1OXUA

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 103
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
103
sequence length
353
structure length
353
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEKN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Crystal structures of the ATPase subunit of the glucose ABC transporter from Sulfolobus solfataricus: nucleotide-free and nucleotide-bound conformations
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 103
structure length 353
sequence length 353
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00005 ABC_tran ABC transporter
A PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxuA03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxuA02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxuA01
1Z8FA 2J7PD 1H9MA 2ATWA 1BIFA 1N0UA 4JI4Q 2BA0A 4LF9Q 1FX0B 2RHDA 3EC2A 1PVOA 2OBMA 4TYWA 1VQ6A 4DLRA 2G88A 3A7AB 1AM4D 1XCGB 3OAAD 1RJ9B 2IEZA 3BD9A 3FMPB 3CX8A 4NHOA 2WICA 4DR5L 2EFDB 4V0KA 5ELXA 1NVWQ 1E1RD 3OEHA 3A4MA 1N6IA 3FGNA 4ZCLA 2BOVA 2BCJQ 4TWZA 3WYFA 4HB0A 1W5SA 3TNFA 5C3EH 4DV4L 2A5FA 2D3WA 4PHFA 5F9FA 2R6GA 1DE0A 3TQFA 2ASBA 2BEKA 2ZJYA 1XMSA 1KO8A 2QE7D 5L3SB 4OO1G 1F5NA 3BS4A 2ZRKA 3I72A 1L1OB 1SR3A 1NVUQ 1XMOQ 4MRSA 3LNCA 4R4TA 3I3SR 2CWPA 2DCUA 1S3SA 3AF3A 1SVKA 4DR1Q 4V0ME 1VQAA 3ULPA 3S1AB 4LJ8A 1GL9B 3GLIA 2RHMA 1DAMA 2O5IC 4ME3A 2ANCA 1KSFX 4LRWA 1QHYA 3REFA 4C0KA 5IT5A 3FE2A 2ZM5A 3OW7A 3SYNA 1KMQA 2IL1A 1QDEA 4TL6A 3TAUA 1GUGA 4MZ9A 3IIJA 1NVVR 4D25A 1II8A 1E7ZA 2A19A 4DUZL 2LKDA 2I5MX 2N42A 2NGRA 1LTQA 3L82B 4XTRA 4Q1FA 4HAVA 5EZ5A 4A76A 4BWYA 3DZDA 4AYXA 1XZQA 2VS1A 2P5SA 1YI2A 5KPJA 1R0ZA 2DFKB 1B0UA 3KF8B 4DR7L 1P4SA 4B3CA 4V0LA 4EFMA 4OO1H 1XNQL 1KSJA 2PCLA 5FPTA 3CNOA 1W2GA 2IHBA 3KKOA 3O8BA 2Z0SA 4M1KA 3H86A 3RSLA 5CJPA 2CNWA 1TF5A 4IPGA 3RRYA 5L3RA 3ASYA 2HCJB 4HB2A 3FHCB 4YWKA 1DPFA 3W6NA 2V3CC 4AI6A 1OE0A 3A4NA 4HAZA 1T0JB 4QIWE 3X1DA 2GXQA 5FR2A 2ZU6A 2ZSBA 2GXSA 4JLBA 1KXLA 1NIPA 4UY8C 4DDTA 2BMDA 4BZQA 2BKUA 2O8DA 1E1OA 1YZQA 4A3CH 2RKOA 3PVSA 3NXSA 4B3RL 4LYAA 3R9WA 5EXSA 1Z47A 2CQOA 5UKDA 4KI0A 1OHHD 2DFTA 1TADA 3CH4B 4G5GA 1UADA 4IOKA 5CITA 2QQ0A 3MRSA 1J5EQ 1SXJA 1G8HA 4R2IA 1XTIA 3CRQA 2ZREA 4W9MC 2QNRA 1RL2A 1JR3E 5JRJA 2UXDQ 3K0CA 3A5UA 2R2AA 3HPQA 4Z8XA 5FOSA 3CF5A 3KTAA 2JJ1A 4Q5IA 1H9SB 4PZ6A 2WKQA 3AFPA 5KNBA 3NC1C 1SLJA 2DNEA 1IBML 1E2JA 4BUJA 4DCVA 4YONB 2RH5A 1E2IA 1IN8A 4IDHA 3GLGB 1CRQA 3CR8A 2GJSA 3K80C 4TVAB 3LO5A 3QXJA 2G1JA 3RRZA 2DY1A 3KJGA 2IYZA 1YIJA 2F3IA 1OKKD 5IWAQ 3RS4A 2NQ2C 1KHIA 1NNEA 3KFXA 3SJAA 4X8OA 3CMAA 2ZJRA 3T1YL 4OL0A 2AR7A 4YCUA 1AQUA 3I1FA 5FBWB 5LB4A 2QY9A 4QBGB 3E9IA 1P9RA 1X65A 1MOZA 1G8FA 1COWD 4DAMA 4JLAA 3EG5A 4NB3A 4DSTA 1EESA 4B3ML 1Z06A 3IILA 2ZSEA 1M1YE 4AK9A 3EBEA 1TQ6A 3S1RH 1D8TA 2OAQ1 3CUEF 3IIMA 4GSYA 3OIVA 1CP2A 2WAXA 1SKYE 4DPGA 3CPJB 5EE9A 3TR5A 4ABYA 2ERXA 1E9AA 3S24A 1KIXA 3EIHA 3W5IA 3PIOA 5TMPA 2GBLA 2PZFA 1OT3A 2W0MA 4DR1L 2IX0A 3THOA 3CRVA 4B3TL 2PNHA 1O7LA 5G3YA 3GJ3A 1UEJA 4IDQA 5A5GA 5BYKA 4FINA 5FLMG 2R6DA 3QKUA 4TL8A 2KCCA 4EPYA 2VEDA 1U94A 3G6EA 5FI1B 4MYCA 3CCVA 3UDXA 1G20E 3PF5A 2WM9B 1Z0FA 1KHTA 1UM8A 4FMDB 4JVNA 2ZANA 4OHXA 1UE1A 1HNZQ 1SKYB 1IJFA 2NO9A 2IX1A 2ODNA 1RZ3A 2ZRAA 3C16C 5EE0A 3F1ZA 2Z4SA 5EJEA 3LY5A 4YDHB 3SS8A 2EJFC 1DAIA 4DK6C 4WZ6A 2BM0A 4Q4LA 4N0DA 3S1AA 1DAEA 5DYGA 4APVA 2MO0A 4K0KL 4DV3Q 1HV8A 4GPTA 4TYYA 1NMGA 3B85A 4DIEA 3CIOA 3SFVA 3T1OA 1NTGA 3F0TA 2DYKA 3CQZH 2QE7A 4M53A 2WB1E 4C7OB 3CNLA 4KKUA 4LHZA 1F2UA 3UWOA 1KI1A 4OQNA 3C7KA 4CEJA 1YNJC 1X86B 2E5LQ 2IC5A 4OGQC 1K8GA 4ESHA 5FJ8G 4ZI2A 2J7PA 3HYTA 4DCNA 4C3JH 3QF4B 3FFBA 4Z8YA 4AWXA 1FUUA 2HV8A 3T5GA 4TLEA 3K0SA 3NDBB 1VG1A 3R8FA 2GNOA 4JYCA 4PC7A 4IXNA 2DBYA 4BBSG 1U0LA 1JXOA 2A3RA 3KOJA 4O0MA 1CR2A 2ZRHA 3D4RA 3HPRA 4CYMA 4A3CG 1HZCA 4A3FH 5JMTA 2O8BB 1OB2A 2WSSA 2GJKA 3OOCA 1VF5C 1N36Q 1KO5A 4Q1AA 2PPBC 4W5JA 3R9IA 3AKEA 2WB1G 2QG6A 1RC8A 4JKYA 5M3MG 2G77B 3KXIA 2LXKA 4HAWA 4P33A 2RF4A 5AJYA 1HNXQ 4TMXA 1D9XA 5J40A 2IYRA 3LVRE 1S1CA 2JK8A 3EQLC 2A6HC 1GL7A 1GKHA 1L1OC 3PO2G 2ZAOA 3EA0A 4KN7C 4MUAA 1AGPA 4A2PA 1VCMA 5L8VA 2C03A 2PLRA 3GJXC 3CONA 3LX8A 3KJHA 3SN6A 4TTRA 2MNAA 4PMWA 2JLYA 2W2XA 4IQZA 5JJLA 3HOYG 4JI4L 4LF9L 1GUNA 1VCIA 1E6CA 1GG2A 2JEOA 3EAQA 3K0FB 2A68D 3KF6B 4GNKA 4PSVA 1SHZA 2OSBA 1IY0A 1W47A 2IYYA 1G6HA 2WSMA 1D9ZA 2HJGA 2J45A 2IXEA 2O0JA 3A8IE 4NYIQ 2YJTD 3WMFA 3L2PA 4D82A 4QKQA 1E69A 1HZBA 1VG0B 2AKAB 1P16A 4MYUA 2ONJA 4XSGA 1YE8A 3BXZA 4B3TQ 1F6BA 2KHJA 2QSZA 3A37A 1Y1WH 3E2IA 3ZQJA 1K5DA 2XTZA 1VQNA 3CMEA 5BN5A 4RFVA 4Q21A 1H95A 4JJKA 2VHJA 2AWOA 1R7RA 3M6AA 1EWQA 2C9YA 1CS4C 4HLUA 3DLLA 2B7BA 2AFHE 1I4TD 2ZPTX 3UDFA 1NJFA 121PA 4AQYL 3RZDH 1UKEA 1N5JA 2YWGA 1HR0L 2OXCA 8OHMA 2K50A 1W1WA 2OTJA 1E2PA 1G17A 1P7CA 3T1TA 2F1RA 2IEYA 1Z5ZA 2HIVA 2ZSFA 2B7CA 2ZI7A 3FOZA 5FTMA 2RGBA 4BZPA 2VL7A 1W7AA 2CXXA 1FL9A 4LOAA 5B58C 2WMNB 1FW6A 5DI3B 1GKIA 3NEJA 4R98A 4YMUA 5FL3A 3IPXA 3PQCA 2OZEA 1Z29A 2O0HA 2EJGC 1F48A 1RVDA 3J7A5 1GM5A 5K36H 2OWOA 4GKKQ 4CEIA 4G7ZC 3FDIA 1UFQA 