 1CEEA 2F43B 3TGPA 1JBKA 2G3YA 3SYKA 4UJ3A 2VYFA 5AJVB 2XTMA 3P4XA 2W58A 5A0FA 4B33A 3DO6A 1Z28A 3QKSA 4DZZA 1AZSC 5HKKA 1KSGA 4EQ6A 3WNDA 4I99A 2QI9C 4FCVA 2VHUA 1G1MA 2OCPA 4R2IA 1XBTA 2GVZC 3K1JA 5LB4A 3L0SA 2ZETA 5FPTA 4LX0A 3MWYW 5EQTA 2NQ2C 5JWHA 4Q9IA 3CZQA 2E87A 2ZRMA 3KKMA 2YVUA 1KHTA 1N25A 1NVXQ 2EWWA 2FFAA 2QAGC 4BFSA 3EZFA 2C9CA 2NO0A 2JLXA 3CRW1 4BFXA 4TQ9A 5F3WB 2CCJA 1QVRA 3RRYA 3T1TA 1WMSA 1RRGA 1ZBDA 4KVAA 1FZQA 1G19A 2W2TA 2ZM5A 4AYTA 3SHFA 4BASA 1WQ1R 2R6CA 3B9PA 3W5IA 4M9XA 3KL4A 2ZE5A 2C77A 1JI0A 1P73A 1QHYA 2D2FA 3LBHA 4PZYA 1XMIA 1E2EA 1Q3HA 1R2QA 2WJGA 1VG8A 2C9OA 3DEFA 3GJ0A 4B43A 2CHGA 2X2FA 4IHQA 5JJKA 3WNBA 3RNLA 5DGXA 2JDIA 2AL7A 2C5LA 2O8CA 1W36D 1V5WA 3K9NA 4BFTA 4D81A 3LXRA 1KI8A 3SQXA 1DAHA 1M7HA 1U8YA 1HH4A 2IUSA 1P9RA 2QL6A 3GLFE 4LPKA 2QGNA 2WBLC 2UVQA 4PPNA 1KI4A 1Z0DA 4C0KA 1FQJA 5AUNB 1XZPA 2FN4A 1ESMA 4AURA 3CRRA 4L9SA 1ETUA 2HUPA 4GZMA 2BJVA 4ACBA 1D2NA 2HV8A 1UAAA 1XD8A 2OM2A 1NP6A 1IN6A 4AY2A 1BH2A 3LY5A 5CB6A 2PH1A 3O8DA 1ZCBA 2ZYVX 4N3NA 4DSOA 5F9FA 3A36A 4TLCA 1Q3TA 2EW1A 3K0AB 3ND9A 1ZIPA 2BEJA 5HE8A 1Z6XA 2UZ3A 1MRNA 4F4CA 2PZEA 5BXQC 5JEDA 2EFHB 1II8A 4C0HA 1E9DA 1GRNA 3VU9A 2IYTA 4EPTA 1FPMA 1SVIA 1P9WA 2WJJA 4EIWA 1JAIA 2CLDX 4LBVA 2FSFA 2ZVQX 4W5HA 1SHZA 4PC6A 4L16A 4EFMA 4Q4AB 1E2IA 3ZZ0A 1KSHA 4PHFA 3G0HA 1EX7A 2G83A 3GEHA 2QRNA 4QC2A 3AB3A 2OBLA 4NH0A 3GLIE 3F5FA 5DI9A 1O87A 2A78A 3GLHA 4KXFB 4OHWA 5DSZA 2ZRBA 2ZANA 2B92A 5IF9A 1JEEA 2OLKA 4NPHA 3WYAA 2OV2A 4O2LA 4OK6A 5KU1A 1Z0IA 5GADl 1KI7A 4B76A 1OKKA 4NHOA 2FX3A 3LA6A 2SHKA 2YOFA 1PLLA 3FMPB 3K0FB 5FOTA 1R4AA 2W83A 1Q20A 5J4HA 2NTYC 1KYIA 1N2CE 3KUCA 3U3OA 1ZD8A 2IYRA 5EE3A 4KITB 2IYQA 5FL7D 2QRZA 4PC2A 4Q4AA 4IOJA 3IHWA 4LUCA 1CR4A 3ZDQA 1N6PA 4CVNA 4RJLA 2O5VA 2Y8EA 2ZREA 3EC1A 3QG1A 2OHFA 3SYNA 1G7TA 5E4FA 4DLZA 2ZSEA 3FMFA 1S0UA 5IRCD 2VEDA 3D8BA 1U9IC 1QG4A 1G6HA 4MKHA 1OXXK 4V0OA 2QPOA 3RSOA 5GVRA 4MGKR 4D0NA 1U8AA 4MUBA 1IY1A 2ECKA 1M6NA 4NYIQ 5G41A 3T61A 2FPLA 3TUZC 1R5BA 4EPRA 2GJSA 2PLFA 4AYWA 1C4OA 3W6NA 4XWOA 2ZRIA 2JLUA 1FTNA 1G3QA 2OFWA 3FMOB 1TQ4A 3QBTA 1EFHA 2YJTD 2YWFA 3C15C 4L8GA 1T5IA 5BN4A 3GFPA 2FFBA 3K9GA 4QHYA 2BV3A 2J3EA 1MR3F 4JIMA 4PPQA 5KNCA 1SVLA 2D74A 2YYZA 3PEWA 2F1JA 4ZPXA 5EP3A 2Z5FA 2D2EA 2QP9X 3PUXA 4JVMA 1GIAA 1YZUA 1JALA 2ZSAA 2J9RA 3KX2A 5FPKA 5FTJA 1AQYA 1SVSA 1I4LD 1TQ6A 2ANCA 2FV8A 4OQMA 2CE2X 1ZD9A 2PCLA 3QUSA 4FCWA 2QSYA 1N5JA 2ZYTX 2VP6A 4D80A 4JSYA 4TSFD 1RW4A 2QQEA 3IPXA 2G1KA 1FUUA 3SQWA 3F3YA 2FF7A 4ITRC 4NZYA 1RJ9B 1JB1A 1E9SA 1KK3A 4UNRA 1KIMA 4PC3A 2JJ1A 2ZRGA 5CLLA 3SDZA 4L9WA 1G3RA 5JRZA 4FW9A 1MO6A 2HYDA 2ZSFA 5G53C 5KPJA 1YR8A 4B2LA 5BYJA 1GITA 4P31A 4AG6A 3P27A 4NKRA 1NLFA 2FSHA 2JCSA 3QVUA 2GJ9A 4QGAA 3K0SA 3U7HB 3CIOA 1VHTA 2ZPTX 1MH1A 2AN9A 1DS6A 3TAUA 2WWYA 2REXB 3VHLB 