1OXXK

Crystal structure of glcv, the abc-atpase of the glucose abc transporter from sulfolobus solfataricus
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
352
structure length
352
Chain Sequence
MVRIIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELYFDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEEVAKILDIHHVLNHFPRELSGAQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALVKEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGEINELEGKVTNEGVVIGSLRFPVSVSSDRAIIGIRPEDVKLSKDVIKDDSWILVGKGKVKVIGYQGGLFRITITPLDSEEEIFTYSDHPIHSGEEVLVYVRKDKIKVFEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ABC transporter, ATP binding protein
publication title Formation of the productive ATP-Mg2+-bound dimer of GlcV, an ABC-ATPase from Sulfolobus solfataricus
pubmed doi rcsb
source organism Sulfolobus solfataricus
molecule tags Transport protein
total genus 105
structure length 352
sequence length 352
ec nomenclature
pdb deposition date 2003-04-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF00005 ABC_tran ABC transporter
K PF17847 GlcV_C_terminal Glucose ABC transporter C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.50.100 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) OB fold (Dihydrolipoamide Acetyltransferase, E2P) 1oxxK03
2.40.50.140 Mainly Beta Beta Barrel OB fold (Dihydrolipoamide Acetyltransferase, E2P) Nucleic acid-binding proteins 1oxxK02
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 1oxxK01
4GP7A 1A6XA 1ASYA 1H9MA 4APVA 1O78A 4B3TQ 4JSTA 1T3LA 3ADCA 1SROA 1E2WA 2A5YB 1JJVA 2KWIA 1DAEA 4JI4Q 1OSNA 2C77A 2PZEA 3TLXA 4CGZA 2QROA 2ZJPA 4FMDB 4EPTA 3CRLC 4A0FA 2IXFA 4P4UA 4B3GA 3N6RA 1JR3A 3ETLA 1CULC 1KIMA 4OO1H 1UKEA 3ZQJA 5KNBA 5JEAG 2CW0C 2J0VA 4GNXA 1GUTA 1KMHA 4HZUA 3V4FA 3RC8A 2OCYC 4DRZA 3AEVA 4NXML 3PO2G 4IFDI 1AKEA 4B48A 5FUVA 1RYFA 4LF8Q 3E70C 5DI9A 1YJWA 1E9DA 4WZAE 4NCHA 2OBNA 1J8MF 1VQ7A 1G8PA 4TYQA 4RVCA 2P3SA 5IE8A 4D4JA 1G8FA 3EG5A 3U6BA 3I4LA 1VQ5A 1WE2A 3BB1A 1JXMA 3DOFA 4OQFA 5EUMA 3KQNA 1SVKA 2C96A 4ZDJA 2QORA 4TT3D 3E9IA 3RLNA 1P3JA 2GF0A 1E2VA 1M7BA 3O8DA 4UPAA 2OZEA 2XZLA 4LFBQ 1RPZA 1XPRA 3NG1A 3CCUA 2EIFA 1S40A 3U50C 3S15H 1ZUHA 3A8JE 3SS8A 4Q4HA 3RLOA 1M8PA 4BLTA 1ZD1A 2CK3A 2K5VA 3EIEA 3TMKA 2F3TA 3IQXA 1M1YE 3ASYA 4ACBA 4B33A 2F55A 4Z8XA 2NG1A 4DUZQ 1YZQA 2G3YA 2G77B 2WAYA 3FMIA 2RHSB 3K7UC 3PSIA 3JVVA 4JLJA 3N70A 1C0AA 3ZD7A 2D2EA 3A4NA 4FMDF 4NP6A 1NP6A 2YTYA 3F0TA 2PQAB 1LFDB 2VUMG 1EFTA 4L5BA 3TNFA 1XEWX 1E4YA 5C46F 4PG3A 1R5NA 4TN1A 4DUYL 4LJ9A 4YMUA 4CEJA 4DK0A 4JI0L 3E2IA 3HOUH 1VIYA 3Q9LA 4IVRA 3VKGA 4D25A 1HV8A 3G48A 1IYJB 3GTOH 4DV6Q 3QQ5A 4TLAA 1IYVA 1P73A 1Q46A 5C44G 1E2KA 3TAUA 4ESHA 4DJTA 2OXCA 3I8SA 1XTIA 2C99A 621PA 1Z63A 5DH9A 4LBZA 5L3SA 2IS1A 1BH2A 5JEAH 4KFTA 3IPYA 2J59A 1E9AA 1IJFA 1DO0A 2ONKA 4LJ5A 5BW8A 4PSVA 4BLRA 1H9KA 4KFRA 4A3CH 5B2ZA 3PVSA 2JJ2A 1C7YA 3TUJC 3J81k 1VQOA 4Q4AA 4LJAA 1SR3A 3T06B 3UE0A 3LW7A 5SZJA 1PMRA 2IA5A 4ZCMA 2WWGA 4Q4AB 4F92B 1SHKA 3QENA 3FOZA 5FUYA 4DSOA 4KVAA 2JA6G 2Q6TA 2FNAA 2WSSA 3VU9B 4HJ9A 4TQ9A 3PCRB 1WCMG 5KNDA 5A35A 1TF5A 2K7VA 2WP8J 2WJGA 2ZJBA 4A3JG 4MGIR 2KBFA 4US0R 5CDFE 2ZYVX 3SYLA 2WIAA 1VQHA 4OI1A 3EWAA 3TVTA 3NHAA 4AG5A 2ZTSA 4HYYA 2UXBQ 2V9PA 1DAIA 3BWDD 1E2GA 2AHOA 4GOPC 1EOVA 1PH1A 5IYDH 1TADA 3P26A 3T15A 4LF5Q 3TEHB 3TUIC 3K7AH 1NIJA 1RRGA 1T0JB 2EFCB 3CWZA 4Q03A 3IO5A 3HPRA 3CKLA 4NDZA 3K0FA 3KDSE 3I4MG 3MD0A 3B9PA 4EJSB 1KZGB 3S14H 3SQWA 4MNOA 2JLQA 4L4UA 5D3QA 4OQMA 2LMCB 1EESA 3FE2A 1WXQA 1SXJA 1QHIA 5C0XG 4NXNL 5DSZA 2FPMA 4A2QA 1SFOH 4M8NE 4F91B 3I56A 2A69C 1VQMA 2YWGA 1OFUX 2YHSA 3IIMA 4LC1A 4XWAA 3RS0A 3UMRA 4H44C 1GOTA 5HGQA 2BDTA 2J0UB 5LMNQ 2Z83A 3WP1B 1DCZA 2Z6VA 2JLZA 1WFQA 5FJ8H 2VW9A 2IC5A 3ZZ0A 3ZJYC 2IY5B 3OFND 4I1OA 1CU1A 1W47A 4P31A 1T8UA 3KLRA 1HY3A 1SXJD 1XNRQ 1SXJE 1PUIA 4DB4A 1EWQA 5E95A 3NBFA 2FF7A 5FPKA 4G7ZC 1KY2A 1E0AA 4XWKA 3J81j 1GNRA 2B29A 1DAGA 4NYJR 5IT5A 2ZM6L 2CJWA 4PO1A 2QRZA 4TL8A 521PA 4URVR 1JECA 4C2TA 4MKIA 5M04A 5GJWC 4YWLA 4W5HA 1VIAA 1K83H 1L7VC 3VR6A 2NVXH 3A7AB 1NVUQ 2XITA 4ON9A 1M34E 4JBMA 2IXGA 2QAJA 3FFAA 5BYJA 4R71A 3U44B 4QOSA 3SBEA 4PQRA 5AR1A 1L1OB 2I1VB 1GKIA 2J0UA 1KO1A 2ZE8A 3KQUA 3FKQA 2PEYA 2WSMA 4HATA 2V1CC 2W2VA 1CJKC 4BY1H 4RG1A 1KJZA 4DV6L 2X2EA 2GESA 3EA5A 5C18A 4TTQA 2CWPA 2QQEA 1DPFA 2ODNA 2KCMA 1W44A 2ERYA 4UP7A 2WKPA 3KUCA 1A0IA 1WBBA 4DKAC 1UDXA 2RGCA 2B8TA 1KGDA 4RFVA 5GAGC 3QKRB 1YEZA 4FWIB 2RHDA 3M4YA 5JMTA 3LV8A 3I4NG 3CX8A 3CPJB 5EXTA 3WYGA 4C0AC 1J6QA 1N25A 2ORVA 3CRRA 3RZOH 1GVNB 2HF8A 3QXXA 3W6PA 4A8JA 3ZLJA 2ZANA 4JI2L 3OEEA 4A3LH 5F98A 3I5YA 1OXTA 4IFBA 4TZ0A 3OIWA 3THWB 3IUYA 5JJIA 1XU4A 1NVVQ 3NIBA 3AKEA 4LYJA 1S3GA 1Q86C 2AKAB 3CIOA 3B1WA 2W0SA 3ONWA 1UE1A 3B7GA 4CW7A 3OE7D 2HXSA 1D8TA 3KF6B 3KFXA 4I99A 5GJCA 1KDRA 5IDVA 3C16C 5KPDA 4XD7D 4B2IA 1Q22A 4ZPXA 1Z6HA 5E7IA 3U5ZB 1Z0AA 5IK2A 5CK4A 3U7FB 1QG2A 2A5JA 4X8OA 2FSHA 4IQZA 4Q4LA 2UZ3A 3F1ZA 4A3FG 3CRVA 5FUXA 4JBXA 3AYHB 4WVFA 3V00A 3BFVA 3FWYA 4BPBA 2C8VA 1G17A 2DCUA 4N0DA 5K36G 4C0HA 1I50H 4Q21A 3RRZA 2PX3A 4GS3A 4KLKA 1CS4C 2IHYA 2P65A 4LBVA 2J7PA 5JS7A 1PH8A 1K8AC 