1BKBA 1EFUA 1L2TA 3SR0A 5JS8A 4JC0A 1NE3A 3CCSA 1HTPA 4GLAC 3RSOA 2YOHA 3WHKA 1CSQA 5LD2B 3CBQA 4O3MA 4X62Q 5M3FH 3W90A 3C5HA 4B76A 3CPFA 4A3KG 2VSFA 2ZYWX 3HDTA 3Q7QA 1G5TA 3FHTA 2ZSDA 4P74A 3TIFA 4FI3C 3GTMH 2NVYH 2F9LA 5JWRA 1GUAA 5FBLB 4EPRA 3QKSA 4EFLA 1P61B 4M8NE 4ZDJA 5IYCG 2BBSA 2QMHA 4IHQA 4WA7A 2R8RA 3VR5A 1VG8A 1WA5A 3EW9A 5EXXA 2FU5C 1E3PA 1AK2A 2A5YB 3UPUA 4DIDA 1NBWA 1P9NA 2YYZA 4DV0Q 1VYVA 1XEXA 4JBYA 1P2VA 2GVZC 3EARA 4OK3A 4BPBA 1ZYUA 2ZJZA 1VF7A 2EIFA 5D3MB 1S3OA 1W2BA 2F43A 5G3ZA 5KSPA 1T5EA 1KAGA 1UBCA 2L0XA 4KCGA 1JEEA 3TBKA 3I92A 3PCRB 2ZM6L 2K4KA 2NO6A 2DWQA 4ZDWA 2ORWA 4JLNA 4KFUA 4NH0A 2X8AA 5JCPA 1W36B 1KJYA 1IBKQ 3I4NH 5CB6A 2ZITA 1ANKA 2FA9A 2JLUA 1O7IA 4QOSA 4QGHA 3PITA 5FL7A 2PQAB 2XJ4A 3IHWA 4A3BG 1PH9A 4IFBA 1DAFA 4FWTA 3NBFA 3WYGA 2IWHA 1FJGQ 1GRRA 4PG3A 2GAOA 4DDUA 5BR8L 1ZIOA 2ZROA 1D6JA 2OQ0A 4F92B 1G16A 1ZM9A 2QM8A 3SI7A 1KZGB 1KL9A 1L0WA 5IT9c 3L8YA 4FCVA 1GUTA 1G7CA 4M2LA 3T12A 4UP7A 1QVCA 1TU4A 4AQYQ 3U4QB 4Q7JB 2FV8A 4CW7A 1KI7A 1KO7A 3UMFA 2V1UA 3CRKC 3HU3A 3OAAA 4HDCA 1IY2A 2NG1A 4Q4AA 4OI0A 1B9MA 3DM9B 1FTNA 1Q1EA 1TMKA 3PCOB 2A6HD 5HR5A 1LFDB 3RS5A 2AK3A 2EQBA 4ZPXA 4JKIA 4URWR 3AP3A 4KVAA 3QKTA 2Z6VA 1HYQA 3ER0A 1JPJA 4LBYA 4JVLA 5K8TA 4BLOA 3J81c 3N6RA 3CPWA 1XPRA 5FR1A 3UMSA 1G51A 1DADA 3ND8A 3LGJA 1YR6A 4UXJA 1ELOA 5FH9A 1P60A 4M1MA 5FTLA 4DKXA 3GD7A 3QVVA 2NPFA 2N3SA 3PUWA 2ASEA 5A35A 4URVR 4I1SA 3RLNA 3LWUA 3A8JE 1N6NA 2FPMA 5BWMA 4JI1L 2QA4A 4IKEA 4ZO4A 2SHKA 3AEZA 4GKKL 1AA9A 4HJAA 4KODA 1I6HH 1KI8A 4A93G 2V1XA 4EJSA 4P75A 3LNNA 4UNPA 4Z51A 3G71A 3KQKA 1VQKA 4A3GH 2RGDA 3BGWA 2QTFA 4LGMA 1N6RA 3SNHA 1VCOA 2ZVPX 2C99A 2FXQA 3C8UA 3H0KA 2J0UA 1GIAA 4XVRA 4BFSA 4TQUS 3W34A 5JSZA 3VKHA 4RZ2A 1DBSA 3RS2A 3H0GH 2VUMH 4YMSA 4OQXA 4JG2A 3LV8A 3K70B 1E1QA 4N0EA 4U7DA 4A15A 5FJ8H 4UNQA 1Z3IX 1Z6YA 1PMRA 3RC8A 4GP7A 2WIAA 3U7HB 3BFXA 4QJ5A 2ZE7A 2HIXA 4IPDA 2ZUBA 3AKCA 2KHIA 3GJ8A 1I4LD 1SVWA 1IYVA 3G4SA 1JE5A 1U8ZA 1EFWA 1Q12A 1I3QH 3EZ9A 3VR2A 2HLDD 3IO5A 4NU0A 4YMWA 5FPSA 1YZNA 5FBRB 3U9SA 5DHAA 3VX4A 2CNWD 5ELNA 4NXML 3S16H 2H7VA 2GXAA 4I1OA 1YZLA 2QA5A 4LW1A 5FBQB 2ZRNA 4Q9LA 2GBLC 1GAJA 1VG9B 2JLXA 2WV9A 3HOVH 4AD8A 1Z2AA 3HYRA 4BFZA 3D7MA 2XZPA 4B35A 1MRNA 1CJTC 2B3GA 1GL6A 2VQEL 1N6LA 2E2JH 4DR6L 4OWWB 4TMTA 1IBLL 2MSCB 1M90C 1R10A 3C4JA 2PJZA 4MYTA 4EX5A 1OH7A 4DUYQ 1CU1A 2ZJOA 4IEEA 1M74A 1ZCAA 1N32L 2D62A 1XWIA 4K8OA 2B8WA 1E0SA 5GJCA 4LJ5A 4US2R 4B3SL 1VQCA 1JB1A 1YNNC 2OFOA 4US0R 4ZIRB 3JC66 4I1UA 1G4AE 2YWFA 3KX2A 1EWHA 2A30A 2O8FB 4C9BA 4LUCA 1CR0A 4V0NA 2HYIC 5IRCD 5AJWA 1JJCB 4A3JH 1W0KA 4I4LA 4MRRA 3A74A 1KO4A 2XTNA 2CK3D 5CM9C 1N34Q 5E95A 3AM1A 4B74A 4AKEA 4XWAA 4BFTA 4UJ3A 3VNUA 2ZXUA 3L0PA 4WVFA 4G5OA 4DC9A 2ORVA 1J7KA 2EXDA 1J5EL 3SQWA 3SEAA 4B33A 4TYPA 1DVRA 4RKFA 4GLVB 5C0XH 2NO1A 3K9NA 4YLGA 2WAQE 1HT1E 3U4QA 3WWVA 1YVDA 5KO2A 5EAYA 4Q4HA 4TL9A 221PA 1WI5A 2VP4A 1IN4A 1Y1VG 3LW7A 4LF8L 3D8BA 3O47A 2WHXA 4FCWA 2JE6I 4ZV4A 4JYAQ 1NP6A 1P3JA 4BECA 4RFSA 2F7SA 1HJPA 4P0TA 4ZDIA 1TUEA 3TMKA 1OXSC 2PZGA 1NSFA 4IDPA 2AWNA 2OLJA 3GP8A 4UKDA 1LYLA 2PL3A 3NEMA 4D26A 1NMXA 2QT1A 3HKZE 3CH5A 4L5QA 3S2DH 4JV5Q 1E1QD 5KSZA 4YCWA 1IXSB 1XPUA 1BVSA 1OYYA 2VTKA 4PHHA 1PFSA 3IFTA 1XTRA 2H57A 3GTOH 3GJ5A 4OJQA 3NE5B 1G8PA 4OQLA 4QNRA 4Q4JB 2WTUA 1VS0A 2GWHA 4M9XA 1X8LA 1UKZA 3MWKA 1H9JA 1PYBA 3KUCA 4MH0R 3RNLA 2H1LA 3NH6A 2UUBQ 3FHWA 4PC6A 3PV0A 3TUIC 5HKKD 2P67A 3GDEA 1WDTA 5JFGA 2GK6A 1IYJB 2DR3A 2KWIA 4OKSA 1JR6A 4RZ3A 1DO2A 4LV5B 4ZKEA 3KQLA 1I6VC 5EXPA 4BZXA 2K5HA 5JWOA 3KQHA 3ZZTA 4G1UC 4LJYA 5LD2C 2FE4A 2FSFA 3HU2A 1H9RA 1VQGA 1KY2A 1Q3TA 4JVSB 3A0JA 4Q1BA 3R8CA 1WB9A 3A8KE 2ID0A 1UDWA 3JVVA 4I7ZC 3OIUA 4Q9HA 4JI8L 4ESVA 2QL6A 4DUGA 1EQRA 4DK3C 2I0QA 1QZXA 2NZ8A 3K0AA 4Q48A 3EA5A 4JI5Q 4NCJA 4ZI3A 4Q4HB 2VF8A 4M1OA 1V5WA 4YY3L 3TRFA 4R9UC 1ZW6A 3ETLA 3SBDA 3KQNA 3TKLA 1JPNA 2DNCA 3WBKA 2Z5FA 4V0MA 4A3EG 4WXRA 1P6XA 2WP8J 1K9MC 3CF6R 3BIFA 3W9YA 2GVBA 1A82A 4IJLA 2PH1A 2QEQA 4WJ3M 4PC3A 4JIMA 1N6HA 1KQSA 1X9NA 1JJ7A 1OLOA 1NSTA 1NVXQ 3AB3A 1CJKC 2WIBA 2V1CC 1GFIA 4R2HA 2OLKA 1WJJA 4NE2A 2PZEA 2CE2X 1R0XA 1DXMA 5E4FA 2FG5A 4JOIC 3QKSB 3SGIA 5JECA 2FEOA 4DVGA 4IJHA 5FLXc 5LBIA 4RJLA 4MQBA 1CKOA 1YHNA 4GI7A 4JSTA 1IXZA 2GJAA 4EPVA 2OBLA 1QVAA 2JA8H 2QI9C 3FMFA 2NZHA 4PZYA 1ONLA 1K8OA 2ZE5A 3F2BA 1H8HA 4ON9A 3B13B 1X55A 1FMLA 2NO0A 3I61A 5JSZB 1HQCA 3LW8A 1EIYB 4HZUA 3W5OA 4MGYR 4P31A 3J80c 5HE9A 2CFMA 3G82C 1N6OA 1XMQL 1CBUA 2ECKA 1P2UA 1X6OA 3DDCA 3CX7A 2O8EA 2G1KA 2ZRIA 1Z28A 1SVMA 4C0LA 3HOWG 1VTKA 4HLQB 5KSYA 2ZJQA 5H1SE 5EZ6B 4DCSA 1U0JA 2D2FA 4KU4A 3S1MH 4LC0A 4S35A 2NIPA 5HZKA 3VAAA 4JBMA 1WFQA 1FMJA 4URYR 4X8LA 3ADDA 2PT7A 2XOKD 3BFVA 4DR4Q 4JI3L 3CF0A 4XVUA 1QZHA 4OK6A 4WZAE 3OTOQ 4AURA 1P9WA 2Q3MA 3VTKA 4HDQB 1UF9A 1G8YA 4OJKA 4OXPA 1DG1G 1HE1C 3V00A 3MXNB 2ZTSA 4JI0Q 1G41A 2DPXA 3WHLA 2ZIAA 2JCSA 2I5HA 1YNXA 3TS0A 3HKSA 2G6BA 3ZS8A 1XD8A 3KLWA 4M1TA 4JI6Q 2F4VQ 2C04A 2RAPA 4QHYA 3T34A 3QSYA 4DLYA 1XTKA 4GN3B 4MTNA 2JA6G 1E9DA 4KSCA 4NXMQ 4IFDG 1TWGH 2K33A 1Q1QA 4A3DH 1UBGA 3FMIA 3FMOB 4BFWA 