3IQXA 2IXEA 3K0CC 4K8OA 4BFYA 1KJZA 1XMSA 4GP7A 1M74A 5CYPA 1AJEA 5G3YA 1XTJA 1KO7A 1E2DA 1J99A 2CE7A 4M9QA 3EAQA 4X8OA 2ZRCA 4AI6A 2VH5R 2ZJ2A 2OESA 3FTQA 1AGPA 1P7CA 1R6BX 2VRWA 2P6UA 4Q4HB 4LJ6A 2MSEB 1ESNA 3R9IA 1W4BA 4GFDA 5DH9A 4KV9A 4D4MA 4PFSA 4OQFA 5B57C 3VX3A 1E2HA 5CIWA 3HDTA 4OQNA 4POAA 2RGGA 2IUUA 5G40A 5JEEA 1CR2A 2OAP1 1GRRA 3DM5A 4WXRA 4JZKA 1BMFA 1NMZA 3B1XA 3VKWA 4IRUB 4D4LA 2P67A 3IO5A 1ZM3A 4KCGA 3SJCA 3KQHA 2YOHA 3AVPA 3UXMA 2J0SA 2J1LA 3OE7D 1W4CA 4KLZA 4V0MA 5JI2E 3RS4A 4AYXA 1S8FA 4DLWA 3KXKA 2QEQA 2O8EA 3WMGA 3FHOA 4FMDF 1OH8A 5IK2A 4EPWA 1GILA 3AF2A 3HYRA 1D9XA 1Z6GA 2CCGA 4IJMA 4DIEA 1NMYA 4TYPA 4CYMA 3O47A 2RGDA 3MFYA 2XTZA 3UMFA 1YZNA 1LTQA 2ZI7A 3AKEA 1RZ3A 2EFGA 3KTAA 1YR9A 1SZPA 2FEMA 4ZKDA 3GLGB 3CONA 4K81B 5D3MB 1SXJC 3LX5A 3ADDA 4ZCIA 5EP4A 4Z8YA 1SXJE 5CJ2A 4I1VA 4WXPA 2WOOA 5FOWA 1V43A 5EXPA 2YKGA 3B5JA 4TQUS 5FR2A 4EJSB 4RCZA 3SHWA 2CCKA 4M4SA 3X2SA 1PLJA 3CPEA 1ZYUA 3L2OB 4TYYA 4E22A 4NCJA 5JJLA 1DAEA 2F3RA 3BB4A 4XSHA 5J47A 1Z3IX 1XXHE 1HQCA 3WBKA 3WYFA 3KZ1E 2NG1A 2O8FA 2VPPA 1E79D 1U8ZA 4AKIA 3RAPR 1E96A 4HUQB 1L4YA 5AR1A 1H8ED 1W1WA 5FBLB 2XXAA 1EFTA 2BJWA 2WKQA 2RHMA 3I3SR 1AS2A 1OIXA 2ZRAA 2WSMA 3ZIAA 3R7WA 2OE2A 4GZLA 5HPYB 4HAWA 1P4SA 4PSKA 4XJXA 4A2PA 1UBFA 3CPHA 1EFRA 5D3QA 2VP5A 3X1XA 1WGWA 1RYHA 2EFDB 4BLPA 3V4RA 2VHJA 1KK2A 1NKSA 2MSDB 3NHBA 2WMNB 4OYHA 4DUGA 1VYTA 2X2EA 4US2R 1KY2A 3GLFB 1P6XA 3I5XA 1NMXA 2LKDA 4Q01A 1JR6A 2QP3A 2JGNA 4KYIB 3NWJA 1N6HA 2C2HA 4KODA 5FUWA 4BEBA 5SZIA 5DHAA 2FWRA 3H86A 3NBYC 4HYYA 3SJBA 4Q7JB 3M6AA 1B23P 4Q4JB 4Q1AA 2CVHA 3ZS9A 4G1UC 2PJRA 3BRWD 5JZVA 4DJTA 4LRWA 3KUDA 1D6JA 3RRNA 1NI3A 3LV8A 4IFBA 1KMHB 5FOVA 1GOTA 1SVOA 4PR0A 3C41J 2ZJAA 2LCFA 2JAQA 4GOJA 4D4KA 2Q6TA 4E07A 4C4PA 2DYKA 3TBKA 1LF0A 4X8HA 3TSZA 2Q0HA 1NKTA 1N6RA 4HAXA 2Z0MA 1BOFA 3AGQA 5K8TA 4W7SA 2J45A 3RYTC 4I81A 4KFUA 1ZNYA 2BKEA 3A1WA 3BIFA 5IK2D 1NLYA 3REFA 3RS3A 2NPFA 4RKFA 1IN5A 2ZE7A 5ANRB 2GZDA 1AKYA
chains in the Genus database with same CATH superfamily
5BSVA 1MIOA 1AMOA 3O9ZA 5G4KB 3PJRA 1Q5PA 1GU7A 2QTCA 3T1HB 1RYMA 4LY9A 4FX5A 1LY1A 3B0VC 4OBBA 4B84A 4CHGA 4OLJA 5GVSA 4DY6A 4U5QA 3WKBA 3S1AA 3ORSA 1WB4A 2R8XA 1BE0A 2XECA 1ZM9A 5AW0A 1NYLA 1QVXA 2UZ0A 1OXUA 4NEHB 4EBBA 3ZHZA 3BMXA 3B2QA 2ZTVA 4RESA 2NYUA 1JF8A 2HXGA 2AWOA 4FZ3A 3DUWA 3GPLA 3WO1A 2VUIB 1GAXA 4RS4A 1PGPA 4G7OF 4GS5A 5PNTA 1Z8DA 5JATA 5HF5A 2DMRA 3BKWA 4TVKA 4XFDA 1FJXA 4RMIA 2LCQA 3VMMA 4ZDKA 3ANXA 3ZY6A 4DF3A 3HXTA 5EHQA 1PQYA 1PEAA 2DH6A 3CE9A 3HUUA 3L7DA 1E2MA 1MJFA 4LV8B 2C1ZA 3WNVA 2CMGA 4HZUB 4URZR 3V1YA 3V7FA 4B6FA 5BN3A 3AX6A 1UKCA 3UJ6A 1ZM2A 5CPBA 1NMQA 5CLIA 1E5TA 5KIAA 2OLJA 1Q83A 4ZD6A 4HVAA 4PGGA 3R3YA 3T0IA 1C8LA 3G2PA 4OGFA 3OC6A 1H6GA 4CM8B 3C7TA 5F7ZA 4NP6A 3U3DA 1AQLA 3I3OA 1SBHA 5L8VA 