4Q66C 1NBMD 5IF9A 1HNWQ 4JG2A 1TEVA 2QG6A 1Z6YA 3PUXA 1AE3A 2QP4A 3GFPA 1JJCB 5FL7A 4C9BA 2WIBA 2FPKA 3D7MA 4GSYA 3GO5A 5EAYA 1CR1A 1MO3A 3UMSA 1ZNZA 3L0IB 2ZS8A 4B44A 1NLYA 1X86B 2WPDD 4B3DA 5FOUA 3H3VI 3U9SA 4URYR 4B73A 1QUQA 1N6LA 1VPLA 2OUKA 2CVFA 1XB2A 4NKRA 1G7CA 1H65A 1G5TA 2F9LA 2ZRAA 1XXHB 3K53A 4OI0A 3THXA 1N33L 2GN5A 2ORIA 4KXFB 4YMTA 4IOCA 4FI3C 4JMPA 4DT1B 2MO1A 1EFRD 1ZYRC 5GJBA 4PPFA 4GOXA 1KI1A 1VYUA 3CF2A 5C4MA 1UE5A 1UE7A 1Z47A 1Z83A 3CPHA 1IHUA 5F2EA 3ADBA 1XTQA 4IVPA 2A30A 3NH9A 2BC9A 1P5ZB 2E5LL 4DR7L 5JCZA 2BH2A 4M0LA 5M5WH 3CUEF 3HWSA 3JZMA 4RY2A 3K0XA 2FGJA 1HTPA 3RS5A 4MYTA 2P5SA 5BYKA 1NTGA 5CM8B 1IBKQ 1NG1A 4PSKA 1I2DA 1KSGA 3W8RA 2C35B 2YV5A 3KTAA 2H7VA 3KJPA 2OFXA 4H02A 2R44A 4R98A 4YONB 3FPAA 2MFIA 2F9MA 3X1WA 2KENA 2FXQA 1K5GA 1LB1B 3TW4A 4GLAC 4LX0A 4DK3C 2AN9A 3KF6A 5H70A 3RRMA 2R93G 4K8OA 1NL3A 4BZQA 4IXNA 1AS2A 2FGKA 3QKRA 4PC2A 4ARZA 2GXAA 1P2VA 4PC7A 3U3JA 2E8GA 3AF0A 4MRNA 4QQBX 3SFVA 2J0QA 4EFMA 4US2R 4DSTA 5UKDA 2A6ED 1US8A 1GITA 1V5WA 3BD9A 3QUSA 1NBMA 2VLIA 4Q01A 4QG7A 4X8MA 2JA5G 5G40A 4A4DA 1M7HA 3B85A 3CC2A 2YVUA 2FSIA 3V4RA 4AD8A 2WHXA 1W2GA 4PXAA 1A1VA 3BU2A 1M7GA 1YNXA 1W4BA 2OFOA 1QVCA 3HJNA 4M22A 4POAA 4KKTA 1VQPA 1T91A 2QSYA 3BXZA 3TE6A 1YBYA 1CSQA 1EIFA 3TBKA 5LPNA 3K8AA 4UXJA 3NC1C 5GADC 2D74A 2QGNA 2BM1A 4GOKA 1Z29A 1W0KA 1EQRA 1D2EA 3SJBA 4QGUA 1Y14B 4V03A 1Q3HA 4HJ8A 4V0MA 4B3SL 2GEVA 4LF4Q 1FJGQ 3ZZUA 4BZXA 1RYHA 4OX9L 4LUZA 1OB5A 2XEXA 1N36Q 3NC0C 3PITA 1U9IA 3RWOA 3IBYA 5DLQC 1P6XA 2FG5A 2FMXA 1CXZA 5EE0A 5JZVA 3T35A 2ALYB 2B21A 2BMJA 4Y52H 1QBKC 3O47A 3SDZA 3RDPA 1G6OA 1W46A 3H2YA 2B3GA 2IWHA 5K36H 2D62A 4GMXA 2QE7A 1ZAKA 1XTKA 3LVQE 3T1QA 1YE8A 5KOYA 4OYHA 3A74A 4URZR 1VCNA 4JJZA 3T1TA 1N33Q 4K46A 3EN2A 2Z6KC 1HQMC 4HAVA 1KOFA 1XEWY 5H8WA 1TNDA 4AI6A 2E2HH 4A8JC 2DHRA 2PPBC 3WWVA 3GLHB 2RCNA 1W0JD 2MQHA 1O87A 2P0EA 1DS6A 4TLDA 4TLBA 5F3WB 1G64A 2BWJA 4YCWA 2IHFA 5TB5A 2LWIA 1EFHA 2NPIA 1X56A 1F6BA 1XX6A 2LSSA 5ELOA 4JBKA 1KJYA 4LV5B 2JK8A 2EYUA 4M9ZA 4TSFD 4ZO4A 3KJGA 4BRWA 5M3MG 3CCRA 4DSNA 1S9DA 3KKPA 3VU9A 5JFGA 2O8BA 3RS2A 3LBHA 2H5XA 1XMOQ 4BBSG 2H16A 2OESA 2YJTD 4V0NA 1HH2P 4DUGD 4JOIC 1BKDR 5GJVC 1OYWA 2A6HD 3ZVNA 4KODA 1BYUA 2GJKA 3B6EA 1LF0A 4LYHA 1U0HC 1BYIA 2W83A 4XVQA 5EXPA 3EC1A 1NRJB 4AG6A 2XNDD 1KSHA 4B3FX 2UKDA 3NKVA 2F3IA 4D80A 3CC7A 1OIVA 5FLMH 1XRJA 3I32A 1S8FA 2HDNB 2P6NA 1A2KC 2O0JA 1KQSA 2WKRA 1JXOA 1OH7A 1Z07A 3CCSA 4DR1Q 2PEZA 3LQQA 4RCYA 5JWHA 4JKYA 1X1RA 2BBTA 1KI2A 3BIFA 1QDEA 2YOGA 1WJJA 1UADA 3LNCA 4OK3A 1P75A 1FW6A 5KSYA 3FMPB 4B75A 1R5BA 4A3BG 3K9LA 4IEIA 2IYYA 1W36C 1KC8C 2IUTA 3O8CA 1AGPA 1EK0A 2PLRA 3E9HA 3HR7A 3I5XA 2O8BB 3BH7A 3GLGB 2F1RA 4JI3Q 1E2HA 2EU8A 1DOAA 3QF7A 1M74A 4DIDA 3L8YA 1G41A 4QY7A 4A3GH 4KBGA 4Q7KA 1II0A 5IYCH 2RB4A 2WVJA 1TWHH 1Q82C 3QJYA 1X6OA 1YVDA 2BBSA 2F1JA 2VF8A 5KDLA 1S9HA 4AYXA 1E2EA 4GP6A 1Q8KA 3QF4A 5JJKA 1ESMA 3QG1A 2A5DA 3R7WB 1RJ9B 1VYVA 3I61A 2O8DB 3X1XA 1E9SA 3VR2A 2CHVA 2PZFA 3H0KA 5GADl 5L3SB 1L8QA 3WBKA 1FR3A 2PLFA 1YVCA 4EPWA 1VQJA 4B2LA 4TMTA 2GJAA 2OE2A 3PV0A 1NI3A 2AK2A 2CCGA 2W2TA 1COWD 5ANRB 1OH8A 5BN4A 1NMXA 1OFIA 2ZAMA 4K81B 4PHTA 2HYIC 4BFVA 5KDOA 2FFAA 1A4RA 1F48A 3LXRA 1GTVA 4AYBG 4DCNA 1EXMA 5C4XH 4V0KA 1E9RA 3EPKA 3E0EA 4B3ML 1COWA 1R2QA 3MAAC 2ZE6A 2JEAI 2ZETA 3GP8A 4MUAA 3GJ5A 1IY2A 4DAYB 3CF6R 3KB1A 3H0GH 3PG5A 2ANBA 2QMEA 5AJXA 2HUPA 1W7AA 3OW7A 2HV8A 1YR7A 5FL7D 1DD2A 2JA8G 2WMNB 3VAAA 2X77A 1S1CA 1EYGA 2ODWA 4LHXA 1OIXA 4AK9A 3WP0A 5HCNA 1LACA 3RAPR 4TLEA 2WFWA 2GCNA 3ZD6A 1O3YA 1RRFA 2OO7A 1KKMA 4TYYA 3F2CA 4I7ZC 3KLWA 3GFOA 3L2PA 1HNXQ 1DAKA 1KMHB 4HZUB 1NJFA 2ZRHA 5JI3E 3GEEA 1Z0FA 4PAOA 1G18A 4DV0Q 1E1QA 2QI9C 2ES2A 3J81i 1Q1EA 1KNQA 1BOFA 1SVLA 3JZAA 4IDHA 4JYCA 4KU4A 4A3FH 3M85A 4DAMA 4Q4JA 3RANA 2BMFA 2ZQ5A 2WB1G 4WIAA 1KO5A 4GNXC 2Q21A 1FX0A 3AV0B 1VQAA 4Q4JB 2ATWA 3ND9A 4LHWA 4WA7A 5FJ8G 2V4ZA 1Y69U 2Y8EA 4BFYA 1Q12A 1OH5A 1HT2E 1FOEB 4GOPB 1G3MA 1L4YA 4RKFA 4B74A 3KQLA 4US1R 3MXUA 1NSFA 2ZRCA 5EXXA 4A0HA 2UUAQ 3KFVA 3AF2A 3CCJA 4X64Q 2OWOA 1PZNA 1U0JA 3VX3A 4KMUC 3HOYH 1U98A 3R8CA 2CHQA 4BBSH 2ERXA 1C9OA 3I4MH 1IM2A 3KJIA 1E7ZA 1DELA 4OK5A 2E9SA 3H84A 5FTNA 2Q9BA 2OHFA 1SMXA 3M4QA 1D2MA 3S1AA 5FPYA 4LGMA 3SJAA 1NF3A 4R4CA 1MABB 4DVGA 3K9GA 1ESNA 4Q9LA 3TSZA 1CKMA 2QGQA 1PYSB 4OO1I 1O7LA 1E9FA 3D3QA 4V0LA 4RZ3A 1R0WA 4P33A 3LX8A 1VF7A 3VMFA 1E2MA 2JLYA 5H1SE 4IFDH 1FL9A 3GFTA 3K9NA 2X2FA 2RHQB 4UXIA 1G8YA 3OTOL 3P27A 4UNSA 2PNRC 4OONA 1AA9A 3EBEA 1NLFA 4JI6L 2A1AA 4UXHA 4LHZA 4Y0VA 2C9YA 4IJLA 4JI5L 2J87A 4NPSA 4A3DG 4OI2A 4NYJQ 1ZM9A 3GLGE 4FD2A 3SYNA 2XTNA 1E0KA 4H1VA 1FTSA 1TQ6A 1GM5A 3SGIA 4ITRC 5BR8Q 1YITA 1FUKA 3ZS8A 2A2ZA 5CIWA 4B3MQ 1II8A 3CLVA 2G1KA 5FBWB 3UK6A 5L3QA 4IPGA 4OHZA 3EWSA 1YKSA 3TR0A 1ZW6A 1E2JA 2CL6X 2ZR7A 3RN5A 1P2TA 3RSLA 2VPPA 4EIWA 2OLJA 4X65L 5GVSA 1RIPA 2VHQA 2QP9X 8OHMA 1JB7A 1VHTA 2JLWA 3FPPA 2RKOA 1XZPA 1TQDA 1VQFA 2ZI9A 3U7GA 3F2BA 2V54A 3PXGA 1E4VA 3A8KE 5LMUQ 1Z0DA 2HLDD 1HZ9A 2ZRLA 5JSZA 1W36D 121PA 4DLWA 5HZHA 3A1VA 4I1SA 2ZE5A 2QAGB 4U7DA 1IZ6A 3J80c 4X66L 1AQUA 1EGAA 2CDNA 1G8HA 2QAGC 3IDQA 1ZC4A 4PO8A 3X1YA 1T9HA 2FV8A 4M2LA 1B7YB 4HR7B 