1ODFA 1XCMA 2ANBA 3VQTA 4IJMA 1NY4A 5DNYB 2YOFA 1HR0W 1N25A 3CAMA 5KNCA 2IXFA 3GLIE 1KNXA 4A82A 3L0SA 1Q44A 3RRMA 4KYIB 3C5CA 1YZ6A 2JA6H 3H2YA 4FMBB 3AVWA 3ZVNA 2XTIA 2W6IA 1IBRA 4PSAA 1UAAA 1FVIA 2RGNA 4LV6A 3OE7D 1ONBA 4LFBQ 3OF5A 4ASUD 4DKAC 5M5XH 2EU8A 1TNDA 3SOPA 5GJWC 2CHGA 3U44A 1VQIA 4EQ6A 1OW3B 1C1YA 1D5CA 3P26A 2G9NA 3I8XA 2VSOA 3VU9B 3IQXA 2FZ4A 3LLMA 4B2IA 5CDFE 3SYLA 3HOXG 5C2JB 4C2TA 1S8FA 2HF8A 2QAJA 2PBRA 3QXCA 4KLNA 3WMEA 4A8JC 2JA7G 1Y1VH 2WJYA 2GEVA 1AQYA 1VQFA 3NBHB 1GNPA 2I1VB 4JSYA 5B64A 2FSGA 3ZS9A 4FW9A 2YWEA 4LC1A 4BLSA 1KJWA 1OFUX 4TSFD 1MH1A 1JBKA 2XITA 1UWVA 1QG2A 2GZAA 1A1VA 5GROA 1VYUA 2WOJA 2WMOB 3WXMA 1ZVQA 5FUWA 4DCUA 4XTCS 4AG5A 4C4PA 3E70C 5G53C 4OO1I 4EPTA 4BY7H 4NONA 1P73A 1TL7C 4EJSB 5J4LA 1GITA 4JI7L 5LPNA 1GUOA 1DO0A 2F52A 3IRBA 4A3JG 4LF8Q 1KI4A 1SVOA 2GF9A 2VHTA 4LJ9A 5J4YA 3JZAA 3UXMA 5GJVC 2NTYC 4HLDA 2ATXA 2UUCQ 2ZJAA 3RS3A 4JL5A 1HE8B 2J5XA 5D3MA 5EUQB 3AV0B 1HH4A 4LBZA 4BFXA 5GAHC 4OX9L 1IW7D 1NBMA 3AF0A 3CCLA 1MV5A 1XJ0A 3JVUA 2QTHA 2ZSAA 3HR8A 4LWCA 3B1ZA 3D0FA 3AFQA 1MRSA 3RNUA 3B9PA 2D5DA 1NJIC 4K81B 4NYMQ 4JK1C 1CTQA 3OTOL 1MO5A 2BH8A 1Y8OB 3MFYA 2RGCA 3KB2A 1EX7A 3RWMB 4C2UA 3CKLA 2XB2A 4DB2A 2VO1A 3T1HL 3KJIA 3KXKA 4Y0AA 3GLGE 3U3KA 3FKSA 3OEED 1ZUHA 3FPAA 1E2HA 3ZLJA 4OI2A 2O52A 2P6RA 2R6CA 1OFHA 1AE2A 4LF4Q 2K32A 1ESMA 2ONKA 5JHHB 2PCFB 2QSYA 5FL7D 4A6PA 4DB4A 1VQ7A 1A5TA 1YBYA 1DAHA 1L4YA 1S3GA 4LFAL 4HIMA 4NCKA 1V43A 3O8DA 2ZTCA 2YTVA 5K8LA 1PH2A 2R92H 1LW7A 4JLPA 4DT1A 3HKZG 2ERYA 5BN3A 4JLVA 2AXPA 1SGWA 3ECCA 3UG6A 5B30A 1DD2A 1J90A 1VIAA 2XEXA 1HTWA 3IUYA 4B3GA 4TZ0A 3G48A 3UMRA 3GFPA 1QVFA 3QI2A 2XZOA 2W6JA 3BZKA 1E96A 1G5RA 5C4GB 3SJBA 3ZVRA 5IY0A 4NMMA 1JAHA 2V55B 2W6ID 3QG1A 4O2LA 3ASZA 1IYUA 4A3LH 1U90A 2GCPA 2RGGA 2BMJA 4FMDF 4DR7Q 1QJOA 5EUMA 1K3RA 4LUOA 2CJWA 2K75A 1E4VA 1ETUA 1WQ1R 3NELA 1K8RA 4I99A 4Q4JA 4YXWA 2QTVB 4KKTA 4OX9Q 4RCZA 2KSQA 4QQBX 1JECA 3VFDA 1I2DA 4KFSA 3T61A 4A0HA 3AVUA 2N8NA 4AKGA 1VQHA 3GJ6A 1W0JD 4KKSA 1PHJA 3B2EA 3U58A 3MJHA 2QEXA 1KKLA 4DHEA 3P4XA 4HR7B 1VQPA 5KDOA 1DGSA 2NVQH 1SKQA 2FFAA 4HZUB 3ICQB 5GADl 4RZXA 3BC1A 1F60A 2K5UA 1L2FA 2B6HA 4PZZA 4C0SA 1TF2A 3CW2A 5CIQA 1Z6TA 4M1WA 3T1VA 4O25A 4C0BA 2IK8A 4GOPA 4C0HA 1CJUC 5FI0B 1S96A 1YU9A 4CIDA 3MCAA 3NDPA 4GBMA 2WWYA 4MDEA 1M7BA 5CYOA 4PXAA 1MIUA 1E98A 2KCTA 1VQBA 4LFAQ 5C4XH 1E1TA 2EYQA 3DO6A 1KMHB 1BKDR 1S9DA 2Q21A 4MRPA 3S17H 3M9BA 2CCZA 1N3BA 2R44A 3QXSA 2P5TB 1W4CA 1OTCA 1R5BA 4AG6A 2WJVA 2H8KA 2ZJ8A 5DYIA 2C35B 5KU1A 1SXJE 4DR3Q 4D0GA 1R9TH 2TMKA 2GESA 1PH7A 2WZQA 4C0AC 2QP9X 3SE0A 4HB3A 3AEVA 1AS0A 2ODWA 2VA8A 5CDFA 4YDSA 4DR2L 4BFYA 3DM3A 1BH2A 2QQEA 1QUQA 1UPTA 4L9SA 2WOOA 4GN4B 1WCV1 4A0FA 1NKTA 3T1YQ 4W5HA 2P65A 1Z6HA 3J81k 2W0SA 4UP8A 1YZKA 3DHWC 4C2MH 4CT4B 3PEYA 4FXPA 2CL0X 2X77A 4LF6Q 1TEXA 2ZUDA 2VW9A 3K0EA 2IYWA 1U98A 1U81A 3CRW1 5J47A 3U7FB 4POAA 1KNQA 2JLZA 2JLWA 4A4IA 4QGGA 2F1HA 1U2RA 4GOXA 1TKWB 2J0UB 4HEJA 4A3DG 2JLVA 4KLKA 4DV4Q 4GOKA 3OFNA 4LNQA 3STBD 1T8UA 4PAOA 1X56A 1EFTA 1ZNXA 2YC4C 3A1UA 3QVUA 3JAMc 3Q3JB 2NN6I 5EP2A 3RN2A 3FHOA 4JZKA 5C0XJ 4LK1C 2Q9BA 3DZ8A 5JEAG 2W6JD 3K0FA 1W49A 4TLDA 1G8GA 2XXAB 2E2IH 1Z63A 2VHQA 1E2ZA 2K52A 1KI3A 3K9LA 3THWA 1CJMA 1TU3A 4IO9A 4GZLA 1XTQA 1KAOA 3QIAA 1HPCA 3BJUA 4LK2A 4PHGA 3WNCA 3X1ZA 3TVTA 2B92A 3TLXA 3I4MH 1PLJA 1LVGA 2BHRA 3GLHB 5CYPA 1KK1A 4WOPA 4IDNA 3ZJYC 4WJ4A 2JDIA 4Q7MB 1R0YA 2F9MA 1RRGA 1CSPA 4QL3A 4DV6Q 4JLKA 2E76C 5L3VA 5SZJA 1Q81C 4GZYC 2IHEA 5HY6A 1I2MA 1KOFA 1IN6A 3VR6A 4DT1B 1WCMG 1UKYA 3HFZB 4GLXA 2JAQA 5AUQA 1EK0A 4BFUA 5CM8B 1H9KA 1CUKA 2D06A 2QENA 3AP2A 1XNQQ 3KKQA 3CX6A 3U7EB 4Q1CA 1Y14B 3HOWH 4NYMR 1TPZA 1AZTA 2ZAMA 3I5YA 2YVUA 1FOEB 2CMKA 5HGQA 3WRXC 2NMVA 2MO1A 4PAMA 621PA 1P5ZB 1WP9A 2AN9A 1AE3A 1EFHA 2VP2A 2G3YA 1LUZA 1XEWX 3FVQA 1FR3A 1E9SA 4C0JA 1YJ9A 1NBMD 4E07A 1VQJA 3GCGA 3VHLB 1IL2A 4JV5L 4C3ZA 2B29A 1HNWQ 3I4OA 1LY1A 3X2SA 5GVSA 4RD3A 3QF7A 3MWJA 3W5JA 4KHPL 3ERSX 1NN0A 2KI5A 3GEIA 1U0HC 3LXXA 4PR0A 4OHZA 3SZRA 4DSOA 1XMVA 1S72A 2QMEA 3TE6A 4LJZC 5C4MA 3PJRA 4V03A 4OHVA 3QG5A 2YC2C 3LBHA 1E9BA 3PENA 3K9GA 4A93H 1WRBA 4KVGA 4OI1A 5KHOC 2FFBA 2QM7A 1HZAA 3RR5A 1VPLA 4BASA 2HHHL 2ZYVX 2BC9A 3A1TA 3K1JA 2IX3A 1EQQA 3HOVG 1M1KC 2CVHA 3S2HH 4IPCA 4O2DA 3GJ7A 3QKRA 5FUXA 1K0RA 5C18A 4EDHA 1OV4A 2CKZB 4F7WA 4GOPB 2B8FA 2OTLA 1YHAA 3AGPA 3DMDA 2I4IA 3E5HA 1LV7A 2NOAA 4DCTA 1KDOA 3TQCA 5KYKA 1RRCA 2X19A 2ZS9A 4OWXB 1Q8KA 2YTYA 4Q19A 1US8B 3BE4A 2QGNA 1NLYA 1R4AA 1NI3A 1MO6A 3U4ZA 5F2EA 4B75A 2F1JA 3MSXA 3P20A 4BE7B 4IOMA 1G3UA 1OXVA 1N5KA 2D0OA 3AF4A 3BAFA 1Q3HA 3T1HQ 5HE8A 4TN1A 4DWJA 4B3MQ 3NBZC 4L16A 1M34E 4B6FA 3GLFB 3IPYA 1NLFA 3A7LA 2OXRA 3KKPA 3ZZ0A 4CEJB 3G5UA 4W7SA 3UG7A 4OHYA 2ZI4A 2QN6A 4JBKA 1IY1A 4LF7Q 2DUDA 1E9EA 3UK6A 2RCNA 2UXBL 4QJ4A 1RPZA 2O8FA 4KAXA 4TKOB 4GZMA 3OYYA 1Z0KA 1RRFA 3Q72A 4Q66C 2CBZA 3TEHB 1E9RA 1NRJB 4A3GG 2REBA 2OE2A 2BE5D 3GTQH 1SVLA 2OFXA 1E2WA 1C9OA 2UVQA 4TSFA 3HOUH 3KKNA 2PLFA 4P4TA 4PANA 2IYVA 3CZQA 3WYAA 2IYTA 1GUSA 5A4JA 5KDDA 2JA5H 3QJYA 3RS7A 3GMTA 2HHHQ 3MD0A 4A3FG 4QJFA 