1V5EA 3ZHRA 1RFGE 2FJUA 3VSAA 4IAQA 1MABB 1N9KA 2RC6A 4DXHA 1UMBB 3D3NA 3NDJA 1PT5A 4MH0R 3QNUA 3HI6A 4S2UA 3ZOKA 5HE9A 4DSUA 3DH0A 2HCBA 3FWHA 2OD7A 1Y7LA 1GTZA 5HJ2A 4E4TA 1PVDA 4JLKA 3V6MA 5BMOA 2HLHA 1Z4KA 4D0GA 4IV5A 3N2GB 3KXIA 4MHOA 3GZJA 4KRFA 3OT5A 3IUPA 2C92A 1U3CA 3PQCA 1USGA 3ITEA 4WACA 2OD2A 3MSXA 5JNSA 5JNLA 1NNI1 3M4YA 2ORIA 3DGEC 3X1MA 4B74A 1JZSA 2E18A 4FW8A 5JSFA 1N7IA 2OZVA 5DULA 2OJQA 3F73A 1R4MB 1TLFA 3MZ0A 3G49A 4ZT6A 2HD4A 4MR9B 3AEKA 3BH6A 3K4HA 3L0OA 4HNRA 4MV8A 2FPUA 4JX8A 5AKIA 2LGJA 2QU7A 3BCUA 2O8VA 4Z0TA 4DV2B 2XGSA 4GE0A 2PHZA 2I2BA 2X5JO 3H9GA 3OAAD 4GUDA 4ZYYA 4U7DA 4XGQA 3IH5A 2JIZA 2G76A 2AFIE 1N0WA 4AVYA 2V59A 4JEUA 1GGMA 1PDVA 1OIWA 2P9JA 3IPMO 1C5KA 4Q4DA 4CL2A 5CBPA 1QB8A 1W8DA 5IG2A 4JR2A 2PFDA 5JSKA 5P8WA 4HO1X 2OMEA 2VXOA 4JLSA 5TEWA 3UXEA 1EVJA 3O1IC 1M66A 1PKXA 4B6RA 1EBUA 2WABA 4E14A 4COKA 1VZ3A 1I5RA 2CFIA 1SUFA 3OE4A 4FYXA 1SPBS 1WSWA 2E9SA 1T0HB 5IN5A 4DTCA 1OW8A 2BEVA 3LYHA 1A77A 1RAAA 5DCLA 3UJCA 2D54A 4FDVA 1SN7A 3CKLA 2I8CA 2G09A 3CZCA 4PFQA 1DG1G 1SVKA 3MMXA 1ILWA 4LBZA 4MTCA 3DMRA 3DYVA 3LQ1A 1DEKA 1NATA 4HPWA 1XNGA 4Q3DA 2FKNA 4QUDA 4MGHA 4EKIA 2JLSA 3B3FA 3N2KA 1PO7A 1T5HX 1XCPA 3N0WA 3O82A 3P9SA 3QF7A 4Q18A 5DN6D 1QG6A 3TSWA 4KHPB 4LRTB 2ZT8A 2R25B 3V8NA 1I8TA 1IJFA 4YCMA 3H9BA 3C3BA 3D6MA 5BV2P 2P9HA 1REQB 1PTJC 1KH3A 3VGPA 3N7UA 3ZV5A 2VSNA 1ZNWA 2GAQA 2IHJA 2NYVA 2VDLB 5FL3A 5T4HA 4M0FA 2O9XA 5CNKA 4CMKA 4CR6A 3Q7LA 3J06A 3HJUA 1BE6A 4PQFA 3U31A 1V2GA 3V4FA 2YJ5A 1P0FA 1E64A 4CLXA 4UXIA 4K1LA 5F1PA 3G2NA 1D0YA 4H3HB 5CT9A 1GRCA 2BAGA 4NYIR 4GX1A 5AHOA 4XWGA 4GMGA 1DC7A 1V7QA 4J94A 5H9VA 4IIGA 3FROA 1GUAA 3QVVA 2R7OA 3N0RA 3EZIA 3L4BC 4HHEA 3PNBA 1TUBB 1NYQA 3DPIA 3FMVA 4L15A 4YJDA 2OHVA 3KNZA 3RVZA 3DDZX 3W2IA 4RIGA 4YRTA 1R9NA 1YHZA 3QPCA 4ZOLB 2B98A 3K73O 4XGNA 3G5TA 4K9NA 4HVCA 3A9CA 3JQPA 2HF8A 2GDJA 3PQFA 5JVDB 3QEBZ 2W4BA 3ELYA 4FLFA 2WMYA 1O3YA 2FPWA 3W2EA 3NT2A 1NR5A 4FFVA 5DP1A 1QYVA 3IP3A 1MQ9A 1KVQA 3LCUA 3RWMB 3ASNC 4RULA 1L4UA 2N1BA 1FP4A 5B3SC 1U5BB 1L6RA 1U7WA 4RM3A 4E5PA 1GV1A 4DRIB 1U0SY 2IYXA 1NG9A 1GU1A 5IFKA 2FMHA 3AXTA 3SOPA 1KFCB 1Z45A 3GRFA 1YQGA 4XE5A 1DC8A 2CUKA 5E6RB 5ELLA 3VHQA 1MMFB 2TRSB 1QG0A 2ZI5A 1O08A 3AERB 4C01A 3B1ZA 3OPYA 1N1EA 1TEHA 2A0YA 1FSPA 3JASB 3RH3A 3GR6A 2JK1A 2F1IA 4GI2A 4PEVA 4KO1S 4QPCA 1EFCA 3ESXA 4Z53A 4OD0A 4QUGA 5JPDA 4DM4A 3NU1A 4QARA 1X1AA 2BP7A 2SCUB 2WWXA 4Q1BA 1RI4A 4CV1A 2GXSA 4OLBA 1N2CB 1WDMA 5AKYA 3M5PA 2YWGA 1RHRA 1ZH2A 5ED4A 1ENPA 2DB4A 1NFQA 2C7BA 1FYXA 4OHKA 4BPMA 4DLXA 1B43A 1G20B 5ARDA 2VIIA 3CUKA 3MT8A 4L7VA 2QVLA 3BGOS 4M1KA 5KJFA 3A2LA 4CS8A 4U8HA 1FBTA 3H42B 4TLAA 3COJA 4W1QA 3VC7A 4D45A 4OJMX 2BWJA 1CNEA 1M1XB 1G7RA 3TSOA 3W8NA 4Y7DA 5A9SA 2RIPA 1DOZA 4FHFA 4HUTA 3E5NA 4KFTA 5JYBA 1PZGA 2R7KA 4V38A 3KQYA 