3BE4A 2BKEA 4HUQA 4DNTB 2OCBA 4G01B 4A3IG 2ZJ2A 1FZQA 4D4MA 2FSGA 3EX7C 1QHHA 4HDOB 2XZPA 4YMWA 5FOVA 2WMOB 2MMCA 2QTFA 1BDOA 5FPSA 3NXSA 1NY4A 3PUYA 2QP3A 3PCOB 1AGRA 4TTRA 4F4IA 3TK1A 2WJJA 3FHOA 3RWMB 1LABA 2N1BA 4QNRA 5J47A 2L0XA 3I55A 3EIQA 3GEHA 4B76A 1XJ0A 4UP8A 1GHKA 4BECA 1EX6A 5EZ5A 2R92G 2ZTEA 4TL6A 1D9XA 3EZ7A 2KCTA 3AUYA 3X2SA 2I0QA 4B6EA 2V7QD 1SN8A 1OF1A 1U94A 3B13B 3K0CC 1LY1A 1W49A 2V55B 4QGHA 3UPUA 1QVRA 3U60B 1N9WA 4C0BA 4P3YA 4ZKDA 1XMVA 2JLRA 5HY6A 4IKEA 3TSOA 1QHNA 4DLXA 3WDNA 2FZLA 2XTZA 4DV4Q 3BRWD 1QJOA 3U2QA 5L8VA 3CCLA 1UBCA 5L3VA 4CRWB 5CJPA 3F2DA 4E5UA 1UAAA 1L0WA 2MSCB 1VHLA 1VQCA 5CM9C 3GLFE 4KYUA 4AURA 4IJHA 2EJGC 1GKUB 3WXMA 2N46A 3HOZH 2IK8A 4J0QA 5HZKA 1ETUA 5C44H 2ODEA 5AUOB 4MITA 3LFUA 3QBVA 5KYKA 1OXXK 2PMDA 2ZRPA 2JASA 4FN5A 2B8GA 2GAAA 3M0EA 3QVVA 1G6HA 3GLFA 3WRYC 2JJ8A 4XTCS 1MO6A 1WI5A 1YJ5A 3GCGA 3OFNA 2FFHA 4D26A 3QEOA 4UY8C 3M7NA 2JA1A 1D2NA 4M9SA 5M5XH 4ARZB 3BBPA 1XZQA 4MUBA 4IOAA 3Q3JB 2ASEA 2QN6A 1VCMA 2DFLA 2Z0MA 3B82A 5C3EH 1EX7A 2IL1A 3K09C 3U4VA 4OJKA 3FFBA 1N6IA 2IUSA 5AJ3Q 3M1IA 3OIYA 5KU1A 3MWYW 1P16A 1EG7A 4UQOA 4A3IH 5DN6A 1NN3A 4YWMA 1L4UA 4Q19A 3SZRA 2LXKA 2O5IC 4IPHA 3MCAA 4S35A 2MNAA 1A2BA 1F2UA 2Z5FA 2B7BA 1E98A 1R7RA 3MMPA 3QVUA 3GTGH 3TUZC 5FOWA 1MKHA 3EZ2A 3K0FB 1XJQA 1E9CA 1I4DD 5AJYA 3FVQA 4EUNA 2O8FA 1AIPA 1IXRC 1GNQA 1JR3D 4LOAA 3CW2C 1CTMA 1J5EQ 1N6OA 4EDHA 3CXCA 3CRQA 1NG9A 4R4QA 2JA7G 1D6JA 2O8DA 1UF9A 1E9EA 4NBSA 4YDSA 4DLTA 3I4OA 4DDUA 1LYLA 4NCNA 1DXMA 1E2FA 1RC8A 1Z5ZA 4F4CA 4MKGA 1CLUA 3ND8A 5JWRA 3TW8B 2N78A 4KITB 2FDCA 1JJ2A 4P4TA 1ZUNB 4O0MA 1A62A 2C95A 3K1JA 4M1SA 1SE8A 3KB2A 1IN4A 1MIUA 2R6AA 5FTJA 6Q21A 3GTLH 1S3SA 2W2XA 2JEOA 4DK6C 4XTRA 4OWTB 4JI1L 2VL7A 1NNEA 4RZUA 2O0KA 1UE6A 1R0XA 4AIMA 2HT6A 4PANA 2BEJA 1DE0A 3CRW1 5BR8L 5JRZA 1N6RA 1P8LA 1OV4A 1WB9A 2ZPTX 3S17H 4AY2A 4FMCB 3RS7A 4DDWA 4PX9A 1SQ5A 5JCPA 2D0PA 5EE3A 1ONBA 4XOIA 2BE5C 2XTIA 1GVPA 2BH8A 4WZBE 2K52A 2UUCL 2E75C 3VR5A 1GUAA 1S3OA 4YHHQ 3TRFA 2BDOA 2CCJA 2QTHA 4LJ8A 5DE3A 1VG0B 3AGQA 4G5SA 4BXXG 4OGQC 4C0SA 3LVRE 4D4KA 3EASA 2ATVA 2YWHA 1P9RA 3LRPA 2W6ID 3ZH9B 2G1JA 3NH6A 1Z6TA 2QM7A 3OEHA 1AKYA 3THYB 3WYFA 2OSBA 1T0HB 1W4AA 4DUGA 3IRBA 3B1VA 5DN6D 2CHGA 2IT1A 3VHLB 1LF5A 2A68C 1MJEA 1QVAA 4LCBA 4EFLA 5FOXA 5BXQC 2E87A 1VS0A 2VEDA 2A68D 3LQRA 4PPQA 1G19A 1X8KA 2P6UA 4LJZC 1MH1A 4MA4A 1N5JA 3CCVA 4WJ3M 1SVSA 2VP0A 4MQBA 4OHXA 3F8TA 3G82C 1D8LA 1U0LA 4EPVA 2WWXA 4DC9A 1RVDA 3NE5B 3VA7A 2JA9A 4C0LA 3B6YA 3THWA 3FKIG 1CR4A 1FQJA 4LZZA 1GO3E 4B3RL 3J80i 5CDFA 1SLJA 2HJGA 2K5UA 5FR2A 1E96A 4BY7G 1JE5A 5B57C 5JWOA 2Q3MA 4M1TA 1BMFA 4A1FA 4CT4B 4YQFA 3BH0A 3GTQH 1TF2A 2HIXA 2ANCA 2ORWA 2D3WA 2A5FA 2ZUDA 4BUJA 3Q7PA 3FTQA 5AUNB 5LDDC 1U9IC 5JHHB 3FMOB 2BKUA 1MR3F 2BM0A 4G5RA 4YMVA 3G6EA 3UWOA 4B32A 1VQ4A 1R6BX 1VQEA 4FXPA 4KSCA 4D4LA 2JGNA 1KK1A 4NCKA 4DCVA 3TQYA 2EXDA 2Q3FA 2HHHL 3AVQA 4RD3A 5LD2B 4QM6A 2BMDA 4RSGA 1UKYA 2UUBL 1NKTA 1B70B 1IN7A 2CLDX 3BC1A 421PA 1PLKA 3A58B 3LY5A 4C0JA 2JA8H 4QJ3A 3VFDA 4L5QA 1C4OA 4PZ7A 4Q9JA 3BJIC 3CC4A 1OXUA 2GK7A 3W8NA 3CH4B 2YTXA 2ZAOA 2H17A 4U00A 4W7SA 3A1TA 2IYTA 4DR4L 4R7ZA 3DKVA 1X3SA 2PNHA 5AJVB 2B8WA 5FOSA 4P73A 1KAWA 1E99A 1NY6A 4GN3B 4A93H 4D0LB 3GTJH 1R10A 2B92A 2K33A 3R8FA 4RKEA 3KKOA 2GJ8A 3HOXH 3AQQA 3MJHA 4OHWA 1GRQA 2A8VA 2WJVA 4PR0A 3C14C 5E4FA 3TREA 4YXWD 1OKKA 4JVNA 3P20A 1EFRA 5HE8A 2PMZE 4PTLA 1H8HA 1KI4A 3EARA 4JKIA 4B6FA 4OKSA 1PH5A 3GTPH 1KI8A 2EQBA 5LD2C 4JOIA 2AXNA 4H1UA 5DYIA 3W1GA 1S72A 3WNCA 3KF8B 3S2HH 1CJTC 1TMKA 1ZNYA 1N5LA 2LKDA 3UDIA 1YI2A 2TMKA 2ZJAA 3IGFA 1E6CA 4M53A 4RD2A 5KO2A 3SE0A 1QVGA 1AE2A 1E2NA 1FVIA 5FLXc 4ABYA 2JQOA 2JJ1A 1YRBA 1T6NA 3GJ7A 2JA7H 2W0MA 1A5TA 5AUQA 2HF9A 4JI8L 4W5WA 2ZSBA 2IX3A 4HIKA 1JEDA 3JAMi 2EJFC 4B3CA 2RGNA 2W6IA 3REFA 4KHPL 2ZJZA 2JJ1D 1YNNC 4DV0L 4A3BH 1A63A 2RGEA 2VA8A 4KLNA 4D81A 2JLXA 1KY3A 2AFHE 5C0XI 3VNVA 1VDZA 4QBGB 4XSGA 4G1UC 4FCWA 3RRNA 1FQKA 2CNWD 2YWEA 2XB2A 3O8BA 2QT0A 3B60A 2PZGA 4LUVA 5C3EG 4AWXA 2QNRA 1ZIPA 5BN5A 1JALA 4NH0A 3WNDA 5TV2A 2NVYH 3K80C 3M6AA 1IBML 4Z54A 3CX7A 4GL2A 2ZEJA 4MRSA 4X64L 2J1LA 1IOZA 3B1ZA 2JA6H 1VQLA 1XNJA 1YR9A 4I4LA 3L7ZC 3KZ1E 1LW7A 1YZKA 5HPYB 2VNUD 1KI9A 2RH5A 4DLZA 4EQ6B 2D2CC 2CVHA 3AKDA 1RZ3A 2HHHQ 1WMSA 4LC0A 4POFA 3RRYA 1VMAA 2KJQA 2JDID 2NN6H 1TQ4A 4BFXA 4JLDA 1RE0A 3LDAA 1X8JA 3CCMA 3STBC 3K81C 2BIFA 2CCZA 2IHEA 1ZM2A 5CJ2A 4B34A 1Y1WG 1UEJA 4CEIA 3AVUA 2NO9A 1E2LA 2VSOA 2PCFB 4LJ4A 5EP1A 3A5ZB 1Y8NB 4HDQB 5LB4A 4B43A 4EAQA 5J4LA 3MGCA 4NCIA 2K32A 4BWYA 4H13C 4A3JH 1XPOA 2GBLA 2NO1A 3VX4A 3D31A 3K0EA 1ZINA 1KAGA 2VHCA 1WDTA 3CQZH 1KZ7B 2C9CA 2ZE7A 2QMHA 1N6HA 2JIZA 5TMPA 4ZKEA 5DHFA 3I62A 2H5EA 4A3GG 1KI3A 1FUUA 5IP7G 3O8RA 2HT1A 2QSZA 4D82A 4G7HC 2FSFA 2MO0A 3OESA 3K0AA 2J46A 2GVBA 2GILA 4G3XA 4TL9A 5FBLB 5JEDA 3A1UA 2PJRA 1OTCA 5G41A 4M1YA 2NVQH 3OHMA 4E09A 4MZ9A 2C04A 4TSFA 4M1WA 2F43B 4CEHA 1Q81C 3T34A 1ZD8A 1Q0UA 2V6IA 3SI7A 3AP2A 3B78A 3HU1A 1GNPA 1IW7C 1Z3IX 2GZAA 4CF7A 1Z0KA 3T53B 4DUZL 2FFBA 3PEVA 3CZQA 4UP9A 3LBNA 4MGZR 4HSEA 2WV9A 3AVOA 4A2PA 4ASUA 4GN4B 4NHOA 2VQEL 1N0WA 2IF0A 2R7ZG 3HU3A 4L9WA 3KOJA 4DV3L 2QENA 2ZI4A 1K6MA 