1QHIA 2KJQA 1JJ2A 1II9A 3QEOA 4FMCB 1ZBDA 4HATA 4ZCIA 4GRAA 4BBSH 1W4BA 3KFVA 4BFVA 4HAYA 3KUDA 4A3IG 1O78A 1G21E 1H8HD 1G291 3ADCA 1VKJA 3DMNA 4PZ7A 1M7GA 1Q57A 3CM0A 1CFMA 1XMQQ 1HZ9A 2E8GA 1GKYA 2JJ1D 1UE6A 1SVSA 4EQ6B 5C1BA 2UZ3A 3SJCA 2JLRA 4EPWA 5G40A 1EIFA 4M21A 5HCNA 3OIYA 1YR7A 1A2KC 1Z0AA 1JR3A 1MJCA 3CWZA 1SVIA 2JIZA 4PO9A 821PA 1QBKC 2E5LL 3F5FA 4IW3B 1OIWA 2GA8A 3CCRA 3B5JA 4CVNA 2Z43A 5J4HA 5LMNQ 1VQ9A 1ZM2A 1G9XA 2IYLD 5SZHB 4DK1A 1TAGA 1KD1C 1KRSA 4JI3Q 4KYUA 2UU9L 3ZZUA 1B23P 3SFZA 1X3GA 2H16A 1CKNB 1IHUA 2UUAQ 1E2DA 2D4HA 2EWVA 4Y52H 1RW4A 4ZDKA 3WDNA 2YWHA 1MKYA 2QPAA 4LHWA 4B44A 2A6ED 5K36G 1KZ7B 1YKSA 2ZQ5A 1ZINA 3BERA 4RMFA 3BWDD 3OIWA 4KV9A 2OAP1 3C15C 4BLPA 3WMGA 4P32A 4H1UA 1CRPA 4AY2A 4TZ6A 4DLZA 1FFHA 3GJ4A 1LF0A 3NHAA 3OESA 3LBIA 5E7IA 4J15A 4ERNA 4XWKA 4U5XA 3VDYA 2G0TA 1OH6A 1PA6A 1N5IA 2FNAA 2ZRBA 4P4SB 1QHHA 4QC2A 3O8CA 1IQPA 1YJ5A 2WWGA 2CCJA 2BV3A 3UATA 1TXYA 1W44A 1ZRHA 2R6AA 4P4SA 2D7DA 3VHXA 4EFNA 4NXNL 4GS3A 3U3RA 1KI9A 2REXB 4NZYA 3M0EA 1OFIA 6Q21A 1YR8A 4KITB 3FP9A 1EFRA 4L5SA 2DFLA 2IUTA 2ZI3A 3WNDA 4A75A 4CRWB 2O8CA 1CR4A 1YRAA 2ES2A 2WWXA 4JI1Q 3K09A 4M0LA 2KB0A 1JAIA 4OQFA 1CR1A 1HQYE 2V54A 4R7ZA 1E0KA 1PH1A 3GTPH 1TUIA 2AL7A 1Y8NB 4Q4AB 2ORIA 5JEDA 1XEWY 4LF7L 4TLAA 1MT0A 2MMGA 2CL7X 2IW3A 3DPUA 2K5VA 3PEUA 5LMNL 2F55A 4IOCA 3TVDA 2KCMA 1XMJA 2Q3FA 4ITRC 1FTSA 4D4KA 1YZUA 3MMPA 4M9ZA 3V4RA 1LABA 1FPMA 2A2ZA 3QPVA 2XSZA 4L5TA 3M4OH 1DS6A 1MABB 1NF3A 4TYNA 3CP0A 5EE5B 4EKDA 2GJ8A 2FPKA 2WJJA 2X2EA 1ZMXA 1A6XA 3QY0A 5H1YA 4M22A 3I4LA 5JCZA 2ZS8A 2PI2E 1XTDA 3FB4A 3UANA 1HR0Q 3Q8DA 2PT5A 4DV5L 2Q6TA 1YHBA 5EE1A 2IS2A 1U99A 3MAAC 4YMVA 3V9PA 4TQAA 2WWWA 2Q2IA 2P3SA 1PLLA 2RGXA 4DDVA 1ZNWA 1FP7A 4PPGA 4BGDA 3PO2H 1EFRD 1QHHB 1VYTA 1W36D 3QENA 1WBDA 3M4YA 3D6TB 1T5IA 3LQRA 5P21A 1OSNA 2CE7A 3TUJC 1T0HB 2N49A 3A1VA 3THYA 3ZGXA 3AVPA 4DLVA 2OO7A 1P62B 5M3MH 1QG4A 2HT1A 4QBHA 3HOUG 3F8TA 2F6RA 3H84A 1L8QA 3NHBA 1I94L 4II7A 4PHTA 3D31A 2J0SA 4B32A 3Q9LA 3JZMA 4BQSA 2E2HH 4P3YA 1E2LA 1V9PA 2R7ZH 1ZJ6A 2A5DA 2ZI9A 4E09A 4PO8A 1OB5A 2IS1A 1OPXA 3M7NA 1Y1WG 1XD9A 1U9IC 1XDBA 1ZNZA 3BH6A 2OUKA 3U6KA 1G6OA 1IOZA 4LPSA 1P2TA 3PUXA 3KZ1E 3AVTA 1IZ6A 2OILA 5FPYA 2PEYA 3EX7C 2IYUA 1OKKA 5DISB 1HUQA 3OPOA 4FN5A 5FOUA 3B1XA 3U3OA 3VX3A 3W8RA 4FDBA 2AHOB 3K81C 4J0QA 4LV8B 1TWCH 4G5SA 2VQFQ 3VMFA 1UBEA 2I1QA 4B3XA 1N34L 5JHGB 4L8GA 1ASZA 4BXXG 3VA7A 4LBWA 4D4MA 3WNBA 4JLJA 1N0WA 1WYDA 2X1VA 2J87A 4CT5A 4LYFA 2K14A 1J70A 1GWNA 2XB4A 3OZXA 2CK3A 2FGKA 3PUVA 4DNRB 4A3MG 1NN3A 3B82A 1TWAH 4NCNA 4CEHA 2CJWB 1XRJA 4NYJR 2GN5A 3RN5A 4XSHA 1VQEA 2FX3A 3CLVA 1U8YA 2LCFA 3RLOA 2VZAA 3CR7A 1H8ED 1NMYA 2GCOA 2IWRA 4OONA 1T9HA 1KDRA 1X1RA 1KK3A 2ZRCA 1XB2A 3VKWA 3TUZC 2UZIR 3S15H 1T4GA 2YZ2A 1ZAKA 3K70C 1XTJA 2OEPA 4MKFA 4BLQA 1NIJA 1SRUA 3EZFA 5BQ5A 4RVCA 1FGUA 4EQ5A 2EDGA 2VP0A 4B3SQ 3AKDA 1QF9A 5IP9H 4HIOA 4ALPA 1Z6XA 5SZKB 3FKIG 4A9AA 2O8DB 2RGAA 4HUQB 1KRTA 3UDGA 1JXMA 1GHKA 2ZR7A 3K8YA 1T3SA 4OQMA 2BH2A 5JJIA 5CK4A 4BRWA 2E9SA 2VH5R 4WAUA 4DXAA 1GP2A 1FJGL 3L0OA 3K7AH 2LWIA 4DR5Q 2WPDA 3U3MA 5JWHA 2CW0C 2Q0HA 1NG9A 3CXCA 1LTLA 2FDCA 1TEVA 4IFDJ 3K70D 3QPWA 2DGYA 4R4OA 4PQRA 4BY1H 2ZRDA 4M9QA 4QXAA 2PJRA 3UE1A 4DV7Q 3CC4A 5DIFA 1Y8PB 2VBCA 4PPFA 1SMXA 3JAMi 2DHRA 2C78A 4C3HH 2VYFA 2C2HA 1LS6A 5J5CA 3NG1A 5JI2E 3O8RA 4LJAA 5HKKA 2DWPA 1D2MA 2LKCA 4IEIA 4LHXA 4U02A 4Q01A 2V6IA 3WRYC 2IS4A 4MKIA 1XD2B 4AKHA 5AUPB 2VPPA 4O2RA 3AQ4A 2NN6G 2AUJD 1GOTA 1XJCA 2AK2A 1A4RA 4JI8Q 2P0EA 4DSUA 3I32A 1Y69U 1X8JA 2FSIA 1SE8A 3B1VA 4XJXA 3I4MG 2GAAA 2OT3B 3KJPA 4NCIA 5TDHA 1T3HA 4EJSC 4EPXA 1JJGA 4Q47A 2JJQA 3R7WB 2VQSA 1XBTA 4NPHA 4IDOA 1DAKA 2IYXA 2Y8EA 3EN2A 1R8SA 1B7YB 1T6NA 4JYBA 2H5EA 4PO1A 4NCHA 3UDIA 4MRNA 1VQOA 4QGUA 4HJ9A 2G0NA 3TR0A 1GZSA 5E7JA 3CC7A 4LFBL 5GJBA 1W0JA 1YZTA 1Y63A 1BO6A 3ZJYA 2O8BA 5IP9G 1SQ5A 2PCJA 5GQOA 3HP1A 3FMCA 4F4CA 2EFEB 3EASA 2IUUA 3NKVA 2H5XA 4ZIRA 4MITA 1OIVA 1NL3A 2XGJA 2AX4A 4JLOA 5AJXA 2XXAA 3P1JA 1W4AA 5IK2D 1H65A 4PPQA 1RJ9A 2I5LX 4QGAA 4WIAA 3UKDA 2O8EB 3PEVA 1SN8A 2B21A 2C96A 3N2IA 4LPKA 4V0OA 2J7KA 2LSSA 3HOZG 3KYHC 1E0JA 1OIXA 4RD0A 4XH9B 4B3DA 3GTKH 3SJZA 4R71A 1K8MA 1AKYA 1CF4A 2EFHB 3GLGA 1NY5A 5JRZA 3THXA 2GF0A 4DZZA 1W46A 3GEHA 1J99A 1Y3AA 1ZD9A 3DOFA 3EPHA 4DNTB 3PSIA 4BXXH 4R4QA 1Q86C 1OFTA 3B7GA 2X2FA 4P73A 2OHFA 4JLDA 1JMCA 1XNJA 5DI9A 1AN0A 1VIYA 1XMIA 2W2VA 1MO4A 3ZH9B 4KLZA 3RHFA 421PA 3TREA 3ND9A 2Z6KA 4L5RC 3CRRA 1K8AC 1E79D 1MABA 4RCYA 3GPLA 3H3VH 1HA3A 2MSDB 1XU4A 2UXCQ 2QORA 3R20A 4GMXA 1QUQB 4C7OA 4FD2A 2HEIA 1ASYA 4HI0E 1KYIA 1J8MF 3TJZA 1IBLQ 2AUKA 2BJWA 4QFMA 3T53B 3HOYH 4DEXA 2DB3A 2NO7A 2QAGA 4JT4A 3H4MA 4A3IH 4YC7A 5IWAL 2QRNA 1N32Q 3F3YA 1SROA 2ZJPA 1W48A 4D6PA 4XD7D 5DN6D 1Z0DA 5DLQC 4GNXC 2KE5A 4F93B 3UWKA 1KK0A 5FOXA 2R7ZG 1T8TA 1YVCA 1B9NA 5ELOA 5C3EG 2PX0A 4BA2I 1VCNA 1Q90A 5TY0A 5AK0A 4DV7L 2XOKA 3HGBA 5IYBH 1QVRA 5IYBG 2XSZD 4Z1MA 4IFDI 1M2OB 2DFNA 3QBTA 3GTLH 4HZIA 5HTKA 5TXGA 1GD7A 1GRNA 2QUZA 2HDNB 1F3OA 1DG3A 1KTVA 1VHTA 3H3VI 2WBLC 3A36A 3FPPA 4M9SA 3A4LA 3LFUA 4GOPC 