4WKBA 4Q6WA 4LYFA 3WL8A 1SR2A 1V0JA 1I1QB 4DT1A 3V97A 2BE7A 2BFBA 4L0QA 4AZVA 4GC5A 4UTVA 2R1TA 3HCNA 4PZUA 3AYZB 4RPLA 3QG5A 4AJHA 1K6IA 1YB1A 2HBYA 3R23A 5T8KC 4V0LA 3F9RA 1JR3D 4YV1A 2Z4TA 4ZYUA 1IZZA 4ONSA 2JFXA 1A4UA 4EQZA 3CTMA 4L7QA 4J7UA 2RGNC 1FRVA 2B8EA 4D02A 5CLFA 4BUCA 2FVXA 5IY5C 4MDFA 1CF9A 3E9EA 3OTQA 3D1LA 5DE3A 4AKGA 1SAYA 1JQLB 4L6IA 1ITZA 3VH1A 1WCIA 3M6UA 1JX6A 2XDWA 4IL5A 5F2OA 4RVDA 4FYIA 4CV0A 3FIJA 3O55A 1HORA 4NV0A 2H4YA 5ESRA 2QA5A 3NBQA 1R8XA 5AOVA 3WQQA 2IOQA 2C95A 2ODWA 3KOMA 1E85A 3PQ5A 4LZWA 4NMXB 3ABZA 4DIDA 4TXJA 4ZQIA 2M6SA 1EJ6A 2I3ZA 3ICOA 1I4EB 2ZXPA 1NXPA 2HWXA 5LMCA 5F52A 4DV6B 4XB6B 4EBFA 2YHIB 4P38A 3TJZA 2R3SA 4C6RA 2HYIC 4ARAA 5JS8A 4KSCA 1G6OA 3IHUA 4NYJR 3PDHA 4QQNA 1KEWA 1BE1A 5GONF 2DUMA 4MIKA 1ZM4A 4I2NA 1MMAA 3QELB 4DEVA 4TMKA 3LAWA 1MX5A 1V4AA 3QKWA 3KB1A 1MD9A 1NBME 3CLUC 1MEOA 1T0IA 5DBHX 1E2JA 4X6UA 1KQPA 1QG2A 2IF0A 5KKNB 1XZJA 1T1GA 3DLTA 2DBZA 1JLKA 4KSBA 5JAMA 4JSTA 1J9EA 2NSDA 3OTHA 1PUIA 1N5KA 2PZMA 2WWRA 3L8EA 4KP7A 3GFOA 3PEEA 1HETA 3I4CA 4PHGA 5CM2Z 4FT4A 1PJAA 2IYEA 3U5SA 2OILA 4IDFA 3TNLA 4ARSA 1E1DA 3E1KA 3AEQB 2VPTA 1PF7E 4ZIRA 3OKAA 1VLMA 3B36A 3L6EA 4BB6A 4M1YA 2HU5A 3CZ9A 1LUAA 1E3WA 5DLJA 5B6PA 3BHIA 2RHDA 4HFKB 1NQOA 3ENZA 4ZVPA 1H23A 4J0QA 4C2AA 1ONPA 5TGTA 4WJLA 1Z4NA 1UXIA 2PEZA 4TWIA 1Z83A 2YVLA 5C5EA 3H5AA 3QFRA 3VZSA 1BFDA 1ODJA 2CBZA 2D0IA 2CEAA 1QVZA 3WY9A 3AUYA 5I47A 1OILA 3LECA 1A9OA 1SA0A 2RKBA 2X22A 4WXMA 5D7BA 5LWQA 2C83A 3JXEA 4PFJA 4QOJA 3KSRA 2I6UA 4JENA 4G4JA 5H7XA 1DJNA 2E5WA 2GCEA 4HEQA 2XUZA 3EDYA 2O8FB 2ZRKA 4XUGB 4M8IA 3I6BA 1OXKB 3OCJA 1J2UA 5HJEA 3ELWA 4JBHA 4UQLA 4C06A 3OAAA 4YJ3F 1LPSA 3SXKA 2W43A 1Y6DA 1FLDA 2EKDA 1RWWA 5CB4B 3JVUA 3T1QA 3KKOA 4Q4CA 1RKVA 1Y1TA 1Z13A 3VOAA 4B4KA 5AIBA 2RJ3A 3ZZUA 4KXXA 1IUOA 3WAGA 1YRWA 1BVUA 3V8PA 5DLYA 3LT0A 2H11A 2LZ0A 3ZH9B 3O93A 3AR7A 1CUGA 3PHHA 2ZUVA 5DNEA 2WJPA 3UN1A 2CC2A 5LZ9A 5M5BA 1C0PA 2BSQA 3ADOA 1PV2A 3IAAA 4N4AA 1NZJA 3AUFA 3C5EA 4KYVA 4Q9HA 3WS7A 1CUYA 4LYHA 5EMLA 4FCTA 2UZIR 2GLTA 3TQTA 4NFSA 2OCCC 1BR4A 1E5DA 3TQSA 3ROQA 4OHYA 3DKPA 4TL6A 1CQIA 2QZ4A 4CIWA 1AA6A 4WHMA 1QB7A 2AF3C 3KPYA 3GT0A 3SQDA 4E31A 1OCOC 4KHZA 2BBWA 1CC1S 4B45A 2F8MA 4DRXB 4P33A 1JXOA 4G5HA 4BGDA 5AHXA 5KO2A 5C35A 4UHJA 2C4HA 3K0CA 3RHTA 3D8NA 2GCOB 1E3SA 1RXSA 1UM8A 2GJ8A 1CF2O 3E8XA 3HGTA 4PZCA 4A0GA 3LLSA 3G89A 1GPDG 3SXZA 4F9FA 1RDFA 3N75A 4UHEA 4E5VA 4FFMA 3U26A 2R1TB 1DBIA 2B83A 4KR2A 5E2QA 4KN6A 1W2WB 5JAIA 1ZJZA 3OWOA 4DBLE 3KC2A 3G8CA 2YUTA 3DP9A 3TNDA 4U5GA 4GSLA 4RWEA 2AFHB 221PA 1LZKA 1WZUA 4LMPA 1TA9A 1YOBA 2CBGA 1BO6A 2ZJOA 3HJHA 4TKVA 5JO0A 1KK0A 3NMKA 3H84A 5FRDA 3FYUA 1NR7A 3OPNA 1U7HA 5J2UA 1ECLA 3NTLA 3RKSA 4YJGB 5FWYA 4QBTA 5C8VA 3JYLA 3NP7A 3WGMA 1C7FA 4B0PA 1BEZA 2G88A 2QM7A 3I8OA 4CTMA 2OV4A 