2C78A 2ZVPX 1YIJA 1VQ9A 2EFDB 3AP1A 4LDJA 3KUDA 3ZDQA 4FMBB 4IO9A 2EFEB 3W5IA 1OYYA 4GKJL 3IHLA 4DCTA 4A3EH 2JCSA 4JI4L 1PLLA 1XCGB 5L3RA 2IS6A 3LGJA 2IEZA 3BB3A 2ZSAA 4HLUA 5AUPB 4LF7Q 2NGRA 1I6VC 1HUQA 1P62B 3S1MH 4C3JH 1G21E 4LFAL 3TS2A 3N2IA 1KKLA 2AD1A 3TGPA 3OYYA 4R9UC 1NBME 2J0SA 3I72A 5FI1B 1G1MA 4DNIA 2F3RA 3BOSA 1W48A 2V6JA 1ZBDA 2XGJA 1HQYE 1L1OA 2AMCB 5IWAQ 2W6JA 3PENA 1NMZA 4XWOA 2RGGA 1E32A 1G6PA 2R62A 5C4JH 4M1OA 3A1SA 1PA6A 3TQFA 1OH6A 4LJ6A 1TAGA 3TVDA 2N8NA 3T61A 3P1JA 4EFNA 3GLIB 3HOXG 4C4PA 2X1VA 2Q9AA 4DV5L 4G0NA 4LPSA 2G0TA 4A6XA 1L2FA 1PLJA 2ZI7A 4O2LA 3W3ZB 4F93B 3M9BA 3AF3A 4BGDA 3HOYG 1PH4A 4Z51A 4P74A 1JJGA 1G5RA 1KMQA 4M9XA 4UJ3A 1E3PA 3S16H 1NLZA 1HJPA 3AF4A 2FZ4A 4LF9L 3QKSA 1G3UA 1WA5A 5A5GA 5IK2D 2D4HA 2VYFA 5CYOA 2OAQ1 1LTQA 1TWCH 3UIEA 2XSZA 3WRXC 1JB1A 1U5KA 3FKIH 1VCOA 4Q48A 3BH6A 2VZAA 4KKUA 1GHJA 1EUJA 1TWAH 4YCUA 2VHJA 5HE9A 4IOJA 2F52A 2J9RA 4KHPQ 3OOCA 2BJWA 2BBWA 2IYQA 4JLBA 4ASUD 3GJ6A 3WMFA 2XB4A 4YLGA 3TRZA 1XMIA 1SVWA 1FP6A 3BAFA 5E7JA 1WBDA 1XEXA 1VQ8A 1IY0A 2HJVA 1Y8PB 5LMNL 3DHWC 4Q1FA 1U81A 3ZYCA 4P75A 4BY7H 1YRAA 3QI2A 4IDPA 4Q1CA 4XSHA 1TX4B 2PX0A 4M1KA 4M21A 3M3YH 2J41A 5CITA 4IRUB 2ATXA 4YY3Q 3PO3H 3KKNA 4Q18A 4HEJA 3DVLA 1W4CA 1QHHB 2QT1A 3GJXC 4LV6A 1ASZA 4JYAL 3T5GA 2UU9L 3OF5A 4JC0A 1YZ6A 3S24A 3BFXA 3LXXA 4Z1MA 4DV3Q 4A0RA 2O8CB 4UNPA 1Z6XA 2Q2TA 3QXSA 2GEDA 2FEMA 2BVNA 1N34L 1XNQQ 2H1LA 2UUBQ 1IQPA 3TSWA 2V1XA 2ZVQX 1GDDA 3HKZG 5EZ6B 1SKQA 5CIQA 2GBLC 3UG7A 1TWGH 4L5SA 3STBD 1E1TA 4Q7MB 2Z0SA 1VKJA 2BBOA 3SJCA 2JE6I 3RS4A 4Q4HB 4E07A 4CEIB 3EZFA 4KI0A 1OIWA 1PH2A 2WPDA 3FYHA 2QUZA 4V02A 1XTJA 5FTMA 3UKDA 4LFAQ 4ZIRB 2AL7A 1TU2B 2ZU0C 3H0GG 3QPUA 4FINA 3THXB 3CD6A 3SN6A 5A0FA 5FH9A 4LNQA 1IJEA 2WICA 4JL8A 2Q8IB 5AWFC 1PFSA 2KHJA 1X6VA 2IYSA 1E24A 1UPTA 2QAGA 1Q1QA 1RRCA 1TPZA 4U5XA 2N49A 4MTNA 4HB4A 1I94L 4EX5A 3BERA 3AVTA 4GOPA 3KXKA 4HUQB 3L82B 4DB2A 2PI2A 1WQ1R 3K70C 1CFMA 4MYUA 4ME3A 4PHFA 1BO6A 4JLAA 2VS1A 1KHTA 2PCJA 5HKKA 4QBFA 3WY9A 4XD7A 5SZIA 1GJXA 3QOFA 4G5GA 2B7CA 4DWJA 3J7A5 5E7MA 2DY1A 2GJSA 4HIMA 3KXLA 3QKUA 3Q7QA 4MH0R 1KHIA 2XTMA 3MLEA 5C2JB 4HIOA 4C2UA 4A3EG 2IW3A 4TMWA 4A9AA 4D6PA 4Z1MD 4DV7L 4C3HH 3KDFB 4HAUA 3JC66 3TQCA 1XFAA 2ZJ5A 4QRHA 2VP9A 3RABA 3GLIA 2L5TA 1N34Q 1KIXA 1XNQL 3SR0A 1J70A 1R8QA 2GHIA 2ASBA 1UBFA 3PEUA 2WM9B 2XJ4A 4TKOB 1VQBA 4RCZA 4B3BA 1A8VA 1W2BA 2GCOB 5K8IA 2BEKA 1TL7C 2FPLA 5KHOC 1B0UA 1II9A 1Q21A 1Z06A 3A36A 4LBWA 3C8UA 3U3MA 1XCMA 3MXNB 3HKSA 4HZIA 4YY3L 1N36L 2JJ2D 2WWFA 4GOJA 4CYMA 3LBIA 3RSOA 3W6NA 1WF3A 2ZYTX 2EWVA 1N32Q 2WOJA 4FDBA 4P71A 3KKQA 1OFHA 1DEKA 3PQCA 2I1QA 4BA2I 2YC2C 4JVMA 2OQ0A 2OM2A 4ZCLA 1CKNA 1ZNXA 2IWRA 1ANKA 1KO7A 4QL3A 3U3RA 4OK6A 3DM5A 4N0EA 2GXQA 4JLVA 1MJCA 2DN8A 4B3TL 3QBTA 4WAUA 1QZHA 2ID0A 4XH9B 2GVZC 3U4ZA 3PEYA 2GNOA 4L5TA 3DXJC 2N3SA 1HH4A 1BBWA 3A7LA 2OAP1 2BA0A 4JVLA 1U8AA 2VP4A 5IT9c 4MKHA 5GVRA 3ZJYA 4ZI3A 3FGNA 3ZQ6A 3RYTC 4PV1C 1YHBA 3QE0A 4MKFA 4QGAA 2UXBL 3CWQA 1I3QH 3PJRA 3PO3G 4YMSA 3CPEA 4NXMQ 2YZ2A 3FHCB 4YC7A 3W1BA 1G7RA 3FMFA 4MDEA 5JEEA 1XPUA 4CDGA 5EXSA 1KNXA 4LK1C 4LSGA 5IWAL 4QHYA 2IBMA 4XJXA 1E1RD 5TARA 4Q1EA 1IW7D 1RIFA 5CB8A 3B5JA 2GK6A 1XD8A 1XXHE 1HNXL 3NEYA 2DNEA 3MG9A 4JLPA 1IXRA 2VP6A 3ADDA 2OTJA 1QUQB 4G5QA 3AKCA 2Q3HA 4QJ4A 3J7ZC 2L15A 3FB4A 2A6EC 4NZYA 5DIFA 4OHYA 1XXHA 1IN8A 1F2TB 2HLDA 1UEBA 1E79A 1T5IA 3KX2A 1ZU5A 4AQYQ 4Q9HA 3SHWA 4JLKA 2MMGA 1CJVC 3K0AB 2D0OA 1QHYA 1ZNWA 2CK3D 2ZUCA 2F1HA 4DV7Q 5IP9H 1VTKA 3AVPA 4N3NA 4Q1DA 1I6HH 4JI3L 3A4MA 5J4YA 2P67A 2ZSDA 2ZI5A 3CM0A 3WHLA 4PFSA 5KSPA 2R6CA 4TYWA 4C30A 2PBRA 4TZ6A 5JSZB 2R6DA 1J99A 4KJZA 1PHJA 4KSBA 1T5EA 1IL2A 4IEEA 4NU0A 1VG8A 1FP7A 4A82A 1N5KA 3A8TA 2DFNA 3ERSX 1M90C 4ILEA 2EQSA 1F2TA 4CEJB 3AFPA 1GKHA 4QJ5A 1UKVY 4NCJA 4RZ2A 3UANA 4JYAQ 2FWRA 2YNMA 2UU9Q 3MJRA 3DM9B 3HR8A 4MGYR 2IX1A 2ZM5A 3U3KA 5IP7H 2GXUA 3R9WA 4A8JB 1XCPA 3EPJA 1TWFH 1K3RA 1G7TA 3OPOA 4D0GA 5JBQA 1B9NA 1B9MA 4NPHA 3EZ9A 2DWPA 3DMDA 1OXSC 2ZRBA 3CH5A 1D7QA 1E2DA 5FUWA 4PPGA 4KN7C 1Z8FA 3K0CA 3CNOA 1LUZA 4NYIQ 3I1FA 1X1SA 3VR1A 1E3MA 5SZHB 4QIWE 2IYUA 4JLMA 4OO1G 3OEHD 1ZVQA 1H9SA 3NBYC 2CCKA 3DOEA 4DDTA 4LJYA 2XZOA 1AJEA 5CLQA 2FU5C 4MYCA 2JLSA 2J45A 3IEVA 3JAMc 2YINC 2NMVA 4X8LA 5DISB 2IS4A 1WP9A 3NBXX 1GL9B 4LWZA 4UNQA 2VSXA 1E2QA 3C7KA 2ZTDA 4W5JA 5KSZA 4AKGA 3U4QB 3L0PA 2AR7A 2KE5A 1I94Q 3L8ZA 2I3BA 3MWLA 1FNMA 4IJMA 4OQNA 3BG3A 2QM8A 4ERNA 2VUMH 2C9OA 5GAEC 3A37A 4KFUA 3G71A 1MKYA 3NWJA 4B3SQ 2EFGA 4JBWA 4ZDKA 4JL5A 3CZPA 3E5HA 3H1TA 4NTZA 4EPRA 1HQCA 3S1QH 1OHHD 1GL7A 4R1JA 4BE7B 4GZYC 2KI5A 1SVOA 1Y1VH 2NIPA 3W6OA 3A5UA 2OCPA 2HQLA 2F4VQ 4LW1A 1OFTA 3U3OA 1DAMA 3BDOA 1CR2A 4RD6A 4PHHA 2A19A 3AUXA 5LBIA 1XTDA 3BB4A 3UE1A 3HP1A 4WZ6A 4GRAA 5FPHA 1AH9A 5C4XG 1ZM7A 2ZREA 1D9ZA 1JNYA 3S2DH 1P9NA 4TMKA 1CJMA 1Q44A 4WW0A 1JI0A 4O0AA 3TIFA 4UKDA 3W3AA 2A7QA 1YJNA 2Z43A 1CI3M 4LF7L 1F2UB 3I4NH 5DGXA 3RZDH 2O5VA 1Q1BA 1T3SA 2E5LQ 4A76A 5EJEA 5JI2E 3U4QA 2ZRFA 2OQKA 4DR7Q 3MSXA 1XD2B 1R0ZA 2WOOA 2ZJ8A 2R65A 3I2ZA 1ODFA 2F7SA 3QPWA 5CLLA 3QIAA 3IIJA 5JLJA 1FMLA 1Z22A 3KTAB 3NBHB 1U8YA 1XEFA 3CBQA 4WXPA 1LM0A 5E7NA 4K0KQ 1IBKL 4IVQA 3K0SA 4AC9A 