1XEFA 1Z6AA 3N5CA 3PO3H 1DEKA 2F3TA 2WPDD 2XJ9A 1A63A 4RCNA 3CW2C 1C0AA 2ZE6A 3LH5A 2CLCX 3J7ZC 1KIMA 2FH5B 3RAPR 4G7HC 1RE0A 3CCMA 4Q03A 1G6PA 4XWOA 1BMFA 3LA6A 2QMOA 4ARZA 4GKJQ 3NIBA 2OQKA 2CHVA 1M7HA 4Q9KA 3M4PA 3VU9A 2WVJA 2GJ9A 5E7MA 3Q8XB 2PMDA 2UXCL 1JR3D 5K8IA 2EQSA 2KA7A 2FGJA 4IPHA 3IKJA 2NZJA 3N70A 1ZC4A 1E2MA 4K0KQ 3NENA 4KXFB 1OXUA 4E22A 2BBTA 4RD1A 3ADBA 4GL2A 4DJTA 5L3QA 4RKEA 3U50C 1K5GA 1T3LA 3OE7A 1E24A 2R93H 1HH2P 2PMKA 4JMPA 4Q9IA 5JZVA 3NBXX 3ZVLA 1ZC3A 3CPEA 2XNDD 3TH5A 3U6BA 4S2EA 5KDLA 5C46F 2A78A 4LF5L 2FZLA 1AH9A 3U60B 2IS6A 3MWLA 4KJZA 3STBC 4HLUC 2BMFA 2BIFA 2A8VA 2ZR9A 2JLQA 2VIIA 5JJKA 4GT1A 4X64Q 1C7YA 5FLMH 3P27A 4B3BA 1OJLA 2HUPA 3VNVA 2PMZE 1RYHA 4OWTB 1G18A 2H18A 5DI3A 1AZSC 2CLDX 4TTPA 2JA1A 5AUNB 1KAWA 3J81j 1D7QA 4LWZA 3TK1A 4A36A 3I2ZA 4QRHA 4QHSA 5AJZA 3F2DA 2UXDL 4YHHQ 4B2LA 1X1SA 3PF4A 3GJ0A 2A5JA 3X1WA 2W2TA 3T51B 4DR2Q 4B71A 1N33Q 3AYHB 1JT8A 2PEZA 2V7QA 4M1SA 4QJ3A 3M1IA 4XD7A 3B8HA 3P32A 3EZ2A 4QGFA 5DN6A 5M5WH 4QG7A 4DRZA 5IF9A 3TGPA 2QP3A 4BBRG 1GKUB 3B1YA 1QRAA 1E32A 3ZIAD 3AVVA 4H02A 4LJ7A 2MMCA 1Q21A 3MUFA 4WW0A 3GLIB 1OXTA 1ZM3A 3WBJA 4JI2L 1FNMA 2BCGY 1Z9FA 1A8VA 1G3RA 1E79A 4QM6A 2KBEA 3F2CA 2JA7H 1MKHA 3FTQA 4YCVA 2HF9A 1JEDA 2V6JA 2ZVQX 2A1AA 2F3RA 3EPJA 5CIWA 3WP1B 1EWIA 4YWMA 2AHOA 3TZUA 2HCBA 1FL0A 3KDFA 4LYHA 5CLLA 3RC3A 1UE5A 3GO5A 3RS0A 5L3QB 1NMFA 2IA5A 2DN8A 2VSXA 5JEAH 4DV2Q 1SULA 1CI3M 2BKEA 2GZHA 2O0KA 2ZRPA 3U5ZB 3AP1A 4MGIR 1ZM4A 1OH8A 3FKIH 1KSHA 1Z83A 3RYTC 2QZ4A 1PZNA 4A8JA 2K7VA 1DOAA 2ZS7A 1G4UR 1PUIA 1FX0A 3BH0A 3RLFA 1BBWA 2QGQA 1X3EA 4JI7Q 5H70A 4HUTA 2REOA 5TV2A 2J0QA 1XJQA 1XXHB 3KDSE 5DLQE 4L9WA 1GNRA 1TU2B 3BB4A 4YHHL 2LXJA 1AS3A 2IYQA 5GADC 2JDID 2ZJ2A 2UUCL 2HLDA 2VLIA 2ZRLA 1X8KA 5JBQA 4H44C 4BA1I 2MQHA 3FKQA 4JJZA 3AH8A 4L15A 1XX6A 3SC3A 4D4JA 4PV1C 2RGNC 3H1TA 4UPAA 3T15A 1E2NA 3DVLA 3THXB 1I50H 2B8TA 3Q5DA 1KJZA 4A3MH 3EWSA 4NXNQ 3N2EA 4YWLA 2BEJA 5DHFA 4GFDA 2ZEJA 1KMHA 4F38A 3M85A 2EJMA 1OYWA 1GO3E 3KFUA 4IVRA 4BRUA 3IEUA 2IT1A 2QP4A 1VHLA 2O8CB 2W83A 2GTPA 4Q7LA 5H8WA 4TL7A 1PUJA 2QPOA 3J80i 4LFCL 1G5PA 4TMZA 1NBME 4LF5Q 1EUJA 3TAHA 4G5QA 2L5TA 3MEFA 4PQFA 4A0GA 2VY3A 2BE5C 3S1QH 4PTLA 1CEEA 2ZRJA 2ODBA 4URUR 4LF4L 1HNWL 2WKRA 3SHFA 1JJVA 2A7QA 3U61B 4QNMA 4LCBA 3RRNA 5C4XG 2P2LA 2XAUA 1XXHE 1C4OA 4AYBE 4GNXB 4JBJA 4FWIB 2RB4A 2QAGB 2BBOA 1X3SA 4BLRA 2HQLA 1AIPA 1NKSA 2QU8A 2XGTA 2F1IA 5BW8A 1YHQA 2QROA 4C30A 2A69D 5CLQA 4RD6A 4LBVA 4RZUA 4POFA 1YJNA 3EZ6A 5F9HA 1VQ8A 3OFND 3REGA 1LM0A 1G7RA 1XP8A 3PIRA 3D3QA 5IE8A 2EYUA 3NEYA 4NL4H 2ZT9C 2ZUCA 3MJRA 3L43A 3C41J 4CGZA 1Z2CA 3T06B 2Q2HA 3Q5EA 3H15A 2ZJ5A 4LJ4A 2G83A 4IVPA 3VR4A 2R65A 2H17A 1YQTA 3W3ZB 3LRPA 4UNNA 3W1BA 4GDFA 1Z08A 3S14H 4MUBA 1XXHA 5DE3A 2XZLA 4HUQA 1A0IA 4X6AH 2R7DA 2D74A 1H9SA 2GHIA 2IBMA 4IFEA 5HCIA 4CDGA 5F98A 2J9RA 1D2EA 4WZBE 4LHYA 4X8HA 4LF6L 1DAGA 4G7OC 1S2MA 3FYHA 1WMSA 4BLTA 2QMUA 5FOVA 3T56B 4Q00A 3TW8B 3QKRB 1R2QA 4QHTA 2YV5A 3LVQE 5AUOB 4FMCF 5L3SA 3QNUA 4F4JA 3M4QA 4Y0VA 3K09C 3EIVA 2P6NA 3CRLC 3ZD7A 4AYBG 1PH6A 4H1VA 2C8VA 1SXJC 4LDJA 1W36C 5KOYA 4B3RQ 2QBYB 4TMKA 3SU8A 2ZE8A 3EIEA 4ACAA 4JL8A 2A6EC 3PEWA 5FPHA 4JOIA 4OHWA 1YZGA 4M1YA 1MJEA 1Z6GA 2O5VA 1XD2A 4F91B 2R9VA 5EP3A 1SHKA 2C9CA 2HT6A 1KI2A 2JEBI 4KFTA 4MGKR 1X3FA 2IY5B 4JCVE 3IO3A 4RY2A 1VDZA 1E0AA 3KDFB 5GVRA 1VQLA 5K8UA 5M5YH 5C44H 1QZGA 1PH4A 1SXJD 4JS0A 4XOIA 5HZHA 1UEBA 2NVXH 3BK7A 2AKWB 3AQQA 1YJWA 5BN4A 3KJEA 2NZOA 2AFIE 4ACBA 3S1NH 3NH9A 1Q82C 1TF7A 1AGRA 2GEUA 4RD4A 4BEJA 4DV6L 3GQBA 1NN5A 4N1AA 2QF7A 3BH7A 2KBNA 2B63H 1B8AA 1PV4A 5FTNA 2CLSA 1GSIA 5DO9A 2ZTDA 1Q0UA 1N6PA 3RZOH 3MGCA 4HAXA 2VF7A 3IGFA 2IYSA 3W1GA 5AWFC 3EXAA 2E74C 1QVGA 1O87A 5SZIA 3EPLA 4CEIB 1TQDA 2YOGA 2VL6A 1T91A 5DGXA 5G41A 4AIIA 3OEEA 4LY6A 1ZD1A 1J2JA 1BS1A 3P4YA 1S4QA 3PIPA 4L5BA 2YKGA 2D0PA 4AIMA 3TRZA 2OCPA 2E75C 1UEIA 4F4IA 4UXIA 2HYDA 1CIPA 2FJUA 5M04A 1PH5A 3U3JA 2NVTH 2UUAL 2N78A 1EX6A 2JATA 1DARA 2AXNA 1I5FA 1KC8C 3I55A 3E9HA 1EGAA 4RFSB 5IYDH 3QQ5A 4A6XA 2VP9A 1RKBA 2ATVA 4B48A 4HIKA 4DLUA 4TT3A 1YEZA 4E5UA 2V8OA 2GCNA 3ZD6A 1WOCA 1HURA 2BBWA 5IYDG 2OG2A 4LSGA 4P72A 2OM2A 1ZNYA 2WKPA 1GNQA 2B8GA 1K83H 1QHSA 2FSHA 4EAQA 3QE0A 4YXWD 3A8TA 3TQYA 5C0XG 5EXTA 1P72A 3CWQA 2XNDA 3GLHE 4DDWA 2RHSB 1BDOA 1TWFH 5LDDC 1E3MA 3ZYCA 1JI0A 3NC0C 2FEMA 2J1LA 2Z83A 3QUSA 3CCEA 1BYUA 1E1RA 1OF1A 3OEHD 4JI2Q 5B2ZA 3R7WA 1W4RA 1XFAA 4JVMA 2JA5G 3B6YA 4H9GA 4LI0A 3V4FA 4UNSA 1CLUA 4JT2A 3W6PA 4KMUC 4QY7A 4R4CA 3KKMA 4OBEA 3R9XA 1ZKOA 4Z1MD 3HJNA 2OV2A 1CKEA 4A1FA 4KBGA 4HJ5A 1KI6B 1Q1ZA 4TTQA 3W6OA 1NMZA 1NVVQ 4B3FX 2V7QD 2Q3HA 2IF0A 2JJ2D 1LNZA 1S9HA 3LLUA 2UKDA 4MGZR 2BVNA 1KY3A 1Q7YC 5IP7G 3HU1A 2UXBQ 1XZPA 4A3LG 3LAWA 4AYTA 5BR8Q 3GTJH 4RG1A 3QXHA 4P4UA 1U9IA 3IEVA 3IDQA 3K7UC 5AJVB 1NY6A 1DCZA 1V1QA 1COWA 1IM2A 3C14C 5C44G 4Q1EA 4A0RA 4I1VA 4NYJQ 1E2EA 3W3AA 2L15A 4P71A 2ZETA 2R7FA 4HB4A 2F1MA 4Q7KA 5FUVA 1ESNA 4DV0L 4NBSA 4NYIR 1G3QA 2RHQB 4DNIA 1QHGA 1U5KA 3EZ7A 1GHJA 2KENA 3NBYC 1VQ4A 3KXLA 2Y0SG 3L7ZC 1O3YA 2R6FA 3TS2A 3IQWA 4LZZA 2A68C 3RVBA 