2WHYA 3GLSA 3AQCA 5ALRA 1AU9A 4AS3A 4WKNA 2JRCA 2VPXA 1UK6A 2PT5A 1SQSA 1Z6TA 3D5TA 3A3NA 4Q12A 2UYHA 2BFNA 3N53A 1KI6A 3SZLA 2IYOA 4MIEA 4PRYA 3UM9A 2W90A 3BL5A 1MHPA 5AKKA 4Y1FA 1U7ZA 2OHHA 2OKCA 2XRFA 3PCRB 5JXWA 1N0VC 1TF7A 4G24A 3NOOA 4N9WA 3SEQA 3AVUA 5CYFA 1ZJWA 2VZ8A 1WMDA 4Z4CA 3QSGA 4IDQA 4ENVA 5A3VA 1VFNA 1QLJA 2GEDA 3PXCX 4MWOA 3ZZTA 1UC5B 2I6TA 1WW8A 2X86A 5AVQA 1Y1QA 5L3QA 3HBLA 5JMTA 1OBVA 2YNMA 1HUQA 4UHKA 1T2VA 1AHIA 3DLAA 3ONFA 4RF2A 3NHAA 1W0KD 4J76A 2QRLA 4YN0B 4LWQA 4I1MA 2WP0A 3V6LA 3JALB 4JUBA 2PNFA 3TUJC 2WHPB 3PDMP 3FOBA 4EA9A 2N1MA 5FWXA 4F5YA 2J31A 4J0IA 2P4HX 4EZBA 4QA9A 3T4XA 5LNK6 3DOUA 3IBSA 3MQ2A 1E3WB 2C1XA 4AUMA 5GINE 3FPKA 4YIKA 1MABA 3GHHA 1BMQA 1D8AA 1FY2A 3KR2A 1GZUA 3DEHA 3IEIA 2GCGA 2JKYA 2OAQ1 3QUTA 4IDBA 3QLUA 2X0JA 2Y71A 5EZ6B 4BPRA 1E9RA 2ID4A 3THOA 4BN0A 3RSSA 4N76A 2AHRA 4Z1MD 2WIGA 1Y6JA 1JXAA 5AVWA 1KSJA 3MT9A 5JAQA 1IHOA 1AIPA 5CFQA 4N6OA 3P9QA 4BX9A 4DJFC 1RLJA 4XASA 4KG7A 4WV3A 6REQA 3U7FB 2IH4A 1G41A 4MUKA 1ZH0A 1VL0A 2H1VA 5CA0B 1R5JA 2OV3A 1WEHA 1YHYA 4ECAA 4D0RA 1LC0A 5ETJA 1T9HA 2V74B 5I7HA 1WXEA 2L42A 2F7SA 2G6BA 3LD9A 4G0QA 1VTKA 4MUGA 2REQB 4RKEA 5CDFE 1IBMB 4MVUA 1OXTA 1V9LA 1YSCA 2B4AA 5IAJA 4UPEA 4RTPA 5FB3A 1XTIA 4IJ5A 4LF5B 2VI5A 4C5AA 1GVNB 3Q0TA 4XIFA 4XB2A 1VYHA 2YYSA 2BM0A 2XH8A 2B37A 1YJBA 3QVJA 2FGYA 2XUJA 2NMVA 2JHAA 1TWCA 1IPEA 2IZ5A 4AD8A 4AZ0B 4BQRA 4FWBA 3STWA 2ZUWA 4PZ0A 2DPHA 1AY0A 2GESA 4CSAA 1ZL0A 1O77A 5CPFA 3TLJA 4D9HA 1IQRA 1W0KA 3JVEA 1HTBA 2OFPA 4JYMA 4PYOA 3S0JA 4DR1B 2QVYX 2B4YA 4CIVA 3KHTA 1W4LA 4M1OA 1AZWA 2ORVA 2FYTA 2G36A 3C3CA 1W0JD 4RU1A 5ULLA 4XD2A 4RHTA 4OVKA 4CT0A 1GFZA 4OQXA 3FHDA 1DBWA 1J97A 3VO8A 1G0OA 3FPEA 4OP1A 6Q21A 2WAYA 3L7CA 2I2XB 3GZNB 3ZD8A 1EUDB 5KBYA 3D81A 1FRQA 3OTGA 1SOAA 2Q1SA 5FQOA 4ESOA 6CHYA 3EWNA 3CNQS 3WLQA 3ZDDA 5EWJA 1PZFA 4X65B 3I9KA 1HEYA 2FPIA 3GJ3A 1UC8A 1D6NA 4A6PA 2FWPA 2A0UA 3NC0C 3ASUA 5DNWA 3K70D 1LK5A 5AVVA 3UXYA 4DLPA 3W8FA 3AT1A 2MR5A 4A8HA 1THMA 2Z98A 2VATA 5K0CA 2G1JA 3BIWA 4W9NC 1DAOA 1WU8A 4QOSA 4WNYA 3X1WA 3KCQA 2WTMA 3PHCA 2ZYUX 3L7NA 3H1GA 3VJKA 5HTOA 2IY8A 1SU6A 2O7NA 5CAEB 1HDYA 4NZOA 2XUPA 4EJ6A 5G0TA 4C3DA 3IDQA 4IXMA 4TSFA 5K3BA 1TPZA 1KJNA 3I0MA 3LCRA 4BDTA 3BFJA 1H9GA 3IP5A 4O7GA 3UAGA 1RQLA 2QRGA 4CF6A 1XTRA 4DR6B 3K1TA 4C7XA 3MFNA 4C3EA 2I33A 3UK7A 3L7IA 3U0VA 1BR2A 4A0QA 1JYEA 3DVLA 2BL4A 1NJ5A 1PZNA 1TK9A 1XQXA 2FR8A 3OEHA 1O6FA 2C31A 1QTNA 1MB2A 5CEJA 5IHXA 4PPYA 1CJSA 4G6ZA 1H3EA 4CLOB 3TQIA 1V5FA 2COKA 3GEDA 4AL0A 2EPNA 3I5YA 2GN6A 2GZHA 4Y0AA 1M0EA 5K0IA 2ATIA 3LX4A 5G1PA 1K4YA 2Q49A 2CJWA 1ZISA 4YO8A 1EMDA 3OFSA 3QNWA 4Y9SA 5CK4A 3EVAA 5F64A 4B3DA 4DHEA 2JLYA 4DABA 2YJ3A 1C9EA 1E63A 4F5DA 5KTNA 4HVTA 4F3TA 1E58A 1KF0A 1CB0A 2CF6A 2CNKA 2BH9A 3A7DA 3IIEA 3QU2A 4S2EA 1OX4B 1MFZA 