1JBKA 4MYHA 1K8GA 1XP8A 3K09A 3ICQB 4C7OB 3H15A 1YJ9A 5EE9A 1LV7A 1Z6AA 2D7CA 4A3CG 1W5SA 4HAWA 3GLFB 3AVXA 4POGA 3QXJA 1TTTA 2QMOA 3ECCA 4JI2Q 1HR0Q 2Q2HA 4YWKA 4G7OC 1MO5A 3N2EA 4Y0AA 2ZXUA 2P6RA 4JV5Q 2XXAB 3SOPA 3HOWH 3G5UA 2BHRA 4LUCA 4BFTA 1P60A 4TQAA 4BZPA 1RRPA 3B1YA 2XGTA 1U99A 5DO9A 1P4SA 1M2OB 5AJ3L 2DFTA 1W36B 5IYCG 2VSFA 4AQYL 5EUQB 5H68A 3HOUG 1E2ZA 1GUNA 2WSSD 4ZI2A 3SC3A 3K9HA 4DLYA 3MWKA 5FBRB 4DSUA 1XMJA 5L3QB 1J90A 3AP3A 2ZIAA 4L16A 2GRJA 3MFYA 2JAQA 4G5OA 4BBRG 4BFSA 5M3FH 5IY0A 2J7PD 2QRNA 4BBRH 1RJ9A 3P32A 1ZJ6A 3GEIA 3MEFA 4OWWB 4TVAB 4NE2A 5HTKA 4ESVA 5J4HA 3EC2A 3P4YA 2Z6KA 5C0XH 4HAYA 4NYMR 4QHTA 3QSYA 1KDPA 1IAQA 3LO5A 3R20A 1FYCA 1R0YA 2HCJB 4JK1C 4NB3A 2D06A 2I5HA 2J7KA 1YR6A 4NL4H 4QKQA 3L0SA 1G4UR 2WJHA 4MGKR 3EPHA 3THYA 2YYZA 1G16A 1SMYC 1TEXA 4K0KL 2UZIR 2H92A 3DL0A 4AKHA 1B23P 5C4GB 3VR3A 4PPNA 2VP5A 2Z4RA 2YU9H 3AGPA 3CNNA 4LI0A 4QBHA 3QG5A 3KJOA 1HCZA 3CMEA 3MWJA 3QKSB 4II7A 3W5JA 3AVWA 2NN6I 3T1HL 1Z0IA 2K5HA 1WYDA 4PC6A 1MABA 1G8GA 2FH5B 2PT5A 4DCSA 1KL9A 2KHIA 5DYGA 2NQ2C 4A75A 4JV5L 3Q85A 2AWNA 1O7IA 1GZSA 4PHGA 3GLHE 3RN2A 1NKSA 1YHQA 2IYRA 3GDEA 721PA 3LLMA 3L2OB 4JJKA 2A69D 4BRUA 1R9TH 1VG1A 2GKSA 4LK2A 4DV2L 1Y1VG 3HPQA 3KKMA 5H1YA 2JIZD 2CLSA 1NN1A 1XEXB 2AFIE 3CR8A 2A9KA 2PL3A 4DHEA 3GQBA 1Q57A 3DM3A 1ZCAA 3AKYA 3U7EB 3TKLA 2MSDB 4A15A 1XMOL 4YXWA 3GMTA 3LA6A 3LNNA 4FW9A 3WHKA 1FX0B 2ZRJA 4AYWA 2Q9CA 1F60A 1NMYA 1NN5A 4IPCA 3SQXA 4NONA 3NHBA 5TXGA 3X1ZA 4ZV4A 1E79D 3SNHA 4JT4A 1HPCA 3WMGA 3WBJA 5M3FG 1PH6A 4PMWA 5J5CA 4PQYA 4L5RC 2UXDL 1XNRL 1FGUA 2GAOA 3U7HB 2RGXA 1YZGA 3G4SA 2W58A 2GDJA 1X3EA 1E1QD 1K8RA 2AUJD 2K4KA 3GTMH 1G9XA 1VG9B 3OAAD 4BXXH 3W90A 1N5IA 3ER0A 1KI7A 4XIGS 5IHPA 4HJ7A 2REBA 4EPXA 4RMFA 1OHHA 4HLDA 2ZUBA 4V0ME 4DR2Q 3PIRA 3T5DA 4R4TA 4DR2L 1KO4A 1T5LA 1BKBA 1NN0A 2EWWA 3BGWA 4EKDA 3QKTA 1HZBA 2P2LA 4DK1A 2P5TB 3I3SR 2K50A 1W4RA 3E1SA 4JI0Q 1P7CA 3CO5A 1I5FA 3UDXA 1FFHA 4OQXA 3KL4A 2JA5H 1GWNA 3I7FA 2QA5A 2XOKD 2IYZA 2CJWB 3PF5A 1R4AA 3QNUA 2G9NA 4ALPA 4FCVA 1HZAA 2QPAA 1NBWA 2LXJA 3J81c 2ZRMA 1Z28A 1H95A 4KLZA 2BCGY 3HOZG 1PUJA 3R7WA 4P0TA 3FP9A 3ZS9A 2HCBA 2O52A 4OL0A 4BFWA 2F4VL 4R4IA 2OCAA 4URWR 1E2PA 5DNYB 2CKZB 4B35A 5FI0B 2CL0X 3A8IE 1TXYA 3RLFA 2XSZD 3PIOA 2EVBA 1NMFA 1C9KA 1Z2AA 1IBRA 5AK0A 1S96A 2QF7A 4M4SA 3FKSA 1G3IA 2QY9A 3U58A 1CRQA 4I1VA 3T1HQ 2V4DA 2QE7D 3AEZA 3UATA 1KK0A 3ZZTA 2GVDC 4YDHB 3V9PA 3FHTA 1LVGA 3UG6A 5DLQE 2ECKA 3HU2A 4IOKA 1TF7A 2Q2UA 1ZKOA 4RCNA 1JAHA 3GLGA 3CMAA 3PO2H 1I4TD 3VQTA 5P21A 4A3MG 4DEYA 2R7FA 1P9WA 2LCFA 2VHUA 3IKJA 1VQ6A 1W0JA 5C1BA 1GUOA 5F9HA 4Q1BA 2NZOA 4A4IA 3LWUA 4LJ7A 4URUR 5LMUL 3TS0A 1Z2CA 5J40A 5BWMA 5FBVB 2B63H 4KKSA 4EQ6A 1EWRA 4AKIA 2C03A 2YOFA 2WWHA 1G3RA 3SBDA 2ZRDA 4X66Q 2F6RA 1FTNA 1SRUA 3MUFA 1V1QA 4Q9KA 5JJLA 1KXLA 3PEWA 2WTUA 2WAXA 1RFLA 2ZROA 1HURA 2R92H 4A36A 2VL6A 3MRSA 4QNMA 1EFWA 4Q7LA 1HNWL 1UDWA 3CP0A 2UXDQ 1MV5A 2N42A 4C0KA 1OT3A 4TYPA 3THOA 5KDDA 4IDOA 3W34A 1AS3A 3KYHC 3GTKH 3EAQA 4RFSB 5J4KA 3ADKA 2ODBA 3FKSD 2ZRIA 1DTSA 3LWNA 3U6KA 1S4QA 3QXCA 3L43A 5FPTA 1II8B 1ZU4A 3G0HA 4IW3B 2JXMB 5BN3A 2EDGA 3CF0A 4D0NA 1TQ2A 1HE1C 1TKWB 1CP2A 5KUTA 1V9PA 1K73C 4LY6A 3A4LA 1J8YF 5TY0A 3KJEA 2Y0SG 1NMGA 4UNNA 3T51B 2FE4A 1U2RA 2I4IA 4Q00A 4GNXB 221PA 2GVAA 2RMKA 3BK7A 4YHHL 4DR5Q 4Q02A 4OX9Q 1Z9FA 4KVGA 4C2MH 1PYBA 1JQLB 1SHZA 4LPKA 3ZIAD 4PZYA 2PQAA 2KCCA 1XWIA 3CCEA 1YR8A 2FOLA 1SGWA 5CK5A 2DUDA 3TJZA 1LNZA 5JECA 4ZDWA 2KB0A 1AZTA 5LB2A 1F5NA 1U90A 2ZYWX 1N0VC 1SXJC 3OIUA 4DZZA 3C5CA 1E2IA 1X3FA 2AK3A 5FTKA 5EQTA 2NVTH 4WXRA 3WMEA 1H8HD 3FHWA 1KD1C 4JI1Q 4R2HA 4BLQA 1MO4A 3KQKA 3AVYA 3NELA 4Y7NH 3HGBA 4A3KG 2NZ8A 4HDCA 2OV2A 1L1OC 2GCPA 4KV9A 1KRSA 1ZCBA 2CWAA 1HR0L 2G6BA 1E1OA 5LMNW 4A2WA 2G83A 1JPNA 1A82A 4KYIB 4GLVB 2PMKA 1X8LA 1Q7YC 3LW8A 3ULLA 4S2EA 1H9SB 4BY1G 1OW3B 5AJWA 2OCEA 1YZLA 3BZCA 1T8TA 1MRNA 3I8XA 3IHWA 2G0NA 2C98A 3LH5A 2ONJA 2W00A 1U8ZA 1CKNB 4E03A 4E22A 1OLOA 1GUGA 2GZDA 1RL2A 5FTLA 2NO6A 4YCVA 1Z08A 3NEJA 5EP3A 1VQDA 2VTKA 4GZMA 2RHMA 4H9GA 4PQFA 2DB3A 2CE2X 4LHYA 3NTUA 1UM8A 1XD9A 2JEBI 2O0HA 2VIIA 4B71A 2CXXA 4D2IA 1QVFA 4DLSA 4F7WA 2HEIA 4QHSA 1K9MC 2ZR0A 3LAWA 3TH5A 2Q0HA 1KK2A 1JR6A 3L0OA 1QF9A 2G88A 3S1RH 2DPXA 2MSEB 2QGZA 3ULPA 1OJLA 1UFQA 2VRWA 3ASZA 3LX5A 4O2RA 4RZXA 1IN5A 1ZMXA 1KYIA 3NEMA 2HYDA 3CONA 3ICEA 1N3BA 3NDPA 2AD5A 3ZVLA 5FOTA 4JI7L 3OTOQ 5FLMG 5CB6A 4OWXB 4PC1A 4TMXA 5A4JA 2WJYA 1QZXA 4TYNA 2FFQA 3DO6A 4JI6Q 4C3ZA 4CZ2A 2KA7A 3KFUA 1E9BA 2XX3A 1H8EA 2ZYUX 1F3OA 4EJSA 4B3XA 3GD7A 4XVUA 4W9MC 1SZPA 2NPFA 2O8EA 5IRCD 4DR3L 1V8QA 1YHNA 5JEAJ 1KI6A 3K70B 1DAHA 4RFSA 3UDGA 5M3MH 1EFCA 2WWWA 1SVMA 2OXRA 3HFZB 4HB0A 3KDFA 3EPLA 3CPWA 1FNNA 1GILA 2A6HC 3WNBA 2O8CA 3GJ4A 3W5OA 4DV2Q 3B2EA 2CFMA 1K5DA 2FJUA 3DZ8A 3VTKA 4JYBA 4GDFA 3OAAA 4HAXA 1G7SA 3RS3A 2J3EA 1NJGA 1GFIA 3D4RA 1GG2A 1QG4A 4JS0A 4WBSA 4AYBE 2YKGA 1GP2A 4R4OA 1HT1E 2V8OA 4BLOA 3CF5A 1JPJA 3RNLA 4AYTA 2H8KA 4IDQA 3PR1A 4HLCA 2EW1A 4LFCQ 4N1AA 1ZM4A 3LLUA 4LFCL 2FA9A 1KSFX 1N6NA 1NVVR 4DLUA 4GBMA 1E69A 3HYTA 3HOVH 1W5TA 4IXMA 4PSAA 1XBTA 3REGA 4DCUA 4F4JA 1P72A 4MDFA 1W3SA 1NSTA 2UUCQ 2XNDA 2ZJYA 4DR1L 3B1XA 3EIHA 