4M4SA 5KTYA 1W3SA 4PPNA 5BYJA 1ZD8A 3AKYA 1Z07A 1I94Q 4XVQA 3ULLA 3KQUA 3M3YH 5IHPA 3QBVA 4A92A 3T1QA 2WJGA 1TQ2A 2A9KA 1K6MA 3J81i 4RSGA 3EIQA 5FTKA 2OCEA 3I5XA 2AMCB 1JQLB 3BU2A 3CRMA 5J4KA 1IXRC 1RIPA 1XF9A 4NP6A 1Z0JA 1CTMA 1BYIA 1G3IA 4TLBA 2P6UA 1XEXB 1EG7A 4LUZA 1AS2A 3L2OB 3L0IB 4X65L 2ZJBA 3AF1A 3GFTA 1FNNA 3THYB 1UE7A 4WBSA 3ZVMA 1N9WA 1B70B 5C4JH 2UU9Q 1CULC 3PUZA 2FN4A 2GRJA 2N46A 1FP6A 3RWOA 4R1JA 3I56A 1DELA 2WAYA 1T5LA 3VR1A 3SQXA 4KN4C 1RFLA 2CWAA 1KO1A 1PLKA 2JASA 5F3WB 1HEIA 1LB1B 3KTAB 1IONA 3K53A 1V8QA 4MRVA 3UIEA 4BEBA 2BDTA 1IBMQ 1YRBA 1L1OA 1NJGA 1TQ4A 4FIDA 1SXJB 4KFRA 3I73A 3BB1A 4N3NA 4LHVA 721PA 4L8JA 1GRQA 2WWIA 4A3EH 1WCMH 3GFOA 4LX0A 4HJ8A 4TQ9A 2FMXA 1E2GA 3CC2A 1RIFA 2JJ8A 3E0EA 1E2KA 4AYWA 1FUKA 3CO5A 3KL4A 4HYYA 2AKYA 3TSOA 4K46A 1CJVC 3DL0A 3ZIAA 2WSSD 4JBXA 4JBWA 3LD9A 1Q46A 1GJXA 3KF6A 4MNOA 521PA 3NTUA 2C98A 4X66Q 4YY3Q 1EYGA 3HOXH 1GDDA 1HT2E 1Z0IA 4B6EA 3ZQ6A 1NG1A 3LWNA 3RDPA 2VHCA 2BA1A 2OCAA 3DKVA 1GTVA 2Q2TA 1R8QA 3DOEA 2LMCB 1ZIPA 4NPSA 4KHZA 4DUYL 5IP7H 3CCQA 2IXGA 1BOFA 3BB3A 4JL6A 3CNNA 3A6PC 2GK7A 5TVKA 4AKIA 2CCKA 4IRUB 2A5GA 4FCTA 4MYHA 5DSZA 5CB8A 4KHPQ 2EVBA 1IXRA 4X62L 4US1R 3CB4A 5D3QA 1UBFA 3ADKA 2BMEA 1NLZA 3I4NG 3A58B 3L8ZA 2PX3A 4G0NA 5C0XI 1G3MA 5KUTA 4DV1L 1M8PA 1R5NA 2W58A 4OK5A 1P2SA 2ZYTX 4QM7A 3MLEA 3ONWA 2GILA 3CF2A 1U8AA 1UJ2A 1E9FA 4X64L 1S1MA 4DLSA 1RRPA 2IHYA 3B9QA 1E2VA 2Y0SE 1FZQA 1TX4B 3PGZA 1M6NA 2FWRA 2IUSA 1FQJA 4POGA 1J6QA 1OXXK 4LUVA 3U4VA 4L4UA 3SBEA 1KK2A 4DUGD 4EUNA 5TARA 3PUYA 1KDTA 2ZR0A 4A2WA 2JXMB 3UE0A 1ZUNB 1E4YA 4PAQA 2C5LA 3PR1A 1FQKA 4C3IH 2ODEA 3W8NA 3B1WA 1TTTA 4UJ5A 2ZYUX 4DLWA 4NTZA 1N2CE 3THWB 5IYCH 1QHXA 1YR9A 4QBIA 1X6VA 1N33L 3KLRA 3BRWD 1VQDA 3K9HA 2R62A 2J41A 5JS7A 2WJIA 1II8B 1Z22A 2RGEA 2QPTA 2YHSA 1XCPA 5M3FG 4X65Q 2GETA 1JNYA 4URXR 1BMFD 3BDOA 1D2NA 4IVQA 1H8EA 5H68A 4DR4L 3FKSD 3X1XA 4CZ2A 1C9KA 2Q9AA 1VQ5A 2QGZA 2VNUD 2HXSA 4D0LB 3ICEA 2J46A 2QRZA 1F2TA 1D8LA 2GKSA 1IAQA 1F2TB 2CCGA 4DK0A 1EXMA 4ZCMA 3FWYA 2WWFA 5JI3E 4TYQA 1N36L 3AVXA 2JJ2A 1PH8A 4JI0L 2A69C 4DV5Q 2ZRGA 3LXRA 4KBFA 4KO8A 4NKRA 1J8YF 1P75A 3U2QA 4TT3D 3EWAA 4CF7A 1N0VC 5EP4A 1EOVA 4DV2L 4JLMA 2F43B 1G7TA 3QXXA 1HNXL 3LX5A 3WP0A 2WAQG 1LS1A 2D7CA 3A1WA 4G01B 2PI2A 1KGDA 3QPUA 2JA8G 1KI6A 3BFKA 1G19A 4HLCA 4ASUA 1G1MA 3GLFE 3HR7A 5KNDA 2CL6X 5CK5A 3RANA 3TW4A 3AUYA 2AD1A 4ARZB 2JEAI 2JQOA 3CD6A 4JYAL 2HJVA 3I8SA 4LYJA 4B34A 3T35A 4XIGS 1ZYRC 3SDZA 3NVAA 4D81A 1JB7A 3BORA 2RMKA 3K0CC 1Q22A 5AJ3Q 1CXZA 4TMWA 3I62A 2CDNA 1XNRL 1OHHA 1BBUA 1E2FA 2FFQA 2GVAA 2ZI6A 4D2IA 4MDFA 1ZU5A 2R92G 1ZUIA 5FTJA 4B73A 5J3BA 5TB5A 4ILEA 2C95A 4IOLA 3GTGH 3VR3A 3IBYA 3CZPA 2YNMA 3G0HA 3OHMA 3MG9A 1E99A 4LFCQ 3EPKA 2NPIA 4O0AA 2FFHA 4DBLC 3U7GA 3EC1A 4AH6A 5FOWA 5LB2A 4TMVA 3X1YA 4UXHA 4DEYA 2UUBL 2K5NA 2VQFL 3SHWA 4HDOB 1P8LA 3H94A 3KJOA 1II0A 5B57C 4HJ7A 1IW7C 2BM1A 2I3BA 2KBFA 1VMAA 2BDOA 2XNSA 2PNRC 2VP6A 2Q2UA 4MKHA 2ZU0C 1HCZA 4MKGA 3H0GG 5JEAJ 2VUMG 3GEEA 4OYHA 2OFWA 3AUXA 2GXUA 4UQOA 5IK2A 5DH9A 4A8JB 2ZRFA 1AKEA 1W0KD 2OBNA 2Q9CA 1SMYC 2J0VA 1X54A 3A5ZB 1E94E 3QEJA 1HQMC 3HWSA 2JLSA 1RYFA 1E22A 4GKJL 1IN7A 4OI4A 2EW1A 2J59A 3ZDQA 1ZM7A 1KDPA 3IIKA 4GP6A 4A2QA 1QHNA 4JI5L 2FPLA 4PX9A 1CKMA 2YU9H 3VKGA 2GCOB 1G64A 1N8RC 3CCJA 4AC9A 1A7JA 3QOFA 4Z54A 4G3XA 2VQEQ 5CJ2A 1Q20A 4BY7G 1KKMA 2PQAA 5AJ3L 4DR6Q 1ZP6A 2CEAA 3KB1A 5EQTA 3SYKA 3A1SA 1LACA 4KSBA 2QT0A 1WF3A 4H0LC 2CVFA 1VECA 3ULJA 2FOLA 2Z4RA 4A4DA 4UNRA 5JLJA 4UP9A 2YTXA 1GVNB 4Q02A 4DAYB 2W00A 4IOAA 1UKVY 3LQQA 3DEFA 1UDXA 1WBBA 1IJEA 1US8A 2GEDA 3BBPA 5JEEA 4PZ8A 4EIWA 2FF7A 2V9PA 1F2UB 3T5DA 3BOSA 1HY3A 2VP5A 3AB9A 1PJRA 5LMUL 3I7FA 1TWHH 4Y7NH 1FYCA 1ZCBA 1R5OA 2JIZD 2EWWA 3E1SA 4IXMA 2OCBA 5ANRB 5E3HA 1PH3A 3QF4A 3DXJC 3BJIC 2DWOA 3MXUA 1MR3F 4URZR 5E7NA 3K8AA 2D2CC 4NDZA 4PSKA 4PQYA 1MO3A 4LJ6A 1CKNA 4IOJA 2XTMA 5IDVA 4A3BH 1NN1A 4BBRH 2C77A 2EFCB 4JI6L 2F4VL 1JALA 4Q1DA 5FFMA 5BXQC 2E87A 2GVDC 1GILA 2EFGA 3BG3A 2XX3A 3CCUA 3HOZH 4HSEA 4PC2A 3NWJA 1W2HA 4B2PA 4C0QC 4Q9JA 5EP1A 1VQMA 1HNZL 2N1BA 2Z0MA 2ZM6Q 1S0UA 1SFOH 2E1RA 4PC1A 4D0NA 5A0FA 3DM5A 1XNRQ 4X66L 2VRWA 3AVQA 1A2BA 2MSEB 1W5TA 2H92A 3TSZA 3TSWA 2D2EA 4DUZQ 1ZU4A 2IF2A 4W5WA 4DSNA 1IBKL 2BWJA 2ZRMA 4GMDA 4IFDH 2HXYA 1OH5A 1AJEA 1E9CA 5AR1A 4DV3L 2B63G 2GZDA 3AF2A 4B43A 4D80A 4PFSA 4R4IA 3DKPA 5GAGC 3CPHA 1L7VC 2AD5A 4E03A 5GAEC 3K0AB 4D4LA 4PZLA 1XJVA 5FPKA 1IN5A 2YINC 3MWYW 3PFIA 4V02A 2OCYC 1I4DD 3LDAA 4GN5A 3B6EA 3GLHA 3IBGA 4U00A 4B47A 4WXPA 4DLTA 5KSOA 3U44B 3B60A 3PXGA 2WFWA 2V4ZA 2J3EA 4DV1Q 3BZCA 1S40A 2WWHA 3OW2A 2MFIA 1YITA 1Z7TA 3Q85A 5LMUQ 4QBFA 4QL5A 1G7SA 4TLCA 2JA9A 4YQFA 1EFCA 2R93G 1EWRA 4RD2A 5J4VA 2NN6H 3K0XA 1N5LA 4X8MA 4HAUA 4ZKDA 5HPYB 4A3KH 4GNXA 1XMOL 3LBNA 3AVOA 2OESA 1JQJC 2BJVA 3PG5A 3AGQA 4I81A 1K73C 1WE2A 5FUYA 4MA4A 1XPOA 2QBYA 4GOJA 3RABA 2QAGC 5LMNW 2CHQA 5FBVB 1Q1BA 2V4DA 2Q8IB 2JGNA 5KPDA 1XTSA 1PYSB 1L4UA 4YMTA 4CEHB 3Q7PA 2O5JC 4DR3L 1DTSA 3IHLA 4BY1G 5EE3A 3GLFA 3B78A 1GVPA 2EVWX 1R6BX 2Z6KC 5FOTA 4H13C 1E2QA 4HIDA 2ZTEA 4G5RA 2WJHA 1SZPA 3AVYA 1KSGA 1WXQA 4DLXA 3FFAA 2IHFA 1N6KA 2ZI5A 1A62A 2VHUA 2ALYB 1LF5A 3WY9A 1R0WA 4Q18A 2C9OA 2GDJA 3PO3G