5AIAA 4X71A 1NL3A 1PP4A 3PC8C 1ML3A 3PVSA 3OU6A 4KH0A 4WLNA 1KVTA 4D4IA 3O2SB 1P0CA 2XW6A 2WPDA 2Z6UA 1CHDA 2P27A 4Y1RB 5F2EA 3WBBA 5EGNA 1S2LA 1DRWA 4H7JA 3LLCA 5AC5A 3RSLA 3CSUA 1BW9B 5BWOA 4RJKA 1TWGA 4TPKA 3A28A 1I3KA 4RD3A 4TQAA 4DSTA 4WXEA 5CDUA 4NF2A 4XXHA 1OLUA 4AJ1A 1UF9A 2D1QA 4ZVVA 1JR3E 1RPAA 2BKLA 3TJ6A 1VBNA 1WSDA 2EWMA 2GD2A 3ONDA 3A9WA 1ZRMA 5LJLA 4MQBA 5ALEA 3HGQA 4RD1A 1NONA 1NN1A 1CRPA 4JDPA 4BEWA 1UDRA 1V37A 1VMIA 1NTRA 2C0QA 3CO5A 3PHLA 3Q12A 1Z5WA 4Z0PA 3X1OA 1PGJA 1AC5A 1LPPA 3K96A 2P4UA 1AZLA 2FUKA 2C5AA 2EATA 3AKCA 3RVDA 1ZOIA 4OHFA 3WK4A 3D6HA 3TYXA 4O0LA 4XYGA 5J1TB 1YVUA 5BN4B 4GDMA 1TEXA 1YMUA 1LPEA 2XQGA 4RY2A 2XUDA 2ZBVA 4K0KB 4OXXA 2XYQA 1YYXA 3DTVA 2X7HA 2YXLA 5JP7A 2HA4A 4ZGBA 1C30A 1SXHA 3NUGA 1GG9A 4CV2A 1W29A 4A2WA 3PNOA 4ZO9A 3C3PA 1QDEA 4EEKA 1EDZA 2IPXA 3TJMA 1UK7A 3K35A 4C07A 2ZYIA 1GUZA 4AWAA 3IB3A 2NX2A 2JZCA 2I8LA 1L4FA 3G0GA 4M38A 2X9QA 3FIUA 1J1ZA 1MRSA 1SOWA 4CKEB 4N41A 1WXQA 3H7AA 1TKNA 2XMBA 4URVR 4IV0A 3O8LA 3GLGE 1K6EA 3VU3A 4MPPA 2IUTA 3CZ6A 3WIVA 4CG3A 4ZI7B 4KR7A 1HDCA 2FEXA 3GRVA 4J0FA 2GNAA 5K3SA 2GX6A 2ZJ6A 1P2BA 5A9SB 2NP6A 1V4VA 4HB2A 3WP0A 3WK8A 4QUEA 4AZ0A 2QM3A 5TMPA 4NFYA 1U7TA 3LPCA 1DUIA 1QOZA 3WJ7A 2O9JA 4IEFB 2KMLA 2O8NA 1YB2A 2GZRA 5ALDA 5L0HA 2PUTA 2WU4A 1ZVZA 4Z1OA 3W7AA 5ICEA 3VU1A 3HLTA 1N6IA 4UZSA 3ZJTA 3Q87B 2IYUA 2XTJA 3JSXA 1BCRB 2RHRA 3JQ6A 3TKYA 3H19A 4H35A 3KUUA 1CRZA 2AN1A 2FEPA 1KI1A 3FMIA 4PJJA 4E18A 4RX1A 5AJWA 5DNUA 1NAIA 2X1MA 4QYWA 5CW2A 1D1BA 2Q1UA 3HB1A 1NBAA 2B82A 1QJCA 4HQKA 1E9VA 1XT6A 4KN5A 1XXLA 4O4HF 4L50A 3LNCA 4M99A 4MSUA 1JIJA 4Y6LA 4EHLA 1A4IA 1CUFA 1UKYA 3FTCA 2ZE8A 3AFGA 3HA3A 1M73E 1XZMA 2FPIB 1XZCA 4NCKA 1MV5A 1E5LA 2IF2A 5CW1A 3WYBA 1LM3B 1Z23A 1P9NA 2JI6A 2LW7A 3LUAA 2WTEA 4LRXA 1U2TA 3HM2A 4TTJA 5CP8A 5HKOA 5HQ3A 1J09A 2P9YA 2QRJA 3W7VA 4YCCA 1G9XA 4YK5A 1WB6A 2UUPA 4NVRA 5IAOA 1WNFA 1TMKA 2AC4A 4E17A 1KMHA 121PA 4OBEA 3H13A 4QNMA 2OZLA 3OM8A 1RC0A 2ZYSA 4X7MA 2KQ9A 4RZ2A 1NXTA 8ABPA 2ZWIA 1AA9A 1I51A 2XZDA 4QL3A 2VYVD 3H4TA 5IJAA 3WAQA 3G2QA 5CFNA 2ZJ5A 4YRBA 5IJ9A 5BUSA 2WNHA 1DQZA 3DXXA 3RRMA 3GJQA 3HXKA 4CW7A 3HP4A 4WVFA 3UK0A 4A9AA 2DYSC 2B5WA 2GARA 4ALNA 1VIYA 2NZYA 1WS6A 3FA2A 4KDCA 3KAPA 3P71T 2FZ5A 2X0RA 5H3CA 4EO9A 2YWEA 1NKVA 2PBZA 1XZEA 4IHJF 3C1OA 1XFDA 5A6SA 5D8DA 1Q1EA 1RU3A 1VI2A 3HNOA 5I7FA 3NKDA 2E89A 3FNFA 1UQUA 2V65A 2LFFA 1E2FA 2QGZA 4MV4A 5K0SA 3RNOA 3EJNA 3WTBA 2LIVA 1UH5A 1VLLA 5JT4A 1HM5A 3JV7A 1ADBA 1F9AA 3T1VA 3F5QA 3K2EA 4IG4A 4M9UA 4LJRA 3PJDA 1T5TA 4OIFA 4RDIA 4LGVA 1JR4A 2WWGA 3IQGX 1R4ZA 3BRWA 3E5MA 5EEGA 1CIVA 4RD9A 2HWKA 2Y9MB 2P8JA 1U28C 3WYNA 4QJ4A 3NETA 3FZYA 1D4ZA 4I46A 1RMYA 3F5SA 1QO0A 4CCAA 4Z99A 2IYFA 4BAGA 1P2FA 2RHBA 3FKQA 4RY9A 3P4UA 5GM1A 1GUBA 2OZKA 5A4FS 2DR2A 3DBLA 2OGSA 3T9OA 1Q0KA 