4JI7Q 3QY0A 1NIPA 3BJUA 3PGZA 1N2CE 3DLLA 3DZDA 3Q5EA 1LS1A 2ZRKA 4IHQA 2UVQA 3EQLC 1IBMQ 3UXMA 1Z7TA 2OT3B 4KBFA 3NBZC 2DWOA 1QHGA 5DHAA 3RNUA 1TU4A 3VKHA 2OLKA 3K70D 4A3LG 3A6PC 1IBLL 1W0KD 1G4AE 3HYRA 4KHZA 4A0GA 1H8ED 1XD2A 2QQ0A 4C7OA 4JLOA 4A3KH 4HAZA 3JVUA 3FMCA 2YTVA 1UEIA 3PIPA 3S1AB 1GD7A 1TUEA 2IF2A 1E22A 1UWVA 2PI2E 2FEOA 1X9NA 1AN0A 3H86A 2V1UA 4LHVA 1PVOA 2IX0A 3OEED 4DR5L 5TDHA 2E74C 5BQ5A 4QFMA 3TAHA 2I5LX 1PH7A 1DAFA 2IHBA 1D5CA 4JLNA 2HXYA 4JCVE 2JJQA 5C0XJ 1DVRA 2OG2A 3EZ6A 4OBEA 4UJ5A 2V7QA 2A78A 3HOWG 3P4XA 1G291 4RD1A 1HNZL 1KAOA 1DBSA 4KO8A 3I73A 4TTPA 5AJZA 1H9JA 4AIIA 4O25A 2QL6A 3ZIAA 2ZU6A 2UUAL 5J4VA 1WCMH 3FDIA 5B58C 2GWHA 3CB4A 4DBLC 5JRJA 1AZSC 3Q5DA 2VQFQ 4TQUS 3VR4A 1BMFD 3CR7A 5HCIA 3GLIE 4U02A 2AWOA 4A3DH 2BE5D 4HJ5A 1Z6GA 2WKQA 1IXSB 2ZR9A 4BA1I 4PZ6A 1EIYB 4PAQA 3U44A 4DNRB 1E94E 2E1RA 1CKOA 4QC2A 4ZCIA 4TT3A 5EP4A 2O8FB 4GPTA 1CR0A 3H94A 2DR3A 3T1VA 1Y3AA 2OBMA 4PAMA 1LTLA 4O3MA 1CRPA 3AFQA 1YZUA 4GFDA 2W6JD 3CRMA 4NYIR 4Q5IA 3Q8XB 4DEXA 1AQYA 2RGBA 1OXVA 4NYMQ 2IUUA 4RD0A 2EYQA 4JIMA 1VQIA 1CTQA 1MOZA 5K8LA 2V3CC 1PH3A 4BLPA 4IPDA 4IFDJ 4GI7A 3DKPA 4XVRA 5IP9G 3T1OA 2XAUA 4MRRA 3ULJA 5HKKD 1HYQA 2EFHB 5G53C 4LYFA 1GSIA 2CE7A 2OBLA 2R6GA 1Q1ZA 2CMKA 3AM1A 1R8SA 4TMZA 1IONA 2WZQA 2EVWX 1Y8OB 4GLXA 1HTWA 1J2JA 1I4LD 1NVWQ 2RGNC 3I92A 4TLCA 2ZJOA 4CIDA 5IYDG 1YZNA 3SU8A 4CVNA 2IS2A 5ELNA 5SZKB 1XJCA 3ZVRA 4DPGA 2VF7A 2Y0SE 4O2DA 3T1YQ 1HNZQ 2GA8A 3NDBB 3SFZA 5EE1A 1Y1WH 1KO8A 3EA0A 4GNKA 1X65A 2Z4SA 4JI8Q 4URXR 1VQNA 3IQWA 4DV1Q 5KNCA 1IBLQ 2ZJRA 1FMJA 1HEIA 2VQFL 3IILA 4PZZA 3T56B 2RAPA 2ZI3A 2C2HA 4IFEA 3SEAA 2UXCQ 2IYXA 3UWKA 3PF4A 2JLVA 3R9IA 5B30A 2XOKA 1J5EL 4GKJQ 1UBEA 1DG1G 1M6NA 3QXHA 3VHXA 2D5DA 4ACAA 3C5HA 4H0LC 4FCTA 4KN4C 3VDYA 1XF9A 4HJAA 4TL7A 1S2MA 5JS8A 1VQGA 2VBCA 2DGYA 1P61B 1SULA 4DLVA 2NO0A 5G3ZA 4LYAA 4RD4A 4A93G 2E2IH 4JBJA 2WBLC 2QPOA 4OI4A 1AK2A 4FWTA 2VP2A 3UDFA 2NTYC 5EP2A 5J3BA 4AH6A 3C41J 1DADA 2A3RA 1AS0A 2RF4A 2AHOB 1T4GA 2RGDA 4KAXA 4DR6Q 4QL5A 4JI5Q 1EFUA 4DR6L 4JL6A 3AB3A 4OJQA 1VCIA 4DIEA 4JSYA 1GAJA 2X19A 2WAQE 3SJZA 4BASA 4LBYA 1NVXQ 4PO9A 1G51A 1Q20A 1A7JA 2ZS7A 4L9SA 2BMEA 3D6TB 3DEFA 4DT1A 1G20E 2QMUA 2BA1A 1X3GA 3S1NH 2FX3A 1P2UA 1XTSA 1ZM3A 2R7ZH 5FBQB 5M5YH 1BS1A 1CIPA 2DYKA 3PFIA 3RHFA 4LFBL 4X65Q 1J7KA 2REXB 4A6PA 1BVSA 4OXPA 1T3HA 1TU3A 2ZTCA 1CUKA 2E76C 4L8GA 1H9RA 2VY3A 2ZRNA 1XJVA 2K14A 1P2SA 3PUZA 1KDTA 5HR5A 1CBUA 1WOCA 2DFKB 1E1RA 3R9XA 1KRTA 3TZUA 4M1MA 5F9FA 1MT0A 1AM4D 4MRPA 2OTLA 3CX6A 4B47A 1EWHA 3KQHA 2VQEQ 2UXCL 3HOVG 3NVAA 5D3MB 1SVIA 2AKYA 2CNWA 2VO1A 1HE8B 2BCJQ 4A92A 3GJ8A 5B64A 2KBNA 2PH1A 1QHSA 1HR0W 3GJ0A 2ZS9A 3GLHA 4HI0E 3UMFA 5K8TA 1ZP6A 3N5CA 1KJWA 3BFKA 2GXSA 2KSQA 3GPLA 2XXAA 1ELOA 2CBZA 1VF5C 1RW4A 2GEUA 4Q7JB 3SYKA 4HLUC 1UKZA 4HB2A 2AX4A 2GTPA 2ZSEA 3CPFA 1HA3A 1IYUA 1Z0JA 3IFTA 4F38A 5GQOA 2PT7A 3TR5A 4UNRA 4BQSA 2D2FA 2QTVB 2PJZA 2QEQA 4IOLA 3OIVA 1JEEA 4I81A 1OE0A 2WWYA 3F5FA 4LWCA 4Q47A 1JJ7A 4QXAA 1K8MA 3H4MA 2R8RA 2LKCA 1EWIA 3PUVA 4C3IH 3BZKA 4DV5Q 1PJRA 1YU9A 4GT1A 2XNSA 4TWZA 2REOA 4J15A 5KSOA 2ZI6A 3RVBA 4BFUA 1OKKD 1N6KA 1GUSA 1VECA 2NZHA 4LF6L 2R7DA 1BBUA 2OFWA 4OQLA 2WAQG 1YHAA 5IYBG 4LF6Q 1Q3TA 3IO3A 1UJ2A 4X8HA 4DKXA 4JBYA 3KXIA 2IYLD 2F43A 5IYBH 4CEHB 1G5PA 4RJLA 4DR4Q 4EQ5A 4V0OA 2QZ4A 1JQJC 3NENA 4OHVA 3X1DA 3HKZE 2X8AA 4QJFA 1DGSA 3BS4A 2EJMA 4DXAA 2GJ9A 3OZXA 3RC3A 4CT5A 2QBYA 4LF5L 2GZHA 1OPXA 1KDOA 1QHXA 4WOPA 2JLUA 4GN5A 4GKKQ 3AQ4A 2QBYB 1R5OA 1ZUIA 4BEJA 3QEJA 3CCQA 3A1WA 3DMNA 4KCGA 1B8AA 2PCLA 2YOHA 1RKBA 1CKEA 4FMCF 1IXZA 1DO2A 1US8B 4HB3A 1XDBA 2F1MA 4P32A 4B2PA 2E2JH 5FR1A 1E0SA 1YQTA 1SKYE 2B63G 2CLCX 3CNLA 5FL3A 5KTYA 2D7DA 2ZJQA 2VH5R 1L2TA 4WJ4A 1K0RA 2WJIA 3F3YA 3QF4B 3SHFA 3K8YA 1HZCA 4P72A 1IY1A 4JT2A 4PZLA 1N32L 1SXJB 4QM7A 4C0QC 3T1YL 2CEAA 1NE3A 4MRVA 2SHKA 4X62Q 1ZIOA 3BORA 4X62L 1X54A 1GIAA 2CQOA 1GRRA 2BOVA 3IBGA 2BJVA 3KJHA 4M9QA 4TMVA 2ZM6Q 1JMCA 1NY5A 2NOAA 4ZDIA 4R2IA 1LS6A 1NJIC 4BEBA 1XMQL 2R9VA 3IEUA 1KTVA 1G3QA 1GL6A 2OILA 2R93H 2QPTA 4EJSC 3D0FA 3ZVMA 2NO7A 2Q2IA 2FN4A 4ZIRA 3OW2A 2ZRGA 2I5MX 1FPMA 1S0UA 2AKWB 1CJUC 4HLQB 1GRNA 1ZRHA 4QBIA 2O5JC 5DI3B 1W1WA 3CW2A 3RR5A 4DUYQ 4LUOA 2ZITA 2OEPA 4EPYA 4JZKA 1WCV1 3EW9A 3AH8A 1JAIA 3M4OH 1UBGA 2DWQA 5EE5B 4BFZA 2WB1E 1EQQA 3AF1A 5FFMA 2H57A 5E3HA 1C1YA 1KSJA 2RGAA 2YWFA 1I2MA 5D3MA 2HIVA 2DBYA 1Q90A 1M1KC 2NZJA 3DDCA 4P4SA 1DARA 1GKYA 4QGFA 3T12A 3ZGXA 2A5GA 2K75A 4L8JA 2IXEA 1K8OA 1ZD9A 4P4SB 1VQKA 3IIKA 3H3VH 1MRSA 4NMMA 1ZYUA 3VNUA 2O8EB 1KK3A 2QA4A 4DR3Q 5ELXA 2R2AA 1PV4A 2GF9A 1QRAA 4KFSA 2QEXA 4DLRA 2DNCA 4Q9IA 4X6AH 2JATA 2QU8A 3D8BA 3LD9A 5DI3A 3C4JA 3EXAA 4Q1AA 1N6PA 1X55A 3C15C 4DV4L 3OE7A 2H18A 3B8HA 3M4PA 4IFDG 5JHGB 5GROA 4QGGA 2B6HA 1TUIA 4LF9Q 1CSPA 1ONLA 4PZ8A 2JDIA 3DPUA 1YNJC 2VHTA 3W9YA 3A0JA 4LRWA 1BIFA 1XTRA 3CAMA 4HUTA 1WRBA 4GZLA 3VKWA 4LF8L 1W2HA 1ZC3A 2C5LA 1SKYB 2IEYA 3HDTA 2XJ9A 2NN6G 2F1IA 1IN6A 1N0UA 1VYTA 5K8UA 4GKKL 1XMSA 1XMQQ 2CL7X 2WWIA 4IDNA 3U61B 4Z8YA 2GETA 2ZT9C 3Q8DA 2AXPA 2B8FA 4L15A 3AVVA 3GJ3A 4NXNQ 3QPVA 1OB2A 4FIDA 3CRKC 2IYWA 1JT8A 3AB9A 3WYAA 3B9QA 2BV3A 5CYPA 1Y63A 2K5NA 4LF4L 1FJGL 1S1MA 1YZTA 4B3RQ 2J5XA 2R6FA 3Q72A 5GAHC 2YC4C 3IPXA 2ZSFA 4GMDA 4IOMA 4HIDA 1KI6B 5G3YA 4BLSA 1FL0A 1V43A 4AKEA 4JVSB 1PH9A 1CEEA 2GCOA 4I1UA 3EIVA 4DDVA 1DG3A 4PC3A 1CF4A 5KPJA 2KBEA 2VQSA 4A3MH 3PUWA 2IYVA 5TVKA 2AUKA 1E0JA 4LV8B 4DV1L 821PA 1N8RC 1JR3E 1QZGA