chains in the Genus database with same CATH superfamily
1Z8FA 3KJFA 1H9MA 1BIFA 1M1XB 3EC2A 1WULS 3O31A 2FPIA 5C53B 1K88A 1N9ZA 2B2NA 3G2MA 4HDKB 5DLPA 4DLRA 4M87A 1XCGB 3HB1A 3OAAD 1YC5A 1I80A 5DASA 5BT9A 2IH2A 1GKKA 1I1QB 2PKQO 1F8FA 2B0JA 1EDOA 2Q7OE 3LK6A 1E1RD 3OEHA 3GIWA 5CFNA 3GHHA 5HQ3B 5ENVA 3HJTA 1KYQA 3D6HA 4ZCLA 3LK7A 1USWA 4TWZA 2ZB7A 4F6RA 3DYIA 4BMOB 1CFJA 3M6IA 1D4OA 3PUJA 5CV5A 1OLSA 4DV4L 3JD3A 3HE3A 3B6IA 4PHFA 5F9FA 1DE0A 1JE1A 1NHGA 1YONA 2WHEA 4NFHA 2BEKA 1JZQA 4D3XA 2R5FA 3MC1A 4MR9B 4OO1G 2E4AA 1WXIA 1HTLD 1L1OB 3I72A 3FLEA 1BNZA 3A2MA 4MRSA 3LC1O 3LNCA 3DEJA 4GXRA 1CY8A 3WGOA 1TK3A 1YL7A 3AF3A 3CKIB 4WJWA 3O38A 3OT1B 3PD7A 4FGSA 3UHPA 1H94A 2V7UA 4OGGA 5TVGA 5BW5A 3GLIA 2O5IC 1XC7A 3DKIA 1QHYA 1ZGGA 4Q12A 5IMBA 5IX8A 1M6VB 2GPAA 1JR2A 5MGBA 2OZLA 5BSVA 2IL1A 4IJUA 4TL6A 3RUDA 1GUGA 3LQ1A 3NYQA 1NVVR 4RWEA 5K4GA 1C7EA 1IWOA 3G2KA 1TWAB 3M3YB 3KKEA 1JBEA 3K4HA 4FNMA 4WOJA 4A76A 5EZ5A 5GMOA 3RIHA 3WGNA 3DZDA 5JNSA 1S2GA 2P5SA 3KAQA 4K8RB 1B0UA 1P4SA 3JQQA 3VI3B 3J7AV 1H1TA 1WTVA 3CNOA 2IHBA 2XB6A 5T3UA 3RJTA 1Z5UA 4DIKA 4V3BA 2W2LD 4JJ7A 2NUBA 5CJPA 1EY7A 3R5JA 2D2XA 4ZXPA 3M2PA 4M8SA 3FHCB 4DUPA 4YJFB 3FUUA 3CE6A 3CVYA 3WJ1A 5KYUB 1BCPD 3WSTA 4CKBB 5EIXA 3ADPA 3FIUA 2P8JA 1SOMA 2EJTA 4FR5A 1QNLA 3CQ9A 5AOVA 5IC5A 3VR1A 5CV8A 3GPCA 4JLBA 1ECLA 3COZA 4UY8C 1NI5A 1L1QA 2HPZA 3Q7SA 1U7PA 2BKUA 4XGRA 3RE1A 2RKOA 1DBRA 2O2DA 3R9WA 1CK1A 1SK9A 3ONAB 2WUVA 5C8YA 5EXSA 1Z47A 5JVDF 5UKDA 2FZEA 4G5GA 4IOKA 4WZAA 1ZL2A 1Y1PA 3OU6A 2WVGA 1RCFA 4G0YA 4HADA 3MRSA 5TMDA 4R2IA 2C4TA 4GMKA 4C7BA 5U9CA 4E2XA 2X5JO 4W9MC 4S0ZA 1ORHA 5IBRA 3N2NA 3QA3E 3B1FA 4Z8XA 1LC0A 5FOSA 1AQJA 1I8TA 4MUJA 2IFTA 3JV7A 3OJWA 4Q5IA 4RZIA 1EY6A 1QB8A 1CNMA 2D1RA 2FQXA 2WK1A 3IP5A 3WZ2A 1RMTA 1EVZA 2P5YA 4CM8B 5CDTA 2DNEA 5JYEA 1ZWLA 2J30A 1E2JA 1UFRA 4QUGA 4AFNA 4YONB 1MZVA 4BUJA 5IASA 2RH5A 4PZEA 4B3IA 3WAJA 3GTQB 1WB6A 1IN8A 2JW5A 2XPCA 2DP4E 1G20B 4FZ5A 1DBPA 4CDFC 1HYEA 3AZPA 3K80C 4TVAB 1Y1SA 3LO5A 3QU9A 2G1JA 4KUGA 3OZFA 4PSDA 2W70A 2VKTA 3FSEA 3KJGA 5E6UA 1KHIA 4RXTA 3R7BA 1OCEA 2PMWB 3KFXA 4IRMA 4N6GA 4OL0A 4UD2A 5FBWB 4EFLA 4NW2A 1W85B 3OCYA 2QY9A 4G8DA 4QBGB 4PLPA 1AURA 4J0GA 4PXSA 3NOQA 4HAOA 1MOZA 1G8FA 2MIIA 3H6GA 3STTA 1XWEA 2J31A 5BUQA 1YAJA 1QO9A 3VV2A 2PGOA 4DSTA 1EESA 5DHTA 1EPUA 1FGBD 3MA0A 3KE9A 1M1YE 2HO4A 3DMFA 3I1YA 4IYRA 4AK9A 1TQ6A 2BFWA 3MCZA 5KYUA 2C2YA 5TGDA 5JZOA 2PZTA 4E7OA 2O9JA 4GGPA 3WIUA 2NACA 2OK8A 3VHXB 2ERXA 2CLOB 2G06A 2XUJA 1RLUA 1N2CB 1QO7A 2ZCUA 2I22A 2PZFA 4KQJA 3RMHA 3KDAA 2CMDA 3TLGB 3P0JA 5H9WA 1QYWA 1W88B 1T2EA 2PNHA 3DF9A 3JZDA 2RHRA 2AFHB 3L84A 3N2GA 1T9KA 1W76A 1LA2A 5BQ3A 5FA5A 1N4AA 1M1YB 1Q0TA 2Z1MA 1U7HA 2VEDA 3LT1A 3G6EA 1JHVA 2WU3A 4M46A 5BSFA 5KYNA 1RJWA 1UH5A 3PF5A 4AJ1A 1Z0FA 2R7ZB 3WKDA 4BNKA 1PT5A 3L0YA 3K5MA 4OHXA 1QE0A 3C6ZA 1IJFA 2IX1A 1FUYB 1ICWA 3S4YA 4JJ8A 4JI6B 3E48A 2E21A 2Z4SA 3GZTB 4RACA 4YGYA 1E5XA 2W8BB 2EJFC 3SS8A 3C85A 1YOBA 2YXBA 3WMWA 3GBSA 5F64A 2BM0A 5HJ2A 1SXPA 4IZ8A 1C1XA 3TZEA 1N5DA 4XQGA 3S1AA 1N1DA 4ZJUA 2YWXA 3HJFA 3BL6A 4EHDA 4K0KL 4DV3Q 3JQAD 1E58A 1RXIA 1SPXA 1UBOS 3B85A 1ZXBA 1XHLA 4JQZA 3RF6A 4DWWA 4NFSA 4P7JA 3T1OA 1NTGA 3F0TA 4GL4A 4UTZA 4YAIA 2BGGA 4BGEA 1S5FD 2QE7A 3D1JA 1G91A 1KYTA 1VPEA 3EEFA 5KVSA 4C7OB 1W85A 3TTSA 1F2UA 3AZQA 4CDGA 4DDHA 3RT7A 1KI1A 2CBGA 2AI1A 4OQNA 2D1QA 4TTTS 4Z49A 3D3EA 2A3NA 4U7PB 3LPNA 3ZE2B 2E5LQ 5H82A 4ODGA 4CEJA 1WD1A 1VSUA 3BIOA 1ZRNA 3U7RA 3NIDB 5IT4A 2HV8A 3NDBB 3L6OO 4KIFA 3WB2A 2F1KA 3LXMA 4CLRB 4PC7A 4YUZA 4C3HB 1WQ4A 1AO0A 2H4ZA 2R00C 2A3RA 4U7FA 4H7EA 4C6TA 1CR2A 1F0NA 2O7VA 3D4RA 2ZRHA 3NGMA 3TQQA 1N2CA 4RVHA 3V1TC 5FDFA 4CTOA 3M5DA 1ZVJA 5EKUA 1PRTF 1VF5C 4JUFA 4HQ0A 1RXYA 1Z4LA 3KUKA 4FD3A 4W5JA 1JEJA 1XLUA 2JI7A 2QG6A 5IDQA 2G77B 3WRVA 3F49S 4EO9A 1IOVA 2CNLA 3DTVA 1RXVA 3BBLA 5K3OA 1QQBA 1Z7WA 2AC2A 2BN4A 1A15A 3IV9A 4YCMA 2H5LA 4OYRA 2UZ4A 1Y9EA 1D9XA 2JI6A 3LVRE 1S1CA 2JHPA 3A7DA 3EA0A 2ZAOA 1GKHA 3LO8A 3SXUA 5L8VA 4EG4A 3SHVA 2C8JA 3ZY6A 2PLRA 4ZCQA 5I3CA 3LX8A 2AEJA 3SN6A 4A2CA 1U28C 4TTRA 2MNAA 1ORDA 4IQZA 5I7RA 2JA5B 1VCIA 1E7MA 1E6CA 1T43A 4YJ3A 3ZUPA 3IQFA 2HA5A 1VL0A 2GYVA 4C3OB 4DLXA 2WSMA 3OUZA 1DXHA 4M1ZA 2I87A 4OPMA 4BVBA 3M5CA 4YWJA 3RSQA 5LP1A 5F76A 4HMJA 1RHUA 3A8IE 1C81A 1XVTA 3QUAA 3U0BA 4J75A 4D82A 2Q41A 3WLKX 4QKQA 3D1LA 1SNCA 5HIKA 2G1AA 4JBHA 3DV2A 4MYUA 3T3OA 1XEAA 3ZKAA 4FDAA 1YE8A 3BXZA 1PTKA 1F6BA 4YP9A 2OK7A 2GR9A 1XZKA 3VAZA 3VTAA 1CC1S 3Q2IA 2F0TA 4HMQA 1EVQA 1VGVA 1T0BA 2DT5A 3CMEA 1ZH6A 1POXA 2OORC 4RFVA 4Q21A 5EZYA 3Q23A 3SR4A 4E3ZA 1HDCA 2AWOA 1BWQA 1JBQA 3M6AA 4ZWNA 4DNQA 4K28A 3VYSB 1PDVA 3UDFA 2P9ZA 4MPRA 4EHFA 1UKEA 5D2CA 4J76A 4ZAVA 1HR0L 1C7ZA 1VOTA 4CMEC 4GUAA 4C3IB 2OXCA 3NWTA 4AYBB 2YVAA 3L46A 3U49A 4C08A 5JTUA 3TQTA 2W4MA 1G17A 1F38A 1P7CA 3T94A 4UU7A 5JSKA 4C2AA 1IZ7A 4GF5A 4D98A 4F3CA 2G9HD 2HCTA 2Y6VA 5FTMA 3X1JA 3FOZA 2RGBA 3LQ4A 4LYEA 4BZPA 1Q74A 3UN1A 5HOQA 5IU6A 1W7AA 3TDNA 