4DMUB 2WC1A 1A7DA 3GRUA 3DPSA 3D3JA 4KR0A 5D5QA 1NVKA 4IIBA 2FLVA 4WMLA 2ES4A 3W4KA 3UJHA 5EIEA 3TG2A 1I94B 1ZHOA 4UFPA 3GEPA 1KS2A 2I65A 3LFUA 4HD8A 1AUEA 1BU8A 1H2EA 3H18A 3L5KA 2GETA 3OECA 1N75A 2IH5A 2VYVA 4WCFA 3E27A 3R74A 4BMVA 3FVRA 1POWA 4PZ9A 2X4LA 1IJKA 1I10A 2C20A 2BF4A 2BZSA 4QOGA 4RK5A 2UKDA 2C04A 5DZSA 2EARA 3C6YA 4F86A 1BXZA 2QAGA 3UPUA 4BZPA 4BVAA 5A4AA 3ZK9A 2G6TA 3FCCA 4ZMRA 4EB0A 3B1YA 3CMMA 1DRKA 1K8RA 4LLEA 5EYPA 2DWPA 4D6XA 1O6GA 3VZBA 3K7EA 3Q7QA 4KI2A 1ZRHA 4ITVA 4M89A 4V2IA 5B2ZA 1YBFA 2QTMA 2ZDHA 3A31A 2EJUA 2I99A 1JWBB 4BMZA 4P36A 4K05A 1XMVA 3B5EA 3BHMA 4J16C 4UBOA 1DBRA 1KAGA 1DAFA 2V7PA 2CYBA 3IT0A 3Q88A 2JAPA 4PAOA 3DXYA 3LQ4A 3PXXA 2ZI9A 4LDPA 1S2OA 4DYVA 2JFWA 3VKUA 3HU5A 1Z0FA 3ZX5A 2XNDD 3ZVRA 1T2CA 3MXOA 4BKOA 2G5PA 4H6WA 4H6XA 2HADA 3ZVLA 3KPVA 3C87A 3IT3A 4L2IB 3NYWA 2JFOA 4LVUA 3MXTA 3HJGA 2VKTA 4GGMX 4IDOA 5ARCA 3ZHTA 1GEEA 2PMKA 3D7KA 4WN9A 4ZARA 4JEBA 2Q3EA 2VHEA 4ZI3A 5JCOA 5C4IA 4WGYA 2AGVA 3ZU6A 4RK0A 4X41A 1K7EB 3IKTA 3DZHA 3LCMA 4IICA 5T41A 3ZWXA 1OCZC 3JARA 4DDWA 5BNZA 3PA8A 5BRNA 3AUAA 3B9BA 4IIUA 4MPDA 1IBSA 4OUDB 1U8EA 1WWKA 1JHAA 4K2AA 1DKNA 4R2LA 4R16A 3KLNA 4JWKA 4ROSA 5CLQA 4ZJYA 1TT7A 2FW9A 4IUCS 3GBPA 4IHJB 4DYHA 4XPXA 4OI0A 4FHCA 4GWGA 1DTWB 1U28A 2K4MA 4K9LA 4QUKA 4PX9A 1KZ4A 3LVRE 4TKVB 2HY7A 3H5IA 5IZ4A 1OROA 1UDWA 3EG5A 1IOLA 3P4YA 2MYTA 5TLSA 1E1QD 1XZQA 4GP9A 3WIEA 4XDHA 2YWDA 2E6UX 2JEZA 3JQAD 4HK4A 2YASA 2QM0A 1V8DA 2R9VA 4UXJA 3FWKA 1HDOA 3MIIA 5A6BA 3Q0IA 3ELBA 3JQEA 4LVCA 4OFWA 2PKXA 3ROGA 5IN4A 3HO8A 1GKLA 3G0IA 3ZI7A 3ER9A 4NEQA 5CM9C 1DL5A 4US1R 1VHLA 1V3UA 3MJDA 1N2IA 5D6NA 2ZIGA 1E3DA 3P19A 2QW8A 1BS9A 3R3WA 5BVHA 4YT8A 3NZEA 4Z9FA 3BTVA 3QVKA 4OMCA 1SKQA 3HZZA 4G5YA 4MO2A 1S3GA 4DR5B 3ZNPA 4XM0A 4TWJA 2P7HA 3BBPA 1FJHA 4PYMA 3RFXA 3RPEA 4JHXA 2FZVA 2J5BA 1IOWA 2CLLB 4K9OA 4ZYZA 1JH9A 2DKOA 3ESYA 2R7RA 3GOHA 3D3EA 5EN4A 5IZCA 3EGIA 4F4FA 5FO1A 4J16A 3SBDA 4YDSA 4RSMA 3WFJA 1O4VA 1TL7C 1QIGA 1WD5A 3OIVA 4OQQA 2M4EA 3PQ2A 4FDUA 3GDOA 2QD5A 4MR7B 1N1GA 3QUQA 1S4MA 3E5RA 1IQUA 4YPOA 1T8TA 1RBMA 1B0UA 2GVDC 5ERXA 2X0FA 5A4DA 1N8SA 3TZCA 5KMGA 1CJCA 2F90A 4RA9B 1GYPA 4OBWA 2I6SA 2VDRB 5C31A 3THSA 3U13A 1OZFA 2GDCA 1JFFB 2KQUA 2PS3A 3TW8A 2SKEA 3W8RA 2X6QA 1PVVA 4EBJA 2WFZA 4R8LA 3DR3A 2R0QC 4ER0A 3OWXA 4DDUA 4WZAB 1U99A 4I08A 3SU8A 5JNTA 4UBKA 5D2CA 4DWJA 2OFOA 2OK7A 4OSEA 5EIHA 5HS4A 2QM8A 2FZCA 2XKBA 4A8JC 1L9KA 3C7KA 3DEJA 2LDBA 3I28A 4C0SA 3AB7A 4HLUA 2G9RA 4TV9F 2H29A 4WZAE 2VA8A 3IBTA 1FXWF 1A8HA 1C4KA 1LQTA 2ZBFA 3CG0A 2R7SA 4URWR 1DG3A 1RXEA 2FPOA 2WDZA 1OWNA 3F8SA 2QI9F 4CKWB 4YUVA 3U4QA 3T5DA 1FFTC 5ES4B 3D6TB 3I32A 4MRNA 1RMTA 2FUG1 4Y9UA 1AH2A 4PJLA 5H3HA 3ET4A 2CHEA 1FFAA 2J59A 4KN8A 2O0JA 3PPYA 3I23A 1NLXA 4FYPA 3KV3O 3NCHA 1YZYA 4BX0A 4CDRA 2A3NA 4UDXX 4RKWA 1FPQA 4L27A 4AQ7A 1P1HA 3QPVA 5EXXA 4QBGB 1LSOA 3AUTA 4ENSA 3PFFA 5IPFA 3M9LA 3H2VA 3BJIC 3LP6A 5COAA 4DANA 4ZDIA 1B1AA 1M8GA 2A5LA 1F4PA 4LJ9A 3RU2A 4H4KC 4FC6A 4M0MA 2Z9DA 3RANA 3F7MA 3RIEA 3TBHA 3AUKA 1I30A 1P3Y1 3EVBA 2R44A 3IAS1 3BG5A 4HWKA 1WSBA 3MWDB 2BW0A 2QQFA 1DQPA 5BNFA 5HOQA 1UXKA 2PLRA 3OA0A 4CU5A 5KTTA 1WR8A 3BAFA 3TTTA 1ZUNA 2PH3A 4WLOA 5JSZA 3MA0A 2QROA 1GA6A 3FF1A 5K6AA 4UQOA 5IKXA 4QXAA 1E9CA 2D5AA 3QPAA 5CJJA 2JJMA 3Q3IA 2AG6A 2WSSA 4LDJA 3O8OB 2VUSA 2XMSA 3VNBA 3M6FA 2BR3A 1Q77A 1TUIA 3P2OA 4D0SA 1QGZA 1X80B 1H4VB 1U4SA 4NABA 3MUOA 4RV5A 2DX7A 3DC7A 3JARB 5I8ZA 1CJUC 1UWLA 3RYIA 4CRWB 2RGBA 2GFHA 1EAMA 2XNHA 3V8EA 4JJZA 5JAOA 1Y8ZA 3AM1A 1SC1A 2JIDA 4OHVA 1BXKA 4OUDA 3DZIA 4KQJA 3C3XA 2QLTA 1AT1A 1CTQA 2FN8A 4C4SA 3AHJA 1N5LA 2P0AA 3VZDA 1X9GA 2BE9A 1QK4A 4TMXA 3T3PB 1RI2A 3C6KA 3O8QA 3JQFC 2VHZA 4CEJB 2D4UA 2B69A 2G5CA 2C9MA 4HSEA 4P4SB 421PA 3CLTD 5IARA 1WPGA 1WHSB 1E7QA 3EEFA 3UG6A 3GN2A 5JS2A 5EQJB 1C0IA 4DCMA 2PLAA 2IDZA 2BT4A 1UBTS 2RIRA 1ISIA 1ULBA 1ZW1A 2ZAGA 3MJVA 2BFEB 2X9GA 3G9QA 4M86A 2F1HA 1MJ5A 5DLDA 3VR0A 4QDZA 3USZA 4BCCA 13PKA 3MS7A 2HT1A 4N0PA 4G0OA 2X0DA 4JTDB 4MVXA 3WRYC 4N0EA 2O23A 3NHKA 1O94D 3K2IA 5DASA 2NTEA 1L1QA 3KR9A 3DCJA 3WIBA 1SOUA 4AMZA 1ISHA 4MQ5A 4KBLA 3AB8A 4JB0A 1XQVA 3HMQA 3GQBA 2DAPA 1LV7A 2RGXA 1VKOA 4LEIA 2XUQA 3ZGOA 4J30B 2W2NA 2HK8A 3RWBA 5C8YB 4G8CA 3EGDB 3COVA 3UBMA 2HS5A 2XJ9A 4NS4A 2NSGA 4Q39A 4HAVA 4YT2A 3HDQA 3EVTA 5BOSA 3TRKA 4TTQA 1XSEA 2ZVPX 2YRFA 1CWUA 4CDNA 2I2DA 2NAPA 1ZXLA 1ZU5A 2C2BA 1O3UA 2VOEA 4OJNA 4XPYA 2R8YA 3RUIA 1I2DA 3K9QO 3QP9A 5HA5A 2RKWA 1DZIA 3DOEA 4K46A 1A04A 1V7ZA 3JCUQ 5JH7F 2BDEA 2ZKIA 5KMGB 4G01B 2H2DA 3LW7A 1YGYA 4K7JA 4P22A 4DA9A 1DQNA 3SC2A 1V11B 3W5JA 4EW1A 1N2GA 2PY6A 3WRXC 2C2YA 2IEAA 2IYPA 2WF5A 3UOGA 4AIIA 4D82A 5KDDA 3PC7A 4GI5A 1ZVJA 4JBYA 4Q7LA 5TY0A 1ZP6A 3FCXA 2J7KA 3PEFA 1JMVA 4OKNA 1P75A 2J0UA 2ATCA 4BFLA 1Y1LA 2OLEA 4F2PA 1GNRA 4ETMA 4I6JA 4CXMA 2F3SA 5KX5F 5JAPA 1Z4LA 5KSZA 2CDQA 2R65A 1PLKA 4FE3A 1WKCA 2W2OA 1QIKA 5LXTB 1GPYA 3O1HB 4Q02A 2HSWA 5GZ3A 3U4QB 3NCTA 1CJKC 4BZQA 1EVKA 1CK4A 3EGCA 3CT6A 2AE1A 3GJXC 2Q3DA 1OIVA 3ZZ1A 1G2PA 1A5SB 3GT4A 4BJ1A 3LKZA 4QKQA 4YR7A 4QDLA 4ZHQB 4MR9A 1XK6A 4B6IA 3T41A 1YDEA 2A1UA 4OEHA 4D7AA 3WLAA 1RFLA 3ZHOA 3A6DA 4FN5A 5K2OA 3R9XA 3KQKA 4E0HA 4BC1A 1LDGA 1JG3A 1S4QA 2B4RO 1GXSA 3M4NA 2AEMA 2GF2A 4P7KA 1ULZA 1ZN7A 3STYA 5GPBA 1TM1E 3WYCA 4ZYXA 3GK3A 1TC2A 5KAMA 4AUKA 4LSGA 3AP2A 1YT5A 3VC1A 1O95D 2PGDA 1NQTA 2VDUE 1ZAKA 3K20A 1L5OA 2A8YA 2POCA 3QPWA 4PCUA 3ZW8A 1X1TA 1R0ZA 4CS8C 3FSJX 2C78A 4IXTA 5C3MA 2H07A 2QU8A 2DY1A 2QYHA 1MVLA 4JROA 3JQGA 1R6AA 5FYDA 2C4NA 1ID8A 1XB2A 1PNTA 3O3OB 3MYFA 4JIOA 1N0IA 3D6UA 4PW0A 3HC7A 4RMGA 5EFOA 3TQCA 5LQJA 3MTIA 1QU3A 3BE6A 4LTNA 5LOVA 1E60A 2MINA