chains in the Genus database with same CATH superfamily
4CFYA 1ORIA 3WK4A 1YNSA 3PPYA 4R9NA 4ZQCB 2GF2A 2Q5QA 1T3LA 3Q2KA 3ADCA 1E2WA 1JJVA 5HQTA 2RSNA 1Q83A 1DAEA 4UHHA 2PZEA 3ZDFA 3S2DB 4ZZ0A 4EPTA 2ZJPA 1H9BA 3CRLC 1NASA 4P4UA 1QYIA 4GOOD 4BMSA 1F1BA 1NLUA 3KYDA 5L4SA 1IHPA 5JDIA 2HMTA 2N1MA 4IHAA 1JHVA 2J0VA 4NMXB 2QZZA 1Y4UA 3OPXA 3OEYA 4CMIB 3IAHA 2HCCA 5SICE 1U1IA 2G5GX 2IU3A 4NXML 1PEDA 3BX1A 2D59A 4B48A 4I3GA 4D92A 1RYFA 2ATEA 5DI9A 1J06A 4EB3A 3DAFA 3W7BA 5JMWA 1ZW1A 3TLYA 4NCHA 4L73A 1W19A 1VQ7A 3TJRA 1WD7A 2P3SA 4AJJA 1DKUA 1NVFA 1VL1A 1XZMA 1XP5A 2NO4A 3T7SA 2PZUA 3RROA 4Y7DA 2O6HA 1XG5A 3I4LA 4FEYA 1VQ5A 2X8JB 4O1HA 3FUVA 2C96A 1VHDA 4M0MA 5DXJA 4C0WA 1UOPA 2P2ZA 3MB5A 1KL7A 4EFDA 2GZMA 2M9VA 2GF0A 3OJ0A 1JFVA 1USKA 5J2UF 2C59A 4Q6BA 1H94A 2OZEA 4O1MA 4GX2A 3RMHA 4IJKA 2XZLA 1P77A 4UREA 2EIFA 3S15H 2ZKLA 3K2IA 4BNVA 4D6XA 1QOHA 2J0TD 3RLOA 1LTGD 4F46A 3HXPA 2H2HA 2K5VA 3DWAA 4BJHB 1L5QA 2JA7B 1HYEA 1JIKA 1ZL0A 2DRIA 2F3TA 3ASYA 3HA7A 3KKEA 5IJ9B 2IHJA 1H6BA 2NG1A 4I50B 1DXQA 3FMIA 4UEJA 3JVVA 3OP1A 4RMJA 4P3PA 3V97A 1GHTA 4N7RA 2I8AA 2NSLA 3FBTA 3PFNA 4BMVA 5CA1F 2WU3A 1NP6A 1C4WA 2EXXA 1S8OA 2VUMG 1WXGA 4Q3AA 4L5BA 2BH9A 3RVLA 2GYYA 1NZDA 2QYHA 1DQZA 4KOEC 4KV6A 1MLDA 1KS9A 1R5NA 2ACVA 2LVBA 4LJ9A 4GXRA 4OKIA 4JI0L 3E2IA 3HOUH 3VKGA 4D25A 1HV8A 3M5DA 1A15A 1PQUA 4P3KA 4C08A 3BYZA 1IYVA 1CNFA 4TLAA 4A6EA 4D9IA 3PGLA 3TAUA 2TMYA 2VAPA 4OB6A 3I8SA 621PA 3C6YA 1WY7A 4NHEA 4LBZA 5HMLA 3UJHA 2GH1A 3L6CA 4ISBA 4UDUC 4KFTA 5B55A 2IS1A 2J59A 1OAOC 1NNI1 3ZCTA 4ZAXA 2VDRB 5ED0A 4BLRA 2XR1A 5GP1A 4A3CH 4EVRA 3PVSA 4IF4A 2JJ2A 4S12A 3HZRA 4YJ3A 5E0OA 4OGGA 1H3FA 1A2UA 2KX7A 3D3KA 4LJAA 4Q4AA 3TUJC 4A8HA 3RAGA 1LBHA 3UE0A 2I54A 3LW7A 4PNPA 5EJIA 1NFQA 3T06B 4B40A 1C8LA 2Q4OA 1FXWA 2QG9A 2V7GA 3EZLA 4UULA 2F0QA 1NJ1A 2GERA 1XWEA 5AK6A 4B09A 1CUDA 1N2HA 2JA6G 5GOZA 1G59A 3ZBPA 1L7BA 4HJ9A 3BMXA 2G9VA 3PNSA 3WZMA 3V05A 2H51A 1WD0A 3H4TA 3LOPA 1A8PA 3CSSA 4Z9YA 1LSUA 3NNSA 4BYGA 2UUCB 1JMYA 3BA6A 4QT0A 2EY1A 1ESFA 3IUMA 3UKJA 4BVAA 4AG5A 2ZTSA 4S3MA 4DMMA 3ES9A 2V9PA 3EUFA 5B5SA 5IYDH 3VI4B 1TADA 1WKBA 3DFMA 4RYLA 4LF5Q 3Q8KA 1M0EA 4GQBA 2FMUA 5T1IA 4O2AB 3BT7A 1T0JB 3ECAA 4U0JA 2G6TA 3TSSA 3HPRA 2EBHX 3CKLA 3E9RA 4NDZA 1ODSA 3GQVA 2QTGA 5SYMA 3MD0A 3B9PA 3RU3A 1KZGB 2JAPA 4IQGA 1QC5A 3EXHB 4GWLA 5F23A 3SQWA 4JBLA 1KDAA 3FE2A 1WXQA 2X0KA 1RJGA 4H0NA 4HMQA 2SKCA 2J6BA 4M8NE 2A69C 1MDBA 2OWDA 2YWGA 1NXTA 4LC1A 1Q7RA 3RS0A 4EARA 5BRJA 4H44C 5ALNA 1R9NA 1DCZA 2JLZA 2FQ1A 3N9IA 3L07A 3ZJYC 3NETA 4FUQA 4J4HA 4ZKBB 1PEYA 4P31A 2Z09A 3ROXA 3VJLA 2IH5A 3FY4A 5DBHX 1KDBA 1XNRQ 1UR5A 3CEJA 4P98A 4I8IA 4ZI5A 1EBFA 4EMBA 1EWQA 2WE8A 3E81A 3WDLA 1KY2A 1UMCB 4YJFB 3VJRA 2H3HA 4D9MA 1GNRA 4LRYA 3EF1A 2B29A 3UFXA 2WUEA 4RPJA 4ZHQB 5EQJB 4RCVA 3VH2A 1HRJA 4PO1A 4HT3B 2QRZA 521PA 4URVR 3MHTA 3DP9A 1ISIA 2AUMA 2HRQA 4IDDA 4UDYX 3VDQA 4MKIA 3LXUX 3WOHA 2M6LA 3LWDA 1JLRA 2HFJA 2XYPA 3C24A 2K04A 3KTOA 4CKCB 1VIAA 1K83H 2FPUA 3K05A 5CGZA 3VO1A 5AKGA 2NVXH 1DTWB 1U3TA 4XGIA 2QAJA 4MP8A 2K5DA 2XMQA 5ESXA 5IFKA 4IQ8A 2R2GA 4IJWA 2BMAA 4RXMA 4NF2A 4K03A 5AR1A 3S2GA 3SBEA 4ESEA 2Q8TA 1E58A 3FKQA 4HATA 5GGXA 6CHYA 2V1CC 1E8DA 3MM4A 4IEFB 1R66A 1CJKC 2I4LA 2X2EA 5C18A 5I7HA 1PS0A 2F0PA 3F2UA 3WGMA 1G21B 3I70A 2ZAYA 1W44A 4UP7A 1ZHFA 3GU3A 3HS3A 1A0IA 4RYDA 1WBBA 4U63A 1SCUA 1Z4LA 3S4YA 5D3MA 4LTNA 2F0UA 4PNYA 1A88A 2W48A 3AC0A 1B4OA 3M4YA 3L93A 3HACA 4FHFA 5FQNA 2NSJA 2QVGA 1TYAE 4NS4A 1MAWA 1Z0ZA 3OLCX 4FX5A 3DZGA 5JXHA 3NBQA 3W1EA 4C0AC 1N25A 3FAKA 4LZNA 1GVNB 4A8JA 3ZLJA 2ZANA 3LF2A 5CYGA 4A3LH 4P82A 4IFBA 4TZ0A 1RWBA 3D8RA 3JS5A 1KDZA 4V24A 1NVVQ 4ZQFA 3JD4A 2VDLB 3KD2A 4DLPA 4C6TA 5LUAA 5KYIA 1E1CA 2DFPA 1D8TA 3GTJB 2DPMA 2ZUFA 1I7PA 1U1CA 4GPEA 4I99A 3EPRA 5IDVA 5KNDD 2R3SA 2ZIFA 1L5VA 1PGJA 3BDLA 1JLLA 3C16C 3DZCA 2Z58A 3E6ZX 1Z6HA 4ZPXA 3U5ZB 3P4UA 3RNOA 1NWHA 1QG2A 5DMHA 1AQ6A 1EA5A 1HDXA 3ZK7A 4IQZA 3DC2A 4R9VA 2ZGVA 3CRVA 4UU8A 2C31A 3V00A 4XPIB 2PD6A 4UBMA 2V9CA 3GRVA 3H65A 1K6IA 3ABSB 2UVPA 4KXQA 1G17A 4LYGA 3EFBA 2NW6A 1A4XA 2IXTA 3ANMA 3BIXA 4Q21A 1CS4C 2HBRA 2IHYA 2P65A 2J7PA 1QONA 4KXVA 4Y30A 2VSNA 1NBMD 4FHZA 3RF6A 4CCYA 4EA9A 4QYIA 5IF9A 5K5EA 1TEVA 5CV5A 2ZB2A 3DE1X 3F6PA 2WIBA 4HGOA 1ZH2A 3R3UA 1Q1NA 4B44A 3AEUA 2B8JA 1GGJA 1EH5A 1ZKMA 1S2GA 4AJNA 4IUYA 3IP1A 2IDZA 1P3DA 3STHA 1SO8A 2XWQA 4ND2A 3JZIA 1D1KA 3HY4A 3H99A 3TTVA 4B6SA 3WLPA 4EY6A 1N6LA 1VPLA 1YJBA 3GTQB 3A3YA 1S4ZA 1FU8A 2X2PA 1Z2DA 3V6LA 2HWUA 3K53A 3O13A 1XDWA 1A9OA 5AI5A 2HHJA 5EUCA 3ZXYA 2ORIA 2GN5A 2YQZA 2NSDA 4OCZA 3UPTA 4Z4HA 1G9SA 2QE6A 4JEUA 1QO0D 4AFNA 2HSDA 3N2GB 5BSGA 3CKMA 2E2HB 3O8OB 5BNIA 1WPXA 1P9LA 3N2GA 2WD7B 4DZTA 1XTQA 2A30A 3SOZA 5C8YF 3NVKI 3PGVA 4DR7L 4D3DA 4RY2A 1DYQA 4WMLA 1X7YA 1WXDA 4J0IA 3RS5A 1HTPA 1NNLA 4IIXA 4RESA 1Y1QA 2P5SA 3NVMB 2QL5A 4UBJA 5K8CA 1IBKQ 5ALWA 3ZJ5A 1SU8A 2C35B 5C4JB 2IZ1A 4F21A 3KJPA 1YIDA 3K7EA 2FZEA 4H02A 2R44A 3CUSA 1VSQA 3GTOB 2F9MA 2IYFA 2R86A 3FPAA 3RZOB 2A84A 4NBRA 1YI0A 3TW4A 3TW0A 1G63A 3D3NA 1IHYA 4PRKA 2PX6A 3Q24A 3DFIA 5H70A 5K3FB 4K8OA 4TXNA 3ZIAA 4BZQA 2YN2A 4F9FA 3RJ5A 2ZQYA 4ARZA 1AMNA 2C4NA 3FSRA 2XPCA 4QQBX 4FFDA 2XH8A 3NTLA 1N2EA 1KMNA 1ZIDA 3OZ7A 4BP9A 2NUPB 5LP6C 2AOWA 4O02B 4P4LA 2IU0A 4QG7A 5AJTA 1S01A 4L27A 4IZHA 3V80A 3B85A 1AEXA 3CC2A 2YVUA 2E4XA 1Z8HA 1ZD4A 4NBLA 4AD8A 1W2GA 3ZKAA 4R9WA 2X8LA 1FY2A 3PDCA 4M22A 1AZLA 4POAA 5FBRB 5HKLA 2QSYA 1T91A 3BXZA 3VU3A 1XQWA 2M32A 1CSQA 1EIFA 1N75A 1V3QE 3TBKA 4UXJA 3INTA 4IXDA 4RV5A 4UARA 4KNWA 1VRVA 2D74A 3D3WA 3KM0A 2HRCA 4I4TF 5EZYA 4MUJA 1L4NA 1UAYA 2P79A 3I0MA 3PQIA 3F8SA 3NM4A 1YJAA 1N3LA 4QGUA 3N0RA 3FUTA 4ER5A 4B3SL 2GEVA 5DBIA 3ZV4A 4LF4Q 1FJGQ 2ODAA 4BZXA 5BQ3A 7REQA 4B7ZA 1RYHA 1HSOA 3L06A 5LC1A 1U9IA 2IRWA 4Y2JA 1JKMA 2NBFA 2ZWPA 4MS3A 5DLQC 5CTJA 3ZW9A 1DZIA 2FG5A 1CXZA 2RHHA 1LPBB 1XHFA 1ZMRA 1SYBA 5HGTA 2B21A 2VH2A 3A6KA 3L8DA 1HEYA 1NUSA 4XWTA 3I5UA 4LECA 1JW9B 3HDGA 2GZSA 3H2YA 2B3GA 5A9SA 1DMSA 1NRXA 2Z8LA 4B6PA 5B7PA 2QE7A 2J5RA 3BMNA 3NQIA 1NM5C 3QH4A 3G1UA 5H9VA 4F9TA 4FFRA 4URZR 1VCNA 1KAAA 3ITKA 4JJZA 1LWOA 1UOQA 3T1TA 4HX9A 3H6GA 3I28A 1HQMC 3K5OA 1KOFA 5H8WA 3URYA 2WAOA 2HQBA 3PQ7A 5EJ7A 1YVPA 2H4OA 3OUTA 4GPIB 3WWVA 1L5KA 3ZCSA 1V1JA 4ETMA 4N54A 4EW1A 3V33A 2MQHA 2F90A 3DXXA 2YN0A 4CLXA 3O8LA 1FP2A 5FNVF 2DLCX 2B0JA 4K9PA 4YCWA 1EFHA 1T4CB 3E0QA 1GTZA 4TV9B 2LSSA 4M9ZA 1JNXX 2AW5A 2JK8A 3T9FA 4AQ7A 3KJGA 3R0XA 3FDZA 4UOQA 4BRWA 4JGGA 4C7KA 3KKPA 4FDUA 3VU9A 2C7VA 1VBFA 1Z4MA 3AV3A 3VDRA 2FPPA 3UBTA 4EZEA 2Q3CA 4R01A 3RR2A 4BBSG 3H2ZA 2OESA 4L4XA 1WU7A 4NZPA 1HH2P 1PZHA 4DUGD 1RQRA 3O21A 3ZVNA 4KODA 4GKAA 4EQ6B 4XQNA 1BYUA 3B6EA 2W83A 1DJRD 3EROA 1EWVA 5EXPA 5F73A 4ZU3A 1UBKS 2CDCA 1DWPA 2UKDA 3FD8A 3GIWA 3QOXA 1GCOA 3CC7A 2CZQA 1DG9A 3JQGA 1WABA 4I5FA 4C4YA 1O97D 1XRJA 3I32A 4B08A 2A94A 2P6NA 3GFVA 3EDMA 1A2KC 2O0JA 1B14A 4JOCA 1YQWA 3LUFA 1HTLD 1OH7A 3RVOA 3C4QA 4DR1Q 4L6TB 3OUZA 3OA0A 3DCNA 5JWHA 4F8YA 4OK3A 3LNCA 1KI2A 1FMFA 3UF0A 2I0FA 1WJJA 5ELEA 3U16A 1P75A 3BFPA 2JHFA 1M72A 4LF8B 1W4LA 3K9LA 4DAOA 2IYYA 1OPRA 5CNKA 2JS7A 1AGPA 1E3JA 2C7BA 2P78A 3CPSA 3WMRA 3D6WA 3AL3A 1Y1LA 3C3YA 4OFXA 1WMEA 4D8WA 1ZUNA 4K9LA 4ZWNA 3F71A 4D0RA 2G9RA 4X92A 1M74A 1OI4A 1Q3KA 5D84A 3OZIA 1SJHD 2PDAA 2IL8A 1TS3A 4RIGA 4DIDA 5EQFA 5IJ0A 1L4GA 5JD6A 2JRCA 2LZ0A 2WVJA 4X97A 1Q82C 2F8MA 2BBSA 2KLBA 2VF8A 4PZCA 3LPAA 4C3OB 1JDBC 2VYVA 1I4RA 1PJ4A 2A5DA 3QG1A 5K0GA 2NACA 4OQ4A 1RJ9B 3I61A 3MGAA 2ENUA 1XZNA 3C3LA 2PZFA 3FI9A 3NOOA 4MB2A 5LLSA 3WKBA 1C41A 1YK1A 2F17A 5L3SB 1JQYD 1VHWA 3QUCA 5GTDA 5TPZA 2RDMA 3UXHA 2R6ZA 4B2LA 4TMTA 5L7YA 4P81A 2AK2A 2EFJA 1GCIA 1RPAA 4RKLA 5BN4A 4EF5A 3VM6A 1FYXA 4K28A 3LE8A 5JY1A 1DL5A 1X70A 4K9DA 5KDOA 4YCMA 3E7XA 3EULA 2I67A 1F48A 4GX0A 2HQSA 1I4QA 4AYBG 3EMKA 2ZBRA 3HJCA 4JCOA 2X0EA 3DE7X 3CJQA 5C4XH 3ROFA 2PANA 4MS4A 3W2EA 1COWA 1A8HA 2JEAI 3PJEA 1IY2A 3A9WA 5PGMA 3TSAA 5AJXA 3FNGA 2HUPA 4HUJA 4ZC8A 3UVEA 1WIWA 5CMDA 1YKFA 3GB9A 3T7TA 2C0QA 2HV8A 1YR7A 2HWKA 1RJDA 4I14A 1N8KA 2PVSA 4NCBA 2BLNA 2ODWA 2B2WA 1AN8A 2HNKA 5KNCH 5CCBA 2XRZA 5JPIA 2IIQA 5DOZA 3WP0A 3LOQA 5KTRA 5LL6P 3NMUF 4DJDC 3DHVA 1C1XB 1RRFA 3PA6A 4MLZA 3IOEA 1T29A 4H08A 1EVLA 2HIMA 4YUXA 2LE0A 3CZAA 2JGIA 3VC1A 5K3OA 4OO3A 3KLWA 2XUFA 3GFOA 3LQ4A 5KVQA 4IWXA 3U09A 1NJ6A 1MXHA 1NJFA 4ODIA 3W7AA 1GPNA 3ETGA 2P4SA 4MICA 3TAXA 4REOA 4IDHA 2RHOA 4KU4A 1BEZA 4GM4A 3KDAA 1Z2NX 4EKNB 2AN4A 3O4VA 2HA2A 1T1RA 4GNXC 1FX0A 4R5HA 3IJPA 1F8XA 2C58A 5DTRA 2PSFA 3TTXA 1NWCA 5FJ8G 3JQPA 4NJEA 4AO7A 2A14A 4M8AA 1KJIA 3U4AA 3DJYA 4I7EA 2WKSA 4DFDA 4GOPB 1L4YA 3JTMA 5EG5A 2F0MA 4US1R 5EXXA 4A0HA 1CERA 3Q4GA 1H4QA 1GXSB 3AF2A 4TN5A 4X64Q 3UJ8A 5CVUA 4EABA 2CHQA 4CE6A 5FTNA 3RRBA 2OHFA 2RKBA 3M4QA 3PMFA 1E2BA 2WD9A 1MABB 4JQOA 1XJ5A 1AURA 5C5IA 2BISA 4K7JA 4NW2A 4E2WA 1W85B 4H4DA 2HADA 4EUHA 1FDVA 2WUWE 4FLEA 2WVGA 3OOHA 1CZWA 3OQ6A 1D8AA 4C14A 5H1SE 1C2TA 3WQSB 3AUJB 1XVAA 4D99A 3PHLA 1G8YA 2NX2A 5GZ1A 3AUUA 4OONA 4YJ2B 5FEUA 1F7UA 3PQDA 3OQHA 1X7WB 4NATA 1NLFA 1W34A 4G2NA 5C3EB 4IUNA 4UXHA 2VXWA 4IJLA 2ECFA 1U9RA 4E88A 1KFCB 2F3WA 2GEKA 1EL0A 2VQ6A 3SX2A 4FB5A 2XTNA 1RJFA 4MKXA 4ITRC 3EG9B 3THSA 2NZWA 4RMNA 1FUKA 2GN4A 3A1EA 2VB2X 2A2ZA 3ZS8A 5C37A 1Y3BE 4BLVA 1V8BA 1UEXC 3ONEA 1CIVA 3UK6A 5FBKA 4IPGA 4IURA 5C5LA 1YKSA 2HA6A 3EWSA 1E2JA 3Q87B 4ZDKA 3ZOZA 5KTNA 5KIXA 3OEWA 2OLJA 4RIEA 2B1RA 1CSEE 4UTOA 4FBMA 5GVSA 2B3DA 4ABTA 1E1NA 4UMVA 2ZT8A 1IMJA 2CNNA 4YCAA 3IQGX 1BXTA 4J1TA 8OHMA 4K2KA 2ZI9A 4QICA 3F2BA 2ECOA 3MIIA 1E4VA 1VGVA 1VQ1A 3FOEC 1OWPA 1CJCA 2O0LA 2ZRLA 4JC5A 2HW8A 4MR9B 3JRWA 121PA 3V1MA 1RCTE 1RWQA 1C50A 4Y6GB 2CXSA 4Q0FA 3E0JA 2QAGB 4PY2A 4X6LA 3TQTA 2VTEA 3X1YA 4E21A 3SP1A 2DQ4A 1B7YB 2BKEA 2C5CA 1I3QB 2FEAA 3QHQA 1SBBB 1QGOA 4G01B 4A3IG 3NHJA 1TR5A 3EGEA 4MQEB 3PTAA 3C2QA 4D4MA 2FSGA 4MWTA 3FTPA 5I9IA 5FOVA 1GXSA 2QTFA 3S17B 2WMOB 3D8NA 5BN3B 1R4ZA 4LTMA 4O2BB 5IG2A 1AGRA 1XQ6A 4JIGA 3FHOA 4YP7A 5J47A 3KU4A 4JBNA 3FZYA 1FSFA 4V0BA 1O8CA 1U2EA 1XMPA 3EIQA 1CQXA 3LF1A 4HNGA 3PX7A 3I34X 4FDTA 1GHKA 5AJUA 2CKDA 1YNND 3MEQA 2ZTEA 4G41A 4GLOA