1FL9A 3FOAA 1J8DA 1OAOA 2ES4A 3O74A 4GEKA 2GA9A 4X44A 3RV3A 5B58C 3CCFA 2PKXA 4XM0A 1I5RA 2AOUA 5GONB 2HY7A 2AYZA 1TCUA 5INTA 1WAMA 3OKFA 3BXXA 1BHJA 1HRKA 4D46A 1YZHA 2H3HA 3FM9A 3CW8X 1F48A 4R7GA 2OWOA 4GKKQ 3QWBA 2GEKA 1XKXA 2NPOA 4L3WA 4RENA 1USUA 2WB1B 2VWGA 1A9XA 3SR0A 3V2HA 3TDMA 3CCSA 3JATA 4GLAC 5HTOA 1YUMA 1V7QA 1HDZA 3AOGA 1VZ2A 1RWQA 2UZ1A 3IEPA 4JD5A 3CBQA 3RSOA 3WHKA 2GAJA 2VK4A 5HZGA 4O3MA 2EY5A 1DRJA 1SAYA 3QKWA 2QRUA 3AVUA 1L5VA 3C5HA 4P0QB 2BEUA 1K75A 2ZYWX 3FHTA 2BP7B 4G5YA 4GZ5A 3E03A 3GTMH 2FPUA 3BVPA 2J9XB 2OO5A 1GUAA 2M98A 3OWXA 3G6KA 4GPEA 5ENDA 5FBLB 3QKSA 4DLNA 1JSZA 4EPRA 3ZNQA 4CM9D 4Q9AA 4X6XA 2EZUA 1UJBA 1FMFA 5BR8B 4NU6A 5LA6F 4NMZA 2A5YB 4KDRA 3RRXA 4C4SA 2BTQA 4D96A 4DIDA 3Q0EA 1FB5A 1VYVA 3QOYA 4K9DA 5ALPA 4JC5A 2QUJA 3RUIA 3OIFA 1P2VA 2GVZC 4RKQA 1WBJB 4LN1A 1P2GA 5CD1A 5E4YA 4LE2A 3OZWA 4YV7A 5IGDA 2FUNB 4RA9A 1XG5A 4EA8A 1UBCA 4U4AA 1F77A 1XQ9A 1JIKA 3RSSA 4NVRA 4ZYVA 3O7MA 4MHEA 2Y92A 1UANA 2K04A 1Q2UA 3C7TA 1JSLA 4K88A 1H6CA 3ODGA 5EPJA 1JMVA 4NH0A 1W36B 1X3QA 2QKIC 1ENYA 3I76A 4H0NA 1RKXA 4PV7A 4D1YA 3BWVA 1C7IA 5EHXA 3OC6A 2AS0A 2GUGA 1IBKQ 3GRCA 6ABPA 1ANKA 1ISMA 1O7IA 1NRWA 2YN4A 2FCAA 5IM4A 1B15A 3MHTA 3MC0B 2QLTA 1PH9A 1UAYA 1KORA 4GSLA 4R6XA 3PQDA 2IWHA 5LP6C 1GRRA 2X4IA 1QDUA 5KQSA 1XKQA 5BR8L 1UXIA 2ZROA 5EJ7A 3HVRA 4BV9A 1G5QA 2MINB 1G16A 3AM4A 1K0SA 1PJQA 4MW6A 1QFSA 4R8NA 1MNAA 5IT9c 1QNUA 1X9IA 3KAJA 3HA3A 1GUTA 4FCVA 2FK7A 4HFJA 4UP7A 2WKDA 1TU4A 1U3FA 2G71A 1B8UA 3A14A 4Q7JB 4CW7A 2AZXA 3CX4A 3RUFA 5AVTA 2J5BA 4GLJA 4GXQA 2VKQA 3DDWA 1Q1EA 5HR5A 3ILHA 1QIMA 2CUNA 4WKPA 5A9TA 3HSSA 2J67A 4ALNA 4URWR 1LDYA 2I62A 4P5PA 2W6QA 1CZWA 2WIKA 3FJ1A 1HYQA 3DDOA 2XKAA 2WIDA 4LBYA 4HQ6A 5LBTA 4D4IA 4Q1VA 1FJGB 1HM5A 3CPWA 3PKJA 4RK4A 1Z33A 1YR6A 4K8IA 1TA9A 1ELOA 3BCUA 3IAS1 2KYRA 3ML1A 3OM9A 3GD7A 1D5MC 3QVVA 2N88A 2JKVA 1B2RA 2ASEA 5A35A 5DIZA 5LUBA 3RLNA 2F3UA 3QPCA 1X15A 3T9FA 1JDTA 4IKEA 4IILA 4ZO4A 4L3VA 4G6ZA 3AEZA 3EODA 1AA9A 1YB6A 4B9EA 2J09A 4KODA 4IEFB 5FPKA 2V1XA 3PRJA 4A5OA 4RXUA 3L92A 4G86A 4CF4A 1VQKA 4A3GH 3OE1A 2QTFA 4LGMA 1WTPA 3S1MB 4E11A 1NW6A 4H6PA 2HSDA 3PWSA 1ZLYA 5ELBA 1JOOA 3E7PA 2ORYA 1GIAA 4KB5A 4UHEA 4UBOA 4B3SB 4MWZA 1BF4A 2FMCA 2OTCA 3F8SA 3KSZO 4YECA 4IXTA 4RZ2A 4UM9B 1L7NA 2FRDA 3H0GH 1PVDA 4LSZA 4YMSA 1FFDA 3IFSA 3K70B 2WIJA 3LV8A 5TPZA 1IWBB 4MICA 1NURA 3R3WA 4N0EA 2O5CA 1H4QA 1J9EA 4ID3A 4GP7A 3RI3A 3ZWNA 4P86A 5DEHA 1WG8A 4QJ5A 5K0EA 2GFQA 1KZ1A 3FMGA 5M3FB 4H7KA 3PJDA 2BRUA 1U8ZA 1SVWA 4BMXA 1CZHA 1Y82A 2CB9A 3DGEC 3VR2A 2HLDD 2LDBA 4NU0A 3LF2A 5K7SA 3FYDA 1YZNA 3K70C 1LI4A 3E82A 4DXAA 5KBYA 3I39X 4LK3A 4TKVB 4QLBA 1Q6ZA 5DHAA 5ELNA 3O9ZA 4J2OA 2GXAA 5HK9A 1YZLA 3O3OB 5FBQB 1N2OA 4Q9LA 1V5GA 2IU6A 2YXNA 3PFNA 5C7LO 2X5NA 2PBZA 1M9NA 3HCWA 1UEXC 5SY9A 4PVCA 2HPVA 3VOTA 3OU7A 1F2LA 3C7CB 1VKNA 1PJSA 1MRNA 4QXOA 2B3GA 4KQEA 4L08A 2WJAA 1GTZA 1N6LA 3I9V1 4P7BA 4DR6L 4FFVA 4R0VA 5CBAE 1IBLL 4OIKA 1E20A 2MSCB 2I8LA 3C4JA 3O4HA 4HHEA 4CQMD 4RY9A 4RK0A 1C3OB 4XQQA 1WWKA 2WNIA 4ZPJA 4IEEA 1F2DA 1ZCAA 2EYFA 1IEQA 3H13A 5DM73 2CLEB 3W4JA 1GTSA 1NDQA 3PT5A 4LWOA 4US2R 3F90A 1JB1A 2OFOA 4US0R 4H0CA 2H2FA 5AKGA 2AYYA 1EWHA 1PYWD 1F8GA 3UENA 4HSPA 4C9BA 1LQTA 1ORIA 1IRXA 3A7EA 1QK3A 4OLAA 4V0NA 5AVSA 1S2IA 2HYIC 5C3UA 2CXOA 2F9FA 4TX1A 5AJWA 3E9YA 4CQMA 3QU4A 2BUBA 5E95A 2H1RA 1M5TA 2XTNA 3EIXA 1L1RA 4ENRA 3DLHA 2I33A 4G25A 1NFRA 3NHRA 4CQMB 4NHEA 4CTNA 1NJ5A 4XWAA 3K0YA 3ZGZA 4I5EA 4U7JA 2XWJB 3VNUA 4O08A 3EGXA 4XRGA 1JS1X 4G8BA 1LBTA 3WHIA 3WWCA 5J2UF 3RVKA 3URKA 3QVOA 1V1PA 4Y2PA 1P8JA 5CA0F 3PYXA 5IJ0A 1RCVD 5C0XH 1Z6QA 3K9NA 4LQDA 4ME5A 1HT1E 3UICA 3KZMA 4YX9A 3WWVA 4L9RA 4ZHQB 3U4QA 1J25A 1BFDA 1ISGA 1HT3A 5EAYA 2PJUA 4Q4HA 221PA 3LW7A 4WL0A 1IN4A 1Y1VG 1UZNA 4ZV4A 3D8BA 3P9KA 2GDZA 2WHXA 2XA9A 1M0TA 1FDWA 2PPLA 5ALVA 2CHUA 2F7SA 1U0TA 2B0CA 3QELB 1BWRA 3MAQA 1HJPA 2JFYA 2YY5A 4BMSA 3TGWA 5KVCA 4P0TA 3KKLA 4UTXA 1TUEA 1V8FA 3Q7RA 4EJ0A 1OXSC 4B9WA 1KJ9A 1NSFA 1K1EA 4Q0FA 1A2TA 4F88A 2H85A 2P62A 3GUCA 3OZGA 1NT4A 2PL3A 3L7CA 4R8SA 4DQUA 2HLNA 3P9ZA 3PNKA 4KFCA 2YU9B 3G5LA 1BVSA 3LQKA 3L7MA 2DTEA 3QM1A 4CNBA 1I3CA 1PFSA 2H57A 2AJLI 4OJQA 4RK5A 3NXWA 1HLGA 2PGDA 5H80A 2ONZA 5HDQA 2Z9DA 4XQJA 4RMIA 4MVXA 4RGQA 5K0TA 2IYPA 1RZVA 3ORQA 1VS0A 1O97D 3UB4A 2LGJA 2GWHA 3KWJA 2YZGA 3MWKA 4QQ8A 4H7FA 1DBIA 5AHOA 1NUPA 2OV3A 3RNLA 2Q49A 2PU7A 1LPAB 2I3ZA 5B5SA 3ZHRA 4E2ZA 1PK8A 2X7XA 1GCOA 4PC6A 3PV0A 4BDSA 2WAQB 3H0GB 3GDEA 1NUTA 1RHQA 4XEHA 2C4WA 2GK6A 1MC8A 2GTIA 2KWIA 2WW8A 3KQVA 5DX0A 4BMPB 1JR6A 4ZAYA 1YB5A 2XECA 2NNWB 3DR3A 4KJXA 5SYAA 2F67A 5LD2C 3SP1A 4Q3AA 3KQHA 4L9AA 2PUAA 2FSFA 4GXTA 4MYSA 4MWBA 7AT1A 4Q1BA 3R8CA 2IYEA 1QE6A 1JZTA 1UDWA 4TWBA 2B5OA 4Q9HA 4CKXA 4JI8L 4ESVA 4ARCA 1XDUA 2PXXA 1NOIA 3TNDA 2DEUA 1SYBA 2GZ1A 1YS2X 2AYXA 1ZIYA 1V45E 4KE6A 2QMZA 3O1LA 4Q48A 4QDZA 4RORA 4A16A 4D9MA 4YRNA 4NCJA 4ZEMA 2ODAA 4ZI3A 3BJMA 4Q4HB 2VF8A 4M1OA 1V5WA 3ZLBA 5JAHA 1I0IA 2DOKA 1N9KA 2VBGA 4OHCA 4R9UC 1AKMA 4CM4B 3ETLA 3O4JA 3P0IA 2PH7A 3DOJA 4E4RA 5KNDH 3PQ5A 3A6FA 1JPNA 